Recombinant Human Gamma-1-Syntrophin(SNTG1)

Total Page：16

File Type：pdf, Size：1020Kb

Product Datasheet Recombinant Human Gamma-1-syntrophin(SNTG1) Catalog No: #AP77208 Package Size: #AP77208-1 20ug #AP77208-2 100ug #AP77208-3 500ug Orders: [email protected] Support: [email protected] Description Product Name Recombinant Human Gamma-1-syntrophin(SNTG1) Brief Description Recombinant Protein Host Species Yeast Purification Greater than 90% as determined by SDS-PAGE. Immunogen Description Expression Region:1-517aaSequence Info:Full Length Other Names Syntrophin-4 Accession No. Q9NSN8 Calculated MW 61.5 kDa Tag Info N-terminal 6xHis-tagged and C-terminal Myc-tagged Target Sequence MDFRTACEETKTGICLLQDGNQEPFKVRLHLAKDILMIQEQDVICVSGEPFYSGERTVTIRRQTVGGFGLSIKG GAEHNIPVVVSKISKEQRAELSGLLFIGDAILQINGINVRKCRHEEVVQVLRNAGEEVTLTVSFLKRAPAFLKLPL NEDCACAPSDQSSGTSSPLCDSGLHLNYHPNNTDTLSCSSWPTSPGLRWEKRWCDLRLIPLLHSRFSQYVP GTDLSRQNAFQVIAVDGVCTGIIQCLSAEDCVDWLQAIATNISNLTKHNIKKINRNFPVNQQIVYMGWCEAREQ DPLQDRVYSPTFLALRGSCLYKFLAPPVTTWDWTRAEKTFSVYEIMCKILKDSDLLDRRKQCFTVQSESGEDL YFSVELESDLAQWERAFQTATFLEVERIQCKTYACVLESHLMGLTIDFSTGFICFDAATKAVLWRYKFSQLKGS SDDGKSKIKFLFQNPDTKQIEAKELEFSNLFAVLHCIHSFFAAKVACLDPLFLGNQATASTAASSATTSKAKYTT Formulation Tris-based buffer50% glycerol Storage The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C,-80°C. The shelf life of lyophilized form is 12 months at -20°C,-80°C.Notes:Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week. Background Adapter protein that binds to and probably organizes the subcellular localization of a variety of proteins. May link various receptors to the actin cytoskeleton and the dystrophin glycoprotein complex. May participate in regulating the subcellular location of diacylglycerol kinase-zeta to ensure that diacylglycerol is rapidly inactivated following receptor activation. References "Gamma1- and gamma2-syntrophins, two novel dystrophin-binding proteins localized in neuronal cells." Piluso G., Mirabella M., Ricci E., Belsito A., Abbondanza C., Servidei S., Puca A.A., Tonali P., Puca G.A., Nigro V. J. Biol. Chem. 275:15851-15860(2000)Research Topic:Others Note: This product is for in vitro research use only and is not intended for use in humans or animals. Address: 8400 Baltimore Ave., Suite 302, College Park, MD 20740, USA http://www.sabbiotech.com 1.

