DOCSLIB.ORG

Contaminated Sites and Health

Total Page：16

File Type：pdf, Size：1020Kb

Download full-text PDF Read full-text
Contaminated Sites and Health 7KH:+25HJLRQDO2IILFHIRU(XURSH 7KH:RUOG+HDOWK2UJDQL]DWLRQ :+2 LVD ,Q(XURSHHDUOLHULQGXVWULDOL]DWLRQDQGSRRUHQYLURQPHQWDOPDQDJHPHQW VSHFLDOL]HGDJHQF\RIWKH8QLWHG1DWLRQVFUHDWHG LQZLWKWKHSULPDU\UHVSRQVLELOLW\IRU SUDFWLFHVKDYHOHIWDOHJDF\RIWKRXVDQGVRIFRQWDPLQDWHGVLWHV3DVW LQWHUQDWLRQDOKHDOWKPDWWHUVDQGSXEOLFKHDOWK DQG FXUUHQW DFWLYLWLHV FDQ FDXVH ORFDO DQG GLIIXVH DFFXPXODWLRQ RI 7KH:+25HJLRQDO2IILFHIRU(XURSHLVRQHRI VL[UHJLRQDORIILFHVWKURXJKRXWWKHZRUOGHDFK HQYLURQPHQWDOVWUHVVRUVWRDQH[WHQWWKDWPLJKWWKUHDWHQKXPDQKHDOWK ZLWKLWVRZQSURJUDPPHJHDUHGWRWKHSDUWLFXODU DQGWKHHQYLURQPHQWE\DOWHULQJDLUTXDOLW\KDPSHULQJVRLOIXQFWLRQV KHDOWKFRQGLWLRQVRIWKHFRXQWULHVLWVHUYHV DQGSROOXWLQJJURXQGZDWHUDQGVXUIDFHZDWHU 0HPEHU6WDWHV 7KH:+2(XURSHDQ&HQWUHIRU(QYLURQPHQWDQG+HDOWKRUJDQL]HGWZR $OEDQLD WHFKQLFDOPHHWLQJV−ZKLFKLQFOXGHGUHSUHVHQWDWLYHVRIHQYLURQPHQWDO $QGRUUD $UPHQLD DQGSXEOLFKHDOWKDJHQFLHV DWWKHQDWLRQDODQGLQWHUQDWLRQDOOHYHOV DQG $XVWULD UHVHDUFK H[SHUWV − WR H[SORUH SULRULWLHV LQWHUHVWV DQG QHHGV DQG WR $]HUEDLMDQ %HODUXV UHYLHZ WKH VWDWH RI WKH DUW WKH FXUUHQW PHWKRGRORJLFDO RSWLRQV DQG %HOJLXP NQRZOHGJHJDSVLQWKHGRPDLQRIFRQWDPLQDWHGVLWHVDQGKHDOWK %RVQLDDQG+HU]HJRYLQD %XOJDULD 7KHDVVHVVPHQWRIWKHSRVVLEOHKHDOWKLPSDFWRIFRQWDPLQDWHGVLWHVLVD &URDWLD FKDOOHQJLQJH[HUFLVHHVSHFLDOO\LQWKHFDVHRILQGXVWULDOO\FRQWDPLQDWHG &\SUXV &]HFK5HSXEOLF VLWHV ZLWK RQJRLQJ PXOWLSOH LQGXVWULDO DFWLYLWLHV DQG LQYROYLQJ PXOWLSOH 'HQPDUN KXPDQ H[SRVXUHV 1RWZLWKVWDQGLQJ WKHVH FRPSOH[LWLHV D YDULHW\ RI &RQWDPLQDWHGVLWHVDQGKHDOWK (VWRQLD PHWKRGVDQGWRROVIRUKHDOWKLPSDFWDVVHVVPHQWKDYHEHHQGHYHORSHG )LQODQG )UDQFH DQGDSSOLHGWRVWXG\FRQWDPLQDWHGVLWHVDQGDEURDGUDQJHRIUHVRXUFHV &RQWDPLQDWHGVLWHV *HRUJLD LVDYDLODEOHWKHVHPXVWEHFDUHIXOO\VHOHFWHGDQGDSSOLHGGHSHQGLQJRQ *HUPDQ\ *UHHFH WKHQHHGVREMHFWLYHVDQGORFDOIHDVLELOLW\ +XQJDU\ $YDLODEOHDVVHVVPHQWVVXJJHVWWKDWFRQWDPLQDWHGVLWHVDUHDQLPSRUWDQW ,FHODQG DQGKHDOWK ,UHODQG SXEOLFKHDOWKLVVXHDWWKHQDWLRQDODQGLQWHUQDWLRQDOOHYHOV3ULRULW\WRSLFV ,VUDHO DQGJRDOVIRUFROODERUDWLYHZRUNRQFRQWDPLQDWHGVLWHVDQGKHDOWKZHUH ,WDO\ .D]DNKVWDQ LGHQWLILHGDWWKHWZRPHHWLQJV .\UJ\]VWDQ /DWYLD /LWKXDQLD /X[HPERXUJ 0DOWD 0RQDFR 0RQWHQHJUR 1HWKHUODQGV 1RUZD\ 3RODQG 3RUWXJDO 5HSXEOLFRI0ROGRYD 5RPDQLD 5XVVLDQ)HGHUDWLRQ 6DQ0DULQR :+25HJLRQDO2IILFHIRU(XURSH 5HSRUWRIWZR:+2ZRUNVKRSV 6HUELD 81&LW\0DUPRUYHM'.&RSHQKDJHQØ'HQPDUN 6ORYDNLD 6\UDFXVH,WDO\1RYHPEHU 6ORYHQLD 7HOyyyyy)D[yyyy 6SDLQ (PDLOFRQWDFW#HXURZKRLQW 6ZHGHQ &DWDQLD,WDO\z-XQH 6ZLW]HUODQG :HEVLWHZZZHXURZKRLQW 7DMLNLVWDQ 7KHIRUPHU<XJRVODY 5HSXEOLFRI0DFHGRQLD 7XUNH\ 7XUNPHQLVWDQ 8NUDLQH 8QLWHG.LQJGRP 8]EHNLVWDQ 2ULJLQDO(QJOLVK 7KLVUHSRUWLVDOVRDYDLODEOHDWKWWSZZZHXURZKRLQWFRQWDPLQDWHGVLWHVDQGKHDOWK &RQWDPLQDWHGVLWHVDQGKHDOWK 5HSRUWRIWZR:+2ZRUNVKRSV 6\UDFXVH,WDO\1RYHPEHU &DWDQLD,WDO\z-XQH $%675$&7 In Europe, earlier industrialization and poor environmental management practices have left a legacy of thousands of contaminated sites. Past and current activities can cause local and diffuse accumulation of environmental stressors to an extent that might threaten human health and the environment, by altering air quality, hampering soil functions, and polluting groundwater and surface water. The WHO European Centre for Environment and Health organized two technical meetings − which included representatives of environmental and public health agencies (at the national and international levels) and research experts − to explore priorities, interests and needs and to review the state of the art, the current methodological options, and knowledge gaps in the domain of contaminated sites and health. The assessment of the possible health impact of contaminated sites is a challenging exercise, especially in the case of industrially contaminated sites with ongoing