Identification of GLUT12/SLC2A12 As a Urate Transporter That

Total Page:16

File Type:pdf, Size:1020Kb

Identification of GLUT12/SLC2A12 As a Urate Transporter That Identification of GLUT12/SLC2A12 as a urate BRIEF REPORT transporter that regulates the blood urate level in hyperuricemia model mice Yu Toyodaa,1, Tappei Takadaa,1,2, Hiroshi Miyataa,1, Hirotaka Matsuob, Hidetoshi Kassaic, Kazuki Nakaoc, Masahiro Nakatochid, Yusuke Kawamurab, Seiko Shimizub, Nariyoshi Shinomiyab, Kimiyoshi Ichidae, Makoto Hosoyamadaf, Atsu Aibac, and Hiroshi Suzukia aDepartment of Pharmacy, The University of Tokyo Hospital, Bunkyo-ku, 113-8655 Tokyo, Japan; bDepartment of Integrative Physiology and Bio-Nano Medicine, National Defense Medical College, Tokorozawa, 359-8513 Saitama, Japan; cLaboratory of Animal Resources, Center for Disease Biology and Integrative Medicine, Graduate School of Medicine, The University of Tokyo, Bunkyo-ku, 113-0033 Tokyo, Japan; dDivision of Public Health Informatics, Department of Integrative Health Science, Nagoya University Graduate School of Medicine, 461-8673 Nagoya, Japan; eDepartment of Pathophysiology, Tokyo University of Pharmacy and Life Sciences, Hachioji, 192-0392 Tokyo, Japan; and fDepartment of Human Physiology and Pathology, Faculty of Pharma-Sciences, Teikyo University, Itabashi-ku, 173-8605 Tokyo, Japan Edited by Francisco Bezanilla, The University of Chicago, Chicago, IL, and approved June 29, 2020 (received for review April 14, 2020) Recent genome-wide association studies have revealed some ge- affected the urate transport activity of GLUT12 (Fig. 1D); netic loci associated with serum uric acid levels and susceptibility GLUT12 is more active at lower pH (Fig. 1E). As GLUT12- to gout/hyperuricemia which contain potential candidates of mediated urate uptake increased linearly with time over physiologically important urate transporters. One of these novel 10 min (Fig. 1F), uptake at 5 min was evaluated in subsequent loci is located upstream of SGK1 and SLC2A12, suggesting that kinetic analysis. Under the experimentally maximum urate con- variations in these genes increase the risks of hyperuricemia and centration (500 μM), GLUT12-mediated urate uptake was not gout. We herein focused on SLC2A12 encoding a transporter, saturable (Fig. 1G). Considering urate concentrations in the GLUT12, the physiological function of which remains unclear. As blood of healthy (nonhyperuricemia) subjects (<0.41 mmol/L: GLUT12 belongs to the same protein family as a well-recognized 6.8 mg/dL) (1), our results suggest that GLUT12 can physio- urate transporter GLUT9, we hypothesized that GLUT12 mediates logically maintain urate transport activity in humans. With PHYSIOLOGY membrane transport of urate. Therefore, we conducted functional mouse Glut12, similar results were obtained (Fig. 1 H–J). Glut12 assays and analyzed knockout hyperuricemia model mice, Next, to address the physiological impact of Glut12 on blood generated using the CRISPR-Cas9 system. Our results revealed that urate concentrations, we analyzed Glut12 KO mice. Notably, GLUT12 acts as a physiological urate transporter and its dysfunc- urate is degraded in wild-type mice owing to urate oxidase (Uox), tion elevates the blood urate concentration. This study provides which humans lack. Therefore, we generated two lines of Glut12 insights into the deeper understanding of the urate regulatory KO mice on Uox KO background (5), as Uox KO mice sponta- system in the body, which is also important for pathophysiology neously develop hyperuricemia. The established Glut12/Uox of gout/hyperuricemia. double-KO (DKO) lines had deletions causing a frameshift in K GWAS | gout | hyperuricemia | serum uric acid | urate handling Glut12 (Fig. 1 ). Each frameshift mutation disrupted the Glut12 urate transport function (Fig. 1L), indicating that the DKO lines were deficient in Glut12 function. Then, we examined plasma enes