Copy Link

Recommended publications

Table S1 the Four Gene Sets Derived from Gene Expression Profiles of Escs and Differentiated Cells
Table S1 The four gene sets derived from gene expression profiles of ESCs and differentiated cells Uniform High Uniform Low ES Up ES Down EntrezID GeneSymbol EntrezID GeneSymbol EntrezID GeneSymbol EntrezID GeneSymbol 269261 Rpl12 11354 Abpa 68239 Krt42 15132 Hbb-bh1 67891 Rpl4 11537 Cfd 26380 Esrrb 15126 Hba-x 55949 Eef1b2 11698 Ambn 73703 Dppa2 15111 Hand2 18148 Npm1 11730 Ang3 67374 Jam2 65255 Asb4 67427 Rps20 11731 Ang2 22702 Zfp42 17292 Mesp1 15481 Hspa8 11807 Apoa2 58865 Tdh 19737 Rgs5 100041686 LOC100041686 11814 Apoc3 26388 Ifi202b 225518 Prdm6 11983 Atpif1 11945 Atp4b 11614 Nr0b1 20378 Frzb 19241 Tmsb4x 12007 Azgp1 76815 Calcoco2 12767 Cxcr4 20116 Rps8 12044 Bcl2a1a 219132 D14Ertd668e 103889 Hoxb2 20103 Rps5 12047 Bcl2a1d 381411 Gm1967 17701 Msx1 14694 Gnb2l1 12049 Bcl2l10 20899 Stra8 23796 Aplnr 19941 Rpl26 12096 Bglap1 78625 1700061G19Rik 12627 Cfc1 12070 Ngfrap1 12097 Bglap2 21816 Tgm1 12622 Cer1 19989 Rpl7 12267 C3ar1 67405 Nts 21385 Tbx2 19896 Rpl10a 12279 C9 435337 EG435337 56720 Tdo2 20044 Rps14 12391 Cav3 545913 Zscan4d 16869 Lhx1 19175 Psmb6 12409 Cbr2 244448 Triml1 22253 Unc5c 22627 Ywhae 12477 Ctla4 69134 2200001I15Rik 14174 Fgf3 19951 Rpl32 12523 Cd84 66065 Hsd17b14 16542 Kdr 66152 1110020P15Rik 12524 Cd86 81879 Tcfcp2l1 15122 Hba-a1 66489 Rpl35 12640 Cga 17907 Mylpf 15414 Hoxb6 15519 Hsp90aa1 12642 Ch25h 26424 Nr5a2 210530 Leprel1 66483 Rpl36al 12655 Chi3l3 83560 Tex14 12338 Capn6 27370 Rps26 12796 Camp 17450 Morc1 20671 Sox17 66576 Uqcrh 12869 Cox8b 79455 Pdcl2 20613 Snai1 22154 Tubb5 12959 Cryba4 231821 Centa1 17897
[Show full text]
SYMPOSIUM References 1
J Orthopaed Traumatol (2008): 24 November 2008 DOI 10.1007/s10195-008-0030-6 24 NOVEMBER 2008 SYMPOSIUM References 1. Pola E, Lattanzi W, Pecorini G, Logroscino CA, Robbins PD (2005) Gene therapy for in vivo bone formation: recent TISSUE ENGINEERING advances. Eur Rev Med Pharmacol Sci 9(3):167–174 2. Pola E, Gao W, Zhou Y, Pola R, Lattanzi W, Sfeir C, et al (2004) A CLINICALLY RELEVANT GENE THERAPY APPROACH Efficient bone formation by gene transfer of human LIM miner- TO INDUCE OSTEOGENESIS: STUDY OF THE NEW alization protein-3. Gene Ther 11(8):683 –693 GROWTH FACTOR LIM MINERALIZAZION PROTEIN-3 3. Lattanzi W, Parrilla C, Fetoni A, Logroscino G, Straface G, Pecorini G, Tampieri A, Bedini R, Pecci R, Michetti F, E. Pola Gambotto A, Robbins PD, Pola E (2008) Ex-vivo transduced autologous skin fibroblasts expressing human Lim Minera - Department of Orthopaedics and Traumatology, Università lization Protein-3 efficiently form new bone in animal models. Cattolica del Sacro Cuore, School of Medicine (Rome-IT) Gene Therapy [Epub ahead of print] Recombinant proteins, such as the bone morphogenetic proteins have been used to enhance repair of non-union fractures and facil- TYPE-I COLLAGEN MEMBRANE AS A SCAFFOLD FOR itate new bone formation in animal models as well as in clinical TENDON REPAIR: AN IN VITRO AND IN VIVO STUDY applications. However, a significant amount of recombinant BMP is required to promote osteogenesis and frequently the extent of A. Gigante, E. Cesari, A. Busilacchi, S. Manzotti, F. Greco new bone formation is low. In contrast, local gene transfer of BMPs has been shown to be more efficient in promoting osteogenesis in Department of Orthopaedics, Polytechnic University of Marche rodents than the use of recombinant proteins.