multiple industrial activities and involving multiple human exposures. Notwithstanding these complexities, a variety of methods and tools for health impact assessment have been developed and applied to study contaminated sites, and a broad range of resources is available; these must be carefully selected and applied, depending on the needs, objectives and local feasibility. Available assessments suggest that contaminated sites are an important public health issue at the national and international levels. Priority topics and goals for collaborative work on contaminated sites and health were identified at the two meetings. .H\ZRUGV ENVIRONMENTAL EXPOSURE – adverse effects ENVIRONMENTAL POLLUTION EPIDEMIOLOGICAL STUDIES INDUSTRIAL WASTE PUBLIC HEALTH RISK ASSESSMENT Address requests about publications of the WHO Regional Office for Europe to: Publications WHO Regional Office for Europe UN City, Marmorvej 51 DK-2100 Copenhagen Ø, Denmark Alternatively, complete an online request form for documentation, health information, or for permission to quote or translate, on the Regional Office web site (http://www.euro.who.int/pubrequest). © World Health Organization 2013 All rights reserved. The Regional Office for Europe of the World Health Organization welcomes requests for permission to reproduce or translate its publications, in part or in full. The designations employed and the presentation of the material in this publication do not imply the expression of any opinion whatsoever on the part of the World Health Organization concerning the legal status of any country, territory, city or area or of its authorities, or concerning the delimitation of its frontiers or boundaries. Dotted lines on maps represent approximate border lines for which there may not yet be full agreement. The mention of specific companies or of certain manufacturers’ products does not imply that they are endorsed or recommended by the World Health Organization in preference to others of a similar nature that are not mentioned. Errors and omissions excepted, the names of proprietary products are distinguished by initial capital letters. All reasonable precautions have been taken by the World Health Organization to verify the information contained in this publication. However, the published material is being distributed without warranty of any kind, either express or implied. The responsibility for the interpretation and use of the material lies with the reader. In no event shall the World Health Organization be liable for damages arising from its use. The views expressed by authors, editors, or expert groups do not necessarily represent the decisions or the stated policy of the World Health Organization. &217(176 Executive summary ...............................................................................................................................................v Contributors and editors ................................................................................................................................... vii Acknowledgements ............................................................................................................................................vii List of abbreviations .............................................................................................................................. .............viii Introduction to the report .............................................................................................................................. ....1 Contaminated sites and health: priorities, interests, needs, methodological options . 2 1 Introduction .............................................................................................................................. .............................2 2 Possible objectives of a network coordinated by the WHO Regional Office for Europe .............. 