encoding physiologically important urate transporters parameters; urate concentrations in both DKO mouse lines were have been reportedly associated with serum uric acid (SUA) G higher than those in control Uox KO mice (Fig. 1M), which levels and susceptibility to gout/hyperuricemia (1). A previous strongly supported our hypothesis. However, Glut12 KO did not study has reported a novel locus for SUA on human chromo- affect the plasma creatinine concentration (Fig. 1N) and frac- some 6 near the SGK1 and SLC2A12 genes (2), which is con- tional renal urate excretion in each DKO line (Fig. 1O), sug- sistent with the result derived from our previous genetic study gesting that Glut12 deficiency does not induce severe renal (3). As SGK1 encodes a kinase protein, we focused on SLC2A12 dysfunction or decrease renal urate excretion. Moreover, hepatic encoding a transporter protein known as GLUT12, whose urate levels in the DKO mice tended to be lower than those in physiological function remains unclear. Since GLUT12 belongs control mice (Fig. 1P), suggesting that the Glut12 deficiency- to the same protein family as GLUT9/SLC2A9 [a physiologically dependent elevation of the blood urate concentration is not important urate transporter (4)], we hypothesized that GLUT12 due to overproduction of uric acid in the liver. However, im- regulates blood urate concentrations as a urate transporter. To portantly, the significantly lower values of the liver-to-plasma verify this hypothesis, we conducted functional assays and ana- urate concentration ratio in the DKO mice (Fig. 1Q) implied lyzed newly generated Glut12 knockout (KO) hyperuricemia that Glut12 might be involved in urate transport from the blood model mice. First, using mammalian cells transiently expressing GLUT12, into the liver. These findings are in line with gene expression we examined whether GLUT12 can transport urate. After con- firming the cellular expression and plasma membrane localiza- tion of GLUT12 (Fig. 1 A and B), we measured the amount of Author contributions: Y.T., T.T., and H. Miyata designed research; Y.T. and H. Miyata 14 performed research; Y.T., H. Miyata, H.K., K.N., M.H., and A.A. contributed new re- [8- C]urate incorporated into the cells (Fig. 1C). In Krebs agents/analytic tools; Y.T., T.T., H. Miyata, H. Matsuo, M.N., Y.K., S.S., N.S., and K.I. ana- buffer mimicking the ionic content of plasma, GLUT12- lyzed data; and Y.T., T.T., and H.S. wrote the paper. mediated urate transport was detected. Neither exclusion of The authors declare no competing interest. sodium from the Krebs buffer nor a high-potassium buffer con- This open access article is distributed under Creative Commons Attribution-NonCommercial- dition that depolarizes plasma membranes affected GLUT12- NoDerivatives License 4.0 (CC BY-NC-ND). mediated urate uptake, indicating that GLUT12 is a sodium- 1Y.T., T.T., and H. Miyata contributed equally to this work. independent and bidirectional urate transporter. Additionally, 2To whom correspondence may be addressed. Email: [email protected]. an enhanced green fluorescent protein (EGFP) tag hardly www.pnas.org/cgi/doi/10.1073/pnas.2006958117 PNAS Latest Articles | 1of3 Downloaded by guest on September 26, 2021 0.4 200 MW Mock GLUT12-EGFP † † A B CD†† † 103) † 170 0.3 150 130 100 0.2 100 70 55 0.1 50 [% of control] [% Urate transport Urate transport L/mg protein/min] 40 μ [ 0 0 35 Na+ + −− EGFP-tag with without 25 Buffer Krebs K-high K-high †† EF1.5 5 G800 4 600 1.0 †† 3 400 2 0.5 † L/mg protein] 200 μ urate transport urate transport Urate transport [ 1 L/mg protein/min] μ GLUT12-dependent GLUT12-dependent GLUT12-dependent [ 0 0 [pmol/mg protein/min] 0 pH 5.4 6.4 7.4 0 5 10 0 200 400 600 Time [min] Urate [μM] H 1.0 †† IJ5 800 0.8 4 600 † 0.6 3 † 400 0.4 2 L/mg protein] 200 μ urate transport urate transport Urate transport 0.2 [ 1 L/mg protein/min] Glut12-dependent Glut12-dependent μ [ 0 0 [pmol/mg