[Show full text]
Impact of a Diet and Activity Health Promotion Intervention on Regional
Hibler et al. Clinical Epigenetics (2019) 11:133 https://doi.org/10.1186/s13148-019-0707-0 RESEARCH Open Access Impact of a diet and activity health promotion intervention on regional patterns of DNA methylation Elizabeth Hibler1* , Lei Huang2, Jorge Andrade2,3 and Bonnie Spring1 Abstract Background: Studies demonstrate the impact of diet and physical activity on epigenetic biomarkers, specifically DNA methylation. However, no intervention studies have examined the combined impact of dietary and activity changes on the blood epigenome. The objective of this study was to examine the impact of the Make Better Choices 2 (MBC2) healthy diet and activity intervention on patterns of epigenome-wide DNA methylation. The MBC2 study was a 9-month randomized controlled trial among adults aged 18–65 with non-optimal levels of health behaviors. The study compared three 12-week interventions to (1) simultaneously increase exercise and fruit/ vegetable intake, while decreasing sedentary leisure screen time; (2) sequentially increase fruit/vegetable intake and decrease leisure screen time first, then increase exercise; (3) increase sleep and decrease stress (control). We collected blood samples at baseline, 3 and 9 months, and measured DNA methylation using the Illumina EPIC (850 k) BeadChip. We examined region-based differential methylation patterns using linear regression models with the false discovery rate of 0.05. We also conducted pathway analysis using gene ontology (GO), KEGG, and IPA canonical pathway databases. Results: We found no differences between the MBC2 population (n = 340) and the subsample with DNA methylation measured (n = 68) on baseline characteristics or the impact of the intervention on behavior change.
[Show full text]
Pharmacogenetics of Response to Neoadjuvant Paclitaxel Treatment for Locally Advanced Breast Cancer
www.impactjournals.com/oncotarget/ Oncotarget, 2017, Vol. 8, (No. 63), pp: 106454-106467 Research Paper Pharmacogenetics of response to neoadjuvant paclitaxel treatment for locally advanced breast cancer Andric C. Perez-Ortiz1,2, Israel Ramírez1, Juan C. Cruz-López3,*, Cynthia Villarreal- Garza4,*, Alexandra Luna-Angulo5, Esmeralda Lira-Romero1, Salvador Jiménez- Chaidez1, José Díaz-Chávez6, Juan A. Matus-Santos6, Laura Sánchez-Chapul5, Patricia Mendoza-Lorenzo7 and Francisco J. Estrada-Mena1 1Universidad Panamericana, Escuela de Medicina, Mexico City, Mexico 2Yale University School of Public Health, Laboratory of Epidemiology and Public Health, New Haven, CT, USA 3Hospital Regional ISSSTE Puebla and Hospital General Zona Norte SSEP Puebla, Puebla City, Mexico 4Depto. de Investigacion, Instituto Nacional de Cancerologia, Centro de Cancer de Mama, Tecnologico de Monterrey, Monterrey, Nuevo León, Mexico 5Instituto Nacional de Rehabilitación, Mexico City, Mexico 6Unidad de Investigación Biomédica en Cáncer, Instituto de Investigaciones Biomédicas, UNAM/Instituto Nacional de Cancerología, Mexico City, Mexico 7División Académica de Ciencias Básicas, Unidad Chontalpa, Universidad Juárez Autónoma de Tabasco, Tabasco, Mexico *These authors contributed equally to this work Correspondence to: Francisco J. Estrada-Mena, email: [email protected] Keywords: pharmacogenetics; paclitaxel; breast cancer; genetic markers; single nucleotide polymorphism Received: July 27, 2017 Accepted: October 27, 2017 Published: November 15, 2017 Copyright: Perez-Ortiz et al. This is an open-access article distributed under the terms of the Creative Commons Attribution License 3.0 (CC BY 3.0), which permits unrestricted use, distribution, and reproduction in any medium, provided the original author and source are credited. ABSTRACT Locally advanced breast cancer (LABC) cases have a varying five-year survival rate, mainly influenced by the tumor response to chemotherapy.