2 3 Aims of the exploratory workshop ................................................................................................................. 3 4 Case studies ...........................................................................................................................................................4 5 Priorities, interests and needs ......................................................................................................................... 5 5.1 Communication .........................................................................................................................................5 5.2 Contamination of environmental media ........................................................................................... 6 5.3 Biomonitoring .............................................................................................................................. ...............6 5.4 Children .............................................................................................................................. ...........................6 5.5 Tools for rapid analysis ............................................................................................................................. 7 5.6 Exposure and risk over time ................................................................................................................... 7 5.7 Environmental justice .............................................................................................................................. 7 5.8 Industrial accidents .............................................................................................................................. .....7 6 Methodological options and available data ...............................................................................................8 6.1 Strategies for environment and health studies in contaminated sites .................................... 8 6.2 Exposure assessment ..............................................................................................................................
Load more

Recommended publications
  • Slovenian Alps
    SLOVENIAN ALPS Mangart, Photo by Bor Rojnik Slovenian Alps are truly remarkable, easily discovered by road as well as by trails suitable for hikers and cyclists. Marvellous panoramas, blooming meadows, alpine pastures and forests are surely never to be forgotten and are one of the most fascinating tourist spots in Slovenia. The high summits of the Julian Alps, the Karavanken chain and the Kamnik-Savinja Alps, open up amazing panoramas of the surrounding territory. It is hardly to find such a blooming meadows, alpine pastures and forests, elsewhere in the world within easy reach. The Julian Alps are a mountain range of the great Alps that stretches from northeastern Italy to Slovenia. They cover an estimated 4400 km², of which 1542 km² lies in Slovenia, and rise to 2,864 m at Mount Triglav, the highest peak in Slovenia. The entire mountain range constitutes about 150 mountains and is divided into two sections - the Western Julian Alps and the Eastern Julian Alps. 1 The Triglav National Park, boasting a number of peculiarities, is the largest and the earliest protected natural heritage site in the country. It is located in the north-west of Slovenia, more precisely in the Julian Alps. The park was named after the highest mountain of Slovenia, the Triglav, which is located nearly at the center of the park. It is the only National Park in Slovenia and among the earliest European parks. Pokljuka, is the southernmost highland marsh in Europe and a natural habitat of sphagnum moss. Near Kranjska Gora you can find nature reserve, the Zelenci, whom lakes provide Sava Dolinka with its source.