protein/min] 0 pH 5.4 6.4 7.4 0 5 10 0 200 400 600 Time [min] Urate [μM] K NS Ex1 sgRNA target Ex2 Ex3 Ex4 Ex5 L 2.0 ** Glut12 1.5 5′--3′ 258 437 1.0 WT KO #1: -8 bp KO #2:-128 bp 0.5 Urate transport Urate L/mg protein/min] μ WT [ KO #1: -8 bp 0 KO #2:-128 bp Mock WT #1 #2 Glut12 KO MNO600 10 40 NS 80 NS * * 9 30 60 500 8 [%] M] M] 20 40 μ μ UA [ 7 [ [mg/dL] 400 FE 10 20 Urate in Urate plasma 6 in Urate plasma 300 5 Creatinine in plasma 0 0 Glut12 WT #1 #2 Glut12 WT #1 #2 Glut12 WT #1 #2 Uox KO Uox KO Uox KO PQ1,500 2.5 2.0 plasma 1,000 1.5 ** Urate * / ** nmolliver] / g 1.0 500 liver 0.5 Urate [ Urate Urate 0 0 Glut12 WT #1 #2 Glut12 WT #1 #2 Uox KO Uox KO Fig. 1. GLUT12/SLC2A12 is a urate transporter, genetic disruption of which affects the blood urate concentration in genetically induced hyperuricemia model mice. (A–J) Identification of human GLUT12 and mouse Glut12 as a novel urate transporter. Immunoblotting (A) and confocal microscopic observation (B)of GLUT12 transiently expressed in HEK293 cells. Magnified images of representative cells outlined by yellow squares are also shown. (Scale bars, 10 μm.) Urate transport activities of GLUT12 in various transport buffers (C). EGFP tag barely affects the urate transport activity of GLUT12 (D). White, mock; black, GLUT12. Acidic pH-dependent [14C]urate transport activities of GLUT12 (E) and Glut12 (H). Time profiles for GLUT12- (F) or Glut12- (I) mediated [14C]urate uptake into HEK293 cells. Unsaturated GLUT12- (G) or Glut12- (J) mediated [14C]urate transport activities with increasing urate concentrations. In E–J, Krebs–Ringer buffer (pH 5.4) was used. (K–Q) Physiological impact of Glut12 KO on blood urate concentrations in hyperuricemia model mice. Schematic illustration of disrupted Glut12 gene in each Glut12/urate oxidase (Uox) DKO line: #1, Glut128del; #2, Glut12128del (K). Glut12 KO mutants transiently expressed in HEK293 cells exhibit no urate transport activity in Krebs–Ringer buffer (pH 5.4) (L).
Recommended publications
  • A Computational Approach for Defining a Signature of Β-Cell Golgi Stress in Diabetes Mellitus
    Page 1 of 781 Diabetes A Computational Approach for Defining a Signature of β-Cell Golgi Stress in Diabetes Mellitus Robert N. Bone1,6,7, Olufunmilola Oyebamiji2, Sayali Talware2, Sharmila Selvaraj2, Preethi Krishnan3,6, Farooq Syed1,6,7, Huanmei Wu2, Carmella Evans-Molina 1,3,4,5,6,7,8* Departments of 1Pediatrics, 3Medicine, 4Anatomy, Cell Biology & Physiology, 5Biochemistry & Molecular Biology, the 6Center for Diabetes & Metabolic Diseases, and the 7Herman B. Wells Center for Pediatric Research, Indiana University School of Medicine, Indianapolis, IN 46202; 2Department of BioHealth Informatics, Indiana University-Purdue University Indianapolis, Indianapolis, IN, 46202; 8Roudebush VA Medical Center, Indianapolis, IN 46202. *Corresponding Author(s): Carmella Evans-Molina, MD, PhD ([email protected]) Indiana University School of Medicine, 635 Barnhill Drive, MS 2031A, Indianapolis, IN 46202, Telephone: (317) 274-4145, Fax (317) 274-4107 Running Title: Golgi Stress Response in Diabetes Word Count: 4358 Number of Figures: 6 Keywords: Golgi apparatus stress, Islets, β cell, Type 1 diabetes, Type 2 diabetes 1 Diabetes Publish Ahead of Print, published online August 20, 2020 Diabetes Page 2 of 781 ABSTRACT The Golgi apparatus (GA) is an important site of insulin processing and granule maturation, but whether GA organelle dysfunction and GA stress are present in the diabetic β-cell has not been tested. We utilized an informatics-based approach to develop a transcriptional signature of β-cell GA stress using existing RNA sequencing and microarray datasets generated using human islets from donors with diabetes and islets where type 1(T1D) and type 2 diabetes (T2D) had been modeled ex vivo. To narrow our results to GA-specific genes, we applied a filter set of 1,030 genes accepted as GA associated.