    [Show full text]
  • Reka SAVA DOLINKA in BELCA ČN Tabre in MČN Belca (Stalni Letni Monitoring Od Leta 2001)
    LABORATORY OF PLANT CYTOGENETICS Use of Allium M test for purpose of establishing quality of waters; since 1998 LABORATORIJ ZA RASTLINSKO APLIKATIVNO CITOGENETIKO Testna rastlina: navadna čebula (Allium cepa L.) Splošna strupenost (dolžina korenin) in genotoksičnost (indukcija kromosomskih poškodb) Reka SAVA DOLINKA in BELCA ČN Tabre in MČN Belca (stalni letni monitoring od leta 2001) Naročnik: Občina Kranjska Gora Kolodvorska 1b, SI – 4280 Kranjska Gora April 2015 Testno poročilo z rezultati raziskav obsega 9 strani, 2 preglednici in 4 fotografije 1 LABORATORY OF PLANT CYTOGENETICS Use of Allium M test for purpose of establishing quality of waters; since 1998 PROTOKOL METODE ALLIUM METAFAZNI GENOTOKSIČNI TEST ZA TESTIRANJE OKOLJSKIH VZORCEV, KEMIKALIJ IN PITNE VODE Peter Firbas, univ. dipl. biol., Zasebni raziskovalec, Laboratorij za rastlinsko citogenetiko E-pošta: [email protected] 1. Uvod ALLIUM metafazni test je test za ugotavljanje splošne celične strupenosti (citotoksičnosti) in ravni genotoksičnosti v vodnih, kopenskih in zračnih ekosistemih, kjer dokazujemo potencialne genotoksične snovi. Test je kratkotrajen in pokaže usklajen in celokupen učinek onesnaževanja in medsebojno delovanje med testno rastlino (Allium cepa L.) in potencialnimi genotoksiki, nato se še rezultati statistično ovrednotijo. Rezultate raziskav s statistično kalkulacijo prikazuje Fisher’s Exact Test. V 2x2 frekvenčnih tabelah dvosmerna p-vrednost determinira statistično značilnost ali neznačilnost dveh kategoričnih vzorcev. Biološki test ALLIUM ali čebulni test razkriva celosten vpliv na rast in razvoj živih celic ali organizmov ter zaznava prisotnost škodljivih snovi v koncentracijah, ki so bistveno nižje od 1 ppb (part per billion – en del snovi na eno milijardo raztopine ali 1 µg na liter ali kilogram). Od približno 700 prepoznavnih snovi, ki se lahko znajdejo na primer v pitni vodi, jih z običajnimi fizikalno-kemijskimi analizami nadzorujemo le okrog 10 odstotkov (Vir: EU Chemical Bureau, Natural Resources Defence Council: Think before you drink).
    [Show full text]
  • Secondary Organic Aerosol from Chlorine-Initiated Oxidation of Isoprene Dongyu S
    Secondary organic aerosol from chlorine-initiated oxidation of isoprene Dongyu S. Wang and Lea Hildebrandt Ruiz McKetta Department of Chemical Engineering, The University of Texas at Austin, Austin, TX 78756, USA 5 Correspondence to: Lea Hildebrandt Ruiz ([email protected]) Abstract. Recent studies have found concentrations of reactive chlorine species to be higher than expected, suggesting that atmospheric chlorine chemistry is more extensive than previously thought. Chlorine radicals can interact with HOx radicals and nitrogen oxides (NOx) to alter the oxidative capacity of the atmosphere. They are known to rapidly oxidize a wide range of volatile organic compounds (VOC) found in the atmosphere, yet little is known about secondary organic aerosol (SOA) 10 formation from chlorine-initiated photo-oxidation and its atmospheric implications. Environmental chamber experiments were carried out under low-NOx conditions with isoprene and chlorine as primary VOC and oxidant sources. Upon complete isoprene consumption, observed SOA yields ranged from 8 to 36 %, decreasing with extended photo-oxidation and SOA aging. Formation of particulate organochloride was observed. A High-Resolution Time-of-Flight Chemical Ionization Mass Spectrometer was used to determine the molecular composition of gas-phase species using iodide-water and hydronium-water 15 cluster ionization. Multi-generational chemistry was observed, including ions consistent with hydroperoxides, chloroalkyl hydroperoxides, isoprene-derived epoxydiol (IEPOX) and hypochlorous acid (HOCl), evident of secondary OH production and resulting chemistry from Cl-initiated reactions. This is the first reported study of SOA formation from chlorine-initiated oxidation of isoprene. Results suggest that tropospheric chlorine chemistry could contribute significantly to organic aerosol loading.
    [Show full text]
  • LEGRAD, V2 0 0 0 0 5 5 1 1 3 3 1 1 5 5 LEGRAD - CROATIA Flood - 14/09/2014 N " 0 '
    639000 640500 642000 643500 645000 646500 648000 649500 651000 16°48'0"E 16°49'0"E 16°50'0"E 16°51'0"E 16°52'0"E 16°53'0"E 16°54'0"E 16°55'0"E 16°56'0"E 16°57'0"E 16°58'0"E GLIDE number: N/A Activation ID: EMSR-101 Product N.: 03LEGRAD, v2 0 0 0 0 5 5 1 1 3 3 1 1 5 5 LEGRAD - CROATIA Flood - 14/09/2014 N " 0 ' 9 Delineation Map - Overview 1 ° 6 4 Production date: 18/09/2014 Austria Hungary N " 0 ' Slovenia 9 Serbia 1 Zagreb ° ^ 6 4 Bosnia Zala and Herzegovina Mur Nyugat-Dunantul Adriatic Sea Croatia Montenegro ! Medjimurska Italy 0 0 Somogy 0 0 0 0 zupanija 0 0 3 3 1 1 Drau 5 5 Legrad !( Del-Dunantul Koprivnicko-krizevacka zupanija N " 0 ' 8 Sjeverozapadna 1 ° 6 4 Hrvatska N " 0 ' 8 !( 1 ° Cartographic Information 6 4 1:20000 Full color ISO A1, low resolution (100 dpi) 0 ! 0 0 0 5 5 0 0,5 1 2 8 8 2 2 km 1 1 5 5 Grid: W GS 1984 UTM Zone 33N map coordinate system Tick marks: WGS 84 geographical coordinate system ± Legend Crisis Information Hydrology Flooded Area (18/09/2014) River General Information Stream Area of Interest N Canal " 0 ' 7 1 Settlements ! ° 6 Ditch 4 ! Populated Place Lake N " Residential 0 ' 7 0 0 River 1 0 0 ° 6 0 0 Agricultural 4 7 7 2 2 1 1 5 5 Cemetery Green Area Recreational Urbanized Multi-functional ! N " 0 0 0 ' 6 0 0 1 ° 5 5 6 5 5 4 2 2 Map Information 1 1 5 5 Due to severe raining in last days, extremely high water level is recorded on almost all rivers N in the northern part of Croatia.
    [Show full text]
  • Health Effects Support Document for Hexachlorobutadiene Health Effects Support Document for Hexachlorobutadiene
    Health Effects Support Document for Hexachlorobutadiene Health Effects Support Document for Hexachlorobutadiene U.S. Environmental Protection Agency Office of Water (4304T) Health and Ecological Criteria Division Washington, DC 20460 www.epa.gov/safewater/ EPA 822-R-03-002 February 2003 Printed on Recycled Paper FOREWORD The Safe Drinking Water Act (SDWA), as amended in 1996, requires the Administrator of the Environmental Protection Agency (EPA) to establish a list of contaminants to aid the agency in regulatory priority setting for the drinking water program. In addition, SDWA requires EPA to make regulatory determinations for no fewer than five contaminants by August 2001. The criteria used to determine whether or not to regulate a chemical on the CCL are the following: The contaminant may have an adverse effect on the health of persons. The contaminant is known to occur or there is a substantial likelihood that the contaminant will occur in public water systems with a frequency and at levels of public health concern. In the sole judgment of the administrator, regulation of such contaminant presents a meaningful opportunity for health risk reduction for persons served by public water systems. The Agency’s findings for the three criteria are used in making a determination to regulate a contaminant. The Agency may determine that there is no need for regulation when a contaminant fails to meet one of the criteria. This document provides the health effects basis for the regulatory determination for hexachlorobutadiene. In arriving at the regulatory determination, data on toxicokinetics, human exposure, acute and chronic toxicity to animals and humans, epidemiology, and mechanisms of toxicity were evaluated.