    [Show full text]
  • Protein Identities in Evs Isolated from U87-MG GBM Cells As Determined by NG LC-MS/MS
    Protein identities in EVs isolated from U87-MG GBM cells as determined by NG LC-MS/MS. No. Accession Description Σ Coverage Σ# Proteins Σ# Unique Peptides Σ# Peptides Σ# PSMs # AAs MW [kDa] calc. pI 1 A8MS94 Putative golgin subfamily A member 2-like protein 5 OS=Homo sapiens PE=5 SV=2 - [GG2L5_HUMAN] 100 1 1 7 88 110 12,03704523 5,681152344 2 P60660 Myosin light polypeptide 6 OS=Homo sapiens GN=MYL6 PE=1 SV=2 - [MYL6_HUMAN] 100 3 5 17 173 151 16,91913397 4,652832031 3 Q6ZYL4 General transcription factor IIH subunit 5 OS=Homo sapiens GN=GTF2H5 PE=1 SV=1 - [TF2H5_HUMAN] 98,59 1 1 4 13 71 8,048185945 4,652832031 4 P60709 Actin, cytoplasmic 1 OS=Homo sapiens GN=ACTB PE=1 SV=1 - [ACTB_HUMAN] 97,6 5 5 35 917 375 41,70973209 5,478027344 5 P13489 Ribonuclease inhibitor OS=Homo sapiens GN=RNH1 PE=1 SV=2 - [RINI_HUMAN] 96,75 1 12 37 173 461 49,94108966 4,817871094 6 P09382 Galectin-1 OS=Homo sapiens GN=LGALS1 PE=1 SV=2 - [LEG1_HUMAN] 96,3 1 7 14 283 135 14,70620005 5,503417969 7 P60174 Triosephosphate isomerase OS=Homo sapiens GN=TPI1 PE=1 SV=3 - [TPIS_HUMAN] 95,1 3 16 25 375 286 30,77169764 5,922363281 8 P04406 Glyceraldehyde-3-phosphate dehydrogenase OS=Homo sapiens GN=GAPDH PE=1 SV=3 - [G3P_HUMAN] 94,63 2 13 31 509 335 36,03039959 8,455566406 9 Q15185 Prostaglandin E synthase 3 OS=Homo sapiens GN=PTGES3 PE=1 SV=1 - [TEBP_HUMAN] 93,13 1 5 12 74 160 18,68541938 4,538574219 10 P09417 Dihydropteridine reductase OS=Homo sapiens GN=QDPR PE=1 SV=2 - [DHPR_HUMAN] 93,03 1 1 17 69 244 25,77302971 7,371582031 11 P01911 HLA class II histocompatibility antigen,
    [Show full text]
  • Pflugers Final
    CORE Metadata, citation and similar papers at core.ac.uk Provided by Serveur académique lausannois A comprehensive analysis of gene expression profiles in distal parts of the mouse renal tubule. Sylvain Pradervand2, Annie Mercier Zuber1, Gabriel Centeno1, Olivier Bonny1,3,4 and Dmitri Firsov1,4 1 - Department of Pharmacology and Toxicology, University of Lausanne, 1005 Lausanne, Switzerland 2 - DNA Array Facility, University of Lausanne, 1015 Lausanne, Switzerland 3 - Service of Nephrology, Lausanne University Hospital, 1005 Lausanne, Switzerland 4 – these two authors have equally contributed to the study to whom correspondence should be addressed: Dmitri FIRSOV Department of Pharmacology and Toxicology, University of Lausanne, 27 rue du Bugnon, 1005 Lausanne, Switzerland Phone: ++ 41-216925406 Fax: ++ 41-216925355 e-mail: [email protected] and Olivier BONNY Department of Pharmacology and Toxicology, University of Lausanne, 27 rue du Bugnon, 1005 Lausanne, Switzerland Phone: ++ 41-216925417 Fax: ++ 41-216925355 e-mail: [email protected] 1 Abstract The distal parts of the renal tubule play a critical role in maintaining homeostasis of extracellular fluids. In this review, we present an in-depth analysis of microarray-based gene expression profiles available for microdissected mouse distal nephron segments, i.e., the distal convoluted tubule (DCT) and the connecting tubule (CNT), and for the cortical portion of the collecting duct (CCD) (Zuber et al., 2009). Classification of expressed transcripts in 14 major functional gene categories demonstrated that all principal proteins involved in maintaining of salt and water balance are represented by highly abundant transcripts. However, a significant number of transcripts belonging, for instance, to categories of G protein-coupled receptors (GPCR) or serine-threonine kinases exhibit high expression levels but remain unassigned to a specific renal function.