    [Show full text]
  • Evaluation of Wetlands and Floodplain Areas in the Danube River Basin Final Report May 1999
    DANUBE POLLUTION REDUCTION PROGRAMME EVALUATION OF WETLANDS AND FLOODPLAIN AREAS IN THE DANUBE RIVER BASIN FINAL REPORT MAY 1999 Programme Coordination Unit UNDP/GEF Assistance prepared by WWF Danube-Carpathian-Programme and WWF-Auen-Institut (Germany) DANUBE POLLUTION REDUCTION PROGRAMME EVALUATION OF WETLANDS AND FLOODPLAIN AREAS IN THE DANUBE RIVER BASIN FINAL REPORT MAY 1999 Programme Coordination Unit UNDP/GEF Assistance prepared by WWF Danube-Carpathian-Programme and WWF-Auen-Institut (Germany) Preface The "Evaluation of Wetlands and Flkoodplain Areas in the Danube River Basin" study was prepared in the frame of the Danube Pollution Reduction Programme (PRP). The Study has been undertaken to define priority wetland and floodplain rehabilitation sites as a component of the Pollution reduction Programme. The present report addresses the identification of former floodplains and wetlands in the Danube River Basin, as well as the description of the current status and evaluation of the ecological importance of the potential for rehabilitation. Based on this evaluation, 17 wetland/floodplain sites have been identified for rehabilitation considering their ecological importance, their nutrient removal capacity and their role in flood protection. Most of the identified wetlands will require transboundary cooperation and represent an important first step in retoring the ecological balance in the Danube River Basin. The results are presented in the form of thematic maps that can be found in Annex I of the study. The study was prepared by the WWF-Danube-Carpathian-Programme and the WWF-Auen-Institut (Institute for Floodplains Ecology, WWF-Germany), under the guidance of the UNDP/GEF team of experts of the Danube Programme Coordination Unit (DPCU) in Vienna, Austria.
    [Show full text]
  • JULIAN ALPS TRIGLAV NATIONAL PARK 2The Julian Alps
    1 JULIAN ALPS TRIGLAV NATIONAL PARK www.slovenia.info 2The Julian Alps The Julian Alps are the southeast- ernmost part of the Alpine arc and at the same time the mountain range that marks the border between Slo- venia and Italy. They are usually divided into the East- ern and Western Julian Alps. The East- ern Julian Alps, which make up approx- imately three-quarters of the range and cover an area of 1,542 km2, lie entirely on the Slovenian side of the border and are the largest and highest Alpine range in Slovenia. The highest peak is Triglav (2,864 metres), but there are more than 150 other peaks over 2,000 metres high. The emerald river Soča rises on one side of the Julian Alps, in the Primorska re- gion; the two headwaters of the river Sava – the Sava Dolinka and the Sava Bohinjka – rise on the other side, in the Gorenjska region. The Julian Alps – the kingdom of Zlatorog According to an ancient legend a white chamois with golden horns lived in the mountains. The people of the area named him Zlatorog, or “Goldhorn”. He guarded the treasures of nature. One day a greedy hunter set off into the mountains and, ignoring the warnings, tracked down Zlatorog and shot him. Blood ran from his wounds Chamois The Triglav rose and fell to the ground. Where it landed, a miraculous plant, the Triglav rose, sprang up. Zlatorog ate the flowers of this plant and its magical healing powers made him invulnerable. At the same time, however, he was saddened by the greed of human beings.
    [Show full text]
  • World Bank Document
    work in progress for public discussion Public Disclosure Authorized Water Resources Management in South Eastern Public Disclosure Authorized Europe Volume II Country Water Notes and Public Disclosure Authorized Water Fact Sheets Environmentally and Socially Public Disclosure Authorized Sustainable Development Department Europe and Central Asia Region 2003 The International Bank for Reconstruction and Development / The World Bank 1818 H Street, N.W., Washington, DC 20433, USA Manufactured in the United States of America First Printing April 2003 This publication is in two volumes: (a) Volume 1—Water Resources Management in South Eastern Europe: Issues and Directions; and (b) the present Volume 2— Country Water Notes and Water Fact Sheets. The Environmentally and Socially Sustainable Development (ECSSD) Department is distributing this report to disseminate findings of work-in-progress and to encourage debate, feedback and exchange of ideas on important issues in the South Eastern Europe region. The report carries the names of the authors and should be used and cited accordingly. The findings, interpretations and conclusions are the authors’ own and should not be attributed to the World Bank, its Board of Directors, its management, or any member countries. For submission of comments and suggestions, and additional information, including copies of this report, please contact Ms. Rita Cestti at: 1818 H Street N.W. Washington, DC 20433, USA Email: [email protected] Tel: (1-202) 473-3473 Fax: (1-202) 614-0698 Printed on Recycled Paper Contents
    [Show full text]
  • Removal of AOX in Activated Sludge of Industrial Chemical Dyestuff with Bimetallic Pd/Fe Particles
    water Article Removal of AOX in Activated Sludge of Industrial Chemical Dyestuff with Bimetallic Pd/Fe Particles Cancan Xu 1, Rui Liu 1, Wei Zheng 1,*, Lichu Lin 1 and Lvjun Chen 1,2 1 Zhejiang Provincial Key Laboratory of Water Science and Technology, Department of Environment in Yangtze Delta Region Institute of Tsinghua University, Jiaxing 314006, China; [email protected] (C.X.); [email protected] (R.L.); sifl[email protected] (L.L.); [email protected] (L.C.) 2 School of Environment, Tsinghua University, Beijing 100084, China * Correspondence: [email protected]; Tel.: +86-0573-8258-1603 Abstract: Pd/Fe bimetallic particles were synthesized by chemical deposition and used to remove absorbable organic halogens (AOX) in the activated sludge of a chemical dyestuff wastewater treatment plant. Bath experiments demonstrated that the Pd/Fe bimetallic particles could effectively remove AOX. It indicated several factors, such as Pd loading, the amount of Pd/Fe used, initial activated sludge pH, and reaction time, which could affect the removal effect. The results showed that increasing the Pd content in Pd/Fe particles, from 0.01 to 0.05 wt %, significantly increased the removal efficiency of AOX in activated sludge. The Pd/Fe particles had a much higher removal efficiency of AOX in the activated sludge than bare Fe particles. A slightly acidic condition with a Pd content of 0.05% and 10 g/L of Pd/Fe was beneficial to the process of removing AOX in activated sludge. In detail, the removal efficiency of AOX in the activated sludge could reach 50.7% after 15 days of reaction with 10 g/L of Pd/Fe (Pd loading 0.05 wt %) and at an initial pH of 6.0 during the experiments.
    [Show full text]
  • The Effect of Individual and Mixtures of Mycotoxins and Persistent
    Food and Chemical Toxicology 130 (2019) 68–78 Contents lists available at ScienceDirect Food and Chemical Toxicology journal homepage: www.elsevier.com/locate/foodchemtox The effect of individual and mixtures of mycotoxins and persistent organochloride pesticides on oestrogen receptor transcriptional activation T using in vitro reporter gene assays ∗ Ukpai A. Ezea,b,1, John Huntrissc, Michael N. Routledged, Yun Yun Gonga,e, , Lisa Connollyf a School of Food Science and Nutrition, Food Science Building, University of Leeds, LS2 9JT, UK b Department of Medical Laboratory Sciences, Faculty of Health Sciences, Ebonyi State University, P. M. B. 053, Abakaliki, Nigeria c Division of Reproduction and Early Development, Leeds Institute of Cardiovascular and Metabolic Medicine, School of Medicine, University of Leeds, LS2 9JT, UK d Leeds Institute of Cardiovascular and Metabolic Medicine, School of Medicine, University of Leeds, LS2 9JT, UK e Department of Food Safety Risk Assessment, China National Center for Food Safety Risk Assessment, Ministry of Health, Beijing, 100021, PR China f Institute for Global Food Security, School of Biological Sciences, Queens University Belfast, Northern Ireland, BT9 5AF, UK ARTICLE INFO ABSTRACT Keywords: The mycotoxins zearalenone (ZEN) and alpha-zearalenone (α-ZOL), which are common contaminants of agri- Mycotoxins food products, are known for their oestrogenic potential. In addition to mycotoxins, food may also contain Chemical mixtures pesticides with oestrogenic properties such as 1,1,1-trichloro-2,2-bis(p-chlorophenyl) ethane (p,p'-DDT) and 1,1- Food-borne chemical contaminants dichloro-2,2-bis(p-chlorophenyl) ethylene (p,p'-DDE), raising the question on the potential effects of individual Reporter gene assay and combinations of these xeno-oestrogens on the action of natural oestrogens.