    [Show full text]
  • Frontiersin.Org 1 April 2015 | Volume 9 | Article 123 Saunders Et Al
    ORIGINAL RESEARCH published: 28 April 2015 doi: 10.3389/fnins.2015.00123 Influx mechanisms in the embryonic and adult rat choroid plexus: a transcriptome study Norman R. Saunders 1*, Katarzyna M. Dziegielewska 1, Kjeld Møllgård 2, Mark D. Habgood 1, Matthew J. Wakefield 3, Helen Lindsay 4, Nathalie Stratzielle 5, Jean-Francois Ghersi-Egea 5 and Shane A. Liddelow 1, 6 1 Department of Pharmacology and Therapeutics, University of Melbourne, Parkville, VIC, Australia, 2 Department of Cellular and Molecular Medicine, University of Copenhagen, Copenhagen, Denmark, 3 Walter and Eliza Hall Institute of Medical Research, Parkville, VIC, Australia, 4 Institute of Molecular Life Sciences, University of Zurich, Zurich, Switzerland, 5 Lyon Neuroscience Research Center, INSERM U1028, Centre National de la Recherche Scientifique UMR5292, Université Lyon 1, Lyon, France, 6 Department of Neurobiology, Stanford University, Stanford, CA, USA The transcriptome of embryonic and adult rat lateral ventricular choroid plexus, using a combination of RNA-Sequencing and microarray data, was analyzed by functional groups of influx transporters, particularly solute carrier (SLC) transporters. RNA-Seq Edited by: Joana A. Palha, was performed at embryonic day (E) 15 and adult with additional data obtained at University of Minho, Portugal intermediate ages from microarray analysis. The largest represented functional group Reviewed by: in the embryo was amino acid transporters (twelve) with expression levels 2–98 times Fernanda Marques, University of Minho, Portugal greater than in the adult. In contrast, in the adult only six amino acid transporters Hanspeter Herzel, were up-regulated compared to the embryo and at more modest enrichment levels Humboldt University, Germany (<5-fold enrichment above E15).
    [Show full text]
  • PRODUCT SPECIFICATION Anti-SLC2A12 Product Datasheet
    Anti-SLC2A12 Product Datasheet Polyclonal Antibody PRODUCT SPECIFICATION Product Name Anti-SLC2A12 Product Number HPA031593 Gene Description solute carrier family 2 (facilitated glucose transporter), member 12 Clonality Polyclonal Isotype IgG Host Rabbit Antigen Sequence Recombinant Protein Epitope Signature Tag (PrEST) antigen sequence: PSPRFLVMKGQEGAASKVLGRLRALSDTTEELTVIKSSLKDEYQYSFWDL FRSKDNMRTR Purification Method Affinity purified using the PrEST antigen as affinity ligand Verified Species Human Reactivity Recommended IHC (Immunohistochemistry) Applications - Antibody dilution: 1:20 - 1:50 - Retrieval method: HIER pH6 Characterization Data Available at atlasantibodies.com/products/HPA031593 Buffer 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative. Concentration Lot dependent Storage Store at +4°C for short term storage. Long time storage is recommended at -20°C. Notes Gently mix before use. Optimal concentrations and conditions for each application should be determined by the user. For protocols, additional product information, such as images and references, see atlasantibodies.com. Product of Sweden. For research use only. Not intended for pharmaceutical development, diagnostic, therapeutic or any in vivo use. No products from Atlas Antibodies may be resold, modified for resale or used to manufacture commercial products without prior written approval from Atlas Antibodies AB. Warranty: The products supplied by Atlas Antibodies are warranted to meet stated product specifications and to conform to label descriptions when used and stored properly. Unless otherwise stated, this warranty is limited to one year from date of sales for products used, handled and stored according to Atlas Antibodies AB's instructions. Atlas Antibodies AB's sole liability is limited to replacement of the product or refund of the purchase price.
    [Show full text]
  • Glucose Transporters As a Target for Anticancer Therapy
    cancers Review Glucose Transporters as a Target for Anticancer Therapy Monika Pliszka and Leszek Szablewski * Chair and Department of General Biology and Parasitology, Medical University of Warsaw, 5 Chalubinskiego Str., 02-004 Warsaw, Poland; [email protected] * Correspondence: [email protected]; Tel.: +48-22-621-26-07 Simple Summary: For mammalian cells, glucose is a major source of energy. In the presence of oxygen, a complete breakdown of glucose generates 36 molecules of ATP from one molecule of glucose. Hypoxia is a hallmark of cancer; therefore, cancer cells prefer the process of glycolysis, which generates only two molecules of ATP from one molecule of glucose, and cancer cells need more molecules of glucose in comparison with normal cells. Increased uptake of glucose by cancer cells is due to increased expression of glucose transporters. However, overexpression of glucose transporters, promoting the process of carcinogenesis, and increasing aggressiveness and invasiveness of tumors, may have also a beneficial effect. For example, upregulation of glucose transporters is used in diagnostic techniques such as FDG-PET. Therapeutic inhibition of glucose transporters may be a method of treatment of cancer patients. On the other hand, upregulation of glucose transporters, which are used in radioiodine therapy, can help patients with cancers. Abstract: Tumor growth causes cancer cells to become hypoxic. A hypoxic condition is a hallmark of cancer. Metabolism of cancer cells differs from metabolism of normal cells. Cancer cells prefer the process of glycolysis as a source of ATP. Process of glycolysis generates only two molecules of ATP per one molecule of glucose, whereas the complete oxidative breakdown of one molecule of glucose yields 36 molecules of ATP.
    [Show full text]
  • Effects of SLC22A2 (Rs201919874) and SLC47A2 (Rs138244461)
    155 Effects of SLC22A2 (rs201919874) and SLC47A2 (rs138244461) genetic variants on Metformin Pharmacokinetics in Pakistani T2DM patients Sadaf Moeez,1 Zoya Khalid,2 Fazal Jalil,3 Muhammad Irfan,4 Muhammad Ismail,5 Mohammad Ali Arif,6 Rauf Niazi,7 Sumbul Khalid8 Abstract Objective: To determine the frequencies of single nucleotide polymorphisms rs201919874 and rs138244461 in genes SLC22A2 and SLC47A2 respectively in Pakistani diabetes patients in order to characterise the genetic variants and determine their association with the pharmacokinetics of metformin. Methods: The case-control study was conducted at the International Islamic University, Islamabad, Pakistan, from June 2016 to June 2017, and comprised genotypes of diabetic cases and matching controls which were determined following allele-specific polymerase chain reaction. Cases were further divided into Group A and Group B. The former consisted of diabetics who were on monotherapy of metformin, while the latter consisted of diabetics treated with a combination of metformin and sulfonylureas. In-silico analysis was performed to verify the effect of single nucleotide polymorphisms rs201919874 and rs138244461 on the structure of genes. Association was statistically determined using SPSS 18. Results: Of the 1200 subjects, 800(66.6%) were cases and 400(33.3%) were controls. Among the cases, 400(50%) each were in Group A and Group B. Significant difference was observed in the distribution of rs201919874 between Group A and controls (p<0.05) and between Group B and controls (p<0.05) for heterozygous genotypic frequency and for allelic frequency. Conversely, statistically significant difference was observed in rs138244461 (p<0.05) for all genotypic and allelic frequencies.