    [Show full text]
  • TRIGLAV NATIONAL PARK (Slovenia)
    Strasbourg, 6 January 2003 PE-S-DE (2002) 22 [diplome/docs/2003/de06e_03] English only Committee for the activities of the Council of Europe in the field of biological and landscape diversity (CO-DBP) Group of specialists – European Diploma of Protected Areas 20-21 January 2003 Room 2, Palais de l'Europe, Strasbourg TRIGLAV NATIONAL PARK (Slovenia) APPLICATION for the European Diploma of Protected Areas Document established by the Directorate of Culture and Cultural and Natural Heritage This document will not be distributed at the meeting. Please bring this copy. Ce document ne sera plus distribué en réunion. Prière de vous munir de cet exemplaire. PE-S-DE (2003) 22 - 2 - INFORMATION FORM FOR NEW APPLICATION FOR THE EUROPEAN DIPLOMA OF PROTECTED AREAS Council of Europe European Diploma Information form for Candidate Sites This form is also available on diskette Site code (to be given by the Council of Europe) 1. SITE IDENTIFICATION 1.1. SITE NAME Triglavski narodni park 1.2. COUNTRY Slovenija 1.3. DATE CANDIDATURE 1.4. SITE INFORMATION COMPILATION DATE Y Y Y Y M M D D - 3 - PE-S-DE (2003) 22 1.5. ADDRESSES: administrative authorities National authority Regional authority Local authority Name: Name: Name: Javni zavod Triglavski Address: Address: narodni park Address: Triglavski narodni park, Kidričeva 2, 4260 Bled, Slovenija Tel. +386 4 5780 200 ............. Tel.......................................... Tel. ......................................... Fax.+ 386 4 5780 201............. Fax. ........................................ Fax.........................................
    [Show full text]
  • Safe Thermal Decomposition of Organochloride Pesticides by Submerged Oxidation in Molten Salts LAINETTI, P
    Safe Thermal Decomposition of Organochloride Pesticides by Submerged Oxidation in Molten Salts LAINETTI, P. E. O. A a. Instituto de Pesquisas Energéticas e Nucleares IPEN-CNEN/SP, São Paulo * Corresponding author: [email protected] Abstract This study was motivated by the current interest in the world in the development of advanced processes for waste decomposition, category in which the process described herein is inserted. This interest stems from the need for safer processes for the decomposition of some wastes, particularly those deemed hazardous or present significant impact on the environment. The technology developed fits into this principle and it is applicable for intrinsically safe disposal of hazardous organic wastes, particularly the organochloride, whose degradation has presented problems when using the most common methods, such as incineration. Pesticides banned, obsolete or discarded constitute a serious environmental risk around the world, especially in developing countries. The HCHS, or Hexachlorcyclohexanes also called BHC or Lindane, are organochloride insecticides that have been banned in most countries in the 70s and 80s. It is one of the compounds that constitute the group of so-called POPs, or persistent organic pollutants that are regulated internationally by the Basel Convention. Among the major POPs could be cited pesticides, dioxins and PCBs that represent, according to the United Nations Industrial Development Organization - UNIDO, one of the most serious and urgent problems to be faced, because on the one hand,
    [Show full text]