    [Show full text]
  • Supplementary Materials: Molecular Signature of Subtypes of Non- Small Cell Lung Cancer by Large-Scale Transcriptional Profiling
    Cancers 2020 S1 of S18 Supplementary Materials: Molecular Signature of Subtypes of Non- Small Cell Lung Cancer by Large-Scale Transcriptional Profiling: Identification of Key Modules and Genes by Weighted Gene Co- Expression Network Analysis (WGCNA) Magdalena Niemira, Francois Collin, Anna Szalkowska, Agnieszka Bielska, Karolina Chwialkowska, Joanna Reszec, Jacek Niklinski, Miroslaw Kwasniewski and Adam Kretowski Cancers 2020 S2 of S18 A B Figure S1. The top-ranked enriched canonical pathway identified in (A) SCC and (B) ADC using IPA: Eicosanoid signalling pathway. Cancers 2020 S3 of S18 A Cancers 2020 S4 of S18 Figure S2. The second-ranked enriched canonical pathway identified in (A) SCC and (B) ADC using IPA: Agranulocyte adhesion and diapedesis. Cancers 2020 S5 of S18 Figure S3. The top-ranked enriched canonical pathway identified only in lung ADC: MIF regulation of innate immunity. A B Figure S4. Cluster dendograms of the gene clusters of (A) LUAD and (B) LUSC subset from TCGA database. Cancers 2020 S6 of S18 A B C D Figure S5. Protein-protein interaction (PPI) network of genes in the red (A), lightcyan (B), darkorange (C), yellow (D) modules in ADC. The networks were constructed using Cytoscape v. 3.7.2. software. Cancers 2020 S7 of S18 A B Figure S6. Protein-protein interaction (PPI) network of genes in the blue (A) and (B) modules in SCC. The networks were constructed using Cytoscape v. 3.7.2. software. Cancers 2020 S8 of S18 Table S1. Upstream regulator analysis of DEGs in lung SCC predicted by IPA. Upstream Prediction Target
    [Show full text]
  • RNA-Seq Reveals Conservation of Function Among the Yolk Sacs Of
    RNA-seq reveals conservation of function among the PNAS PLUS yolk sacs of human, mouse, and chicken Tereza Cindrova-Daviesa, Eric Jauniauxb, Michael G. Elliota,c, Sungsam Gongd,e, Graham J. Burtona,1, and D. Stephen Charnock-Jonesa,d,e,1,2 aCentre for Trophoblast Research, Department of Physiology, Development and Neuroscience, University of Cambridge, Cambridge, CB2 3EG, United Kingdom; bElizabeth Garret Anderson Institute for Women’s Health, Faculty of Population Health Sciences, University College London, London, WC1E 6BT, United Kingdom; cSt. John’s College, University of Cambridge, Cambridge, CB2 1TP, United Kingdom; dDepartment of Obstetrics and Gynaecology, University of Cambridge, Cambridge, CB2 0SW, United Kingdom; and eNational Institute for Health Research, Cambridge Comprehensive Biomedical Research Centre, Cambridge, CB2 0QQ, United Kingdom Edited by R. Michael Roberts, University of Missouri-Columbia, Columbia, MO, and approved May 5, 2017 (received for review February 14, 2017) The yolk sac is phylogenetically the oldest of the extraembryonic yolk sac plays a critical role during organogenesis (3–5, 8–10), membranes. The human embryo retains a yolk sac, which goes there are limited data to support this claim. Obtaining experi- through primary and secondary phases of development, but its mental data for the human is impossible for ethical reasons, and importance is controversial. Although it is known to synthesize thus we adopted an alternative strategy. Here, we report RNA proteins, its transport functions are widely considered vestigial. sequencing (RNA-seq) data derived from human and murine yolk Here, we report RNA-sequencing (RNA-seq) data for the human sacs and compare them with published data from the yolk sac of and murine yolk sacs and compare those data with data for the the chicken.
    [Show full text]
  • Autocrine IFN Signaling Inducing Profibrotic Fibroblast Responses By
    Downloaded from http://www.jimmunol.org/ by guest on September 23, 2021 Inducing is online at: average * The Journal of Immunology , 11 of which you can access for free at: 2013; 191:2956-2966; Prepublished online 16 from submission to initial decision 4 weeks from acceptance to publication August 2013; doi: 10.4049/jimmunol.1300376 http://www.jimmunol.org/content/191/6/2956 A Synthetic TLR3 Ligand Mitigates Profibrotic Fibroblast Responses by Autocrine IFN Signaling Feng Fang, Kohtaro Ooka, Xiaoyong Sun, Ruchi Shah, Swati Bhattacharyya, Jun Wei and John Varga J Immunol cites 49 articles Submit online. Every submission reviewed by practicing scientists ? is published twice each month by Receive free email-alerts when new articles cite this article. Sign up at: http://jimmunol.org/alerts http://jimmunol.org/subscription Submit copyright permission requests at: http://www.aai.org/About/Publications/JI/copyright.html http://www.jimmunol.org/content/suppl/2013/08/20/jimmunol.130037 6.DC1 This article http://www.jimmunol.org/content/191/6/2956.full#ref-list-1 Information about subscribing to The JI No Triage! Fast Publication! Rapid Reviews! 30 days* Why • • • Material References Permissions Email Alerts Subscription Supplementary The Journal of Immunology The American Association of Immunologists, Inc., 1451 Rockville Pike, Suite 650, Rockville, MD 20852 Copyright © 2013 by The American Association of Immunologists, Inc. All rights reserved. Print ISSN: 0022-1767 Online ISSN: 1550-6606. This information is current as of September 23, 2021. The Journal of Immunology A Synthetic TLR3 Ligand Mitigates Profibrotic Fibroblast Responses by Inducing Autocrine IFN Signaling Feng Fang,* Kohtaro Ooka,* Xiaoyong Sun,† Ruchi Shah,* Swati Bhattacharyya,* Jun Wei,* and John Varga* Activation of TLR3 by exogenous microbial ligands or endogenous injury-associated ligands leads to production of type I IFN.
    [Show full text]
  • Transporters
    University of Dundee The Concise Guide to PHARMACOLOGY 2015/16 Alexander, Stephen P. H.; Kelly, Eamonn; Marrion, Neil; Peters, John A.; Benson, Helen E.; Faccenda, Elena Published in: British Journal of Pharmacology DOI: 10.1111/bph.13355 Publication date: 2015 Licence: CC BY Document Version Publisher's PDF, also known as Version of record Link to publication in Discovery Research Portal Citation for published version (APA): Alexander, S. P. H., Kelly, E., Marrion, N., Peters, J. A., Benson, H. E., Faccenda, E., Pawson, A. J., Sharman, J. L., Southan, C., Davies, J. A., & CGTP Collaborators (2015). The Concise Guide to PHARMACOLOGY 2015/16: Transporters. British Journal of Pharmacology, 172(24), 6110-6202. https://doi.org/10.1111/bph.13355 General rights Copyright and moral rights for the publications made accessible in Discovery Research Portal are retained by the authors and/or other copyright owners and it is a condition of accessing publications that users recognise and abide by the legal requirements associated with these rights. • Users may download and print one copy of any publication from Discovery Research Portal for the purpose of private study or research. • You may not further distribute the material or use it for any profit-making activity or commercial gain. • You may freely distribute the URL identifying the publication in the public portal. Take down policy If you believe that this document breaches copyright please contact us providing details, and we will remove access to the work immediately and investigate your claim. Download date: 06. Oct. 2021 S.P.H. Alexander et al. The Concise Guide to PHARMACOLOGY 2015/16: Transporters.
    [Show full text]
  • Wo 2008/156655 A9
    (12) INTERNATIONAL APPLICATION PUBLISHED UNDER THE PATENT COOPERATION TREATY (PCT) CORRECTED VERSION (19) World Intellectual Property Organization International Bureau (43) International Publication Date (10) International Publication Number 24 December 2008 (24.12.2008) PCT WO 2008/156655 A9 (51) International Patent Classification: (81) Designated States (unless otherwise indicated, for every C07K 14/00 (2006.01) kind of national protection available): AE, AG, AL, AM, AO, AT,AU, AZ, BA, BB, BG, BH, BR, BW, BY, BZ, CA, (21) International Application Number: CH, CN, CO, CR, CU, CZ, DE, DK, DM, DO, DZ, EC, EE, PCT/US2008/007377 EG, ES, FI, GB, GD, GE, GH, GM, GT, HN, HR, HU, ID, IL, IN, IS, JP, KE, KG, KM, KN, KP, KR, KZ, LA, LC, (22) International Filing Date: 13 June 2008 (13.06.2008) LK, LR, LS, LT, LU, LY, MA, MD, ME, MG, MK, MN, MW, MX, MY, MZ, NA, NG, NI, NO, NZ, OM, PG, PH, (25) Filing Language: English PL, PT, RO, RS, RU, SC, SD, SE, SG, SK, SL, SM, SV, SY, TJ, TM, TN, TR, TT, TZ, UA, UG, US, UZ, VC, VN, (26) Publication Language: English ZA, ZM, ZW (30) Priority Data: (84) Designated States (unless otherwise indicated, for every kind of regional protection available): ARIPO (BW, GH, 60/934,768 15 June 2007 (15.06.2007) US GM, KE, LS, MW, MZ, NA, SD, SL, SZ, TZ, UG, ZM, ZW), Eurasian (AM, AZ, BY, KG, KZ, MD, RU, TJ, TM), (71) Applicants (for all designated States except US): European (AT,BE, BG, CH, CY, CZ, DE, DK, EE, ES, FI, GENELUX CORPORATION [US/US]; 3030 Bunker FR, GB, GR, HR, HU, IE, IS, IT, LT,LU, LV,MC, MT, NL, Hill Street, Suite 310, San Diego, CA 92109 (US).
    [Show full text]