[Show full text]
Set2-Mediated Alternative Splicing of Srsf11 Regulates Cocaine Reward Behavior
bioRxiv preprint doi: https://doi.org/10.1101/798009; this version posted October 8, 2019. The copyright holder for this preprint (which was not certified by peer review) is the author/funder, who has granted bioRxiv a license to display the preprint in perpetuity. It is made available under aCC-BY-NC-ND 4.0 International license. Graphic Legend: Epigenetic editing enriches H3K36me3 at the gene for Srsf11, a splice factor. Enrichment of H3K36me3 causes alternative splicing of Srsf11, in the form of increased intron retention. After this manipulation in a brain reward region, mice show greater preference for a cocaine reward. bioRxiv preprint doi: https://doi.org/10.1101/798009; this version posted October 8, 2019. The copyright holder for this preprint (which was not certified by peer review) is the author/funder, who has granted bioRxiv a license to display the preprint in perpetuity. It is made available under aCC-BY-NC-ND 4.0 International license. Summary Alternative splicing is a key mechanism for neuronal gene regulation, and is grossly altered in mouse brain reward regions following investigator-administered cocaine. It is well established that cocaine epigenetically regulates transcription, yet mechanism(s) by which cocaine-induced epigenetic modifications regulate alternative splicing is largely unexplored. Our group and others have previously identified the histone modification, H3K36me3, as a putative splicing regulator. However, it has not yet been possible to establish the direct causal relevance of this modification to alternative splicing in brain or any other context. We found that mouse cocaine self-administration caused widespread alternative splicing, concomitant with enrichment of H3K36me3 at splice junctions.
[Show full text]
UC San Diego Electronic Theses and Dissertations
UC San Diego UC San Diego Electronic Theses and Dissertations Title Biomechanical implications of muscle cell-ECM communication Permalink https://escholarship.org/uc/item/8qf1428m Author Meyer, Gretchen Ann Publication Date 2011 Peer reviewed|Thesis/dissertation eScholarship.org Powered by the California Digital Library University of California UNIVERSITY OF CALIFORNIA, SAN DIEGO Biomechanical Implications of Muscle Cell-ECM Communication A dissertation submitted in partial satisfaction of the requirements for the degree Doctor of Philosophy in Bioengineering by Gretchen Ann Meyer Committee in charge: Professor Richard L. Lieber, Chair Professor Andrew D. McCulloch, Co-Chair Professor Anne Hoger Professor Geert Schmid-Schonbein Professor Samuel R. Ward 2011 Copyright Gretchen Ann Meyer, 2011 All rights reserved. The dissertation of Gretchen Ann Meyer is approved, and it is acceptable in quality and form for publication on microﬁlm and electronically: Co-Chair Chair University of California, San Diego 2011 iii DEDICATION This work is dedicated to my parents whose constant and unconditional support has always made me feel invincible. And to my colleagues and friends whose light has guided me through this mysterious world of science. iv EPIGRAPH Muscle is a metaphor for life; sometimes we could all use a good stretch. v TABLE OF CONTENTS Signature Page . iii Dedication . iv Epigraph . .v Table of Contents . vi List of Figures . .x List of Tables . xiii Acknowledgements . xiv Vita........................................ xvi Abstract of the Dissertation . xviii Chapter 1 Introduction . .1 1.1 Structure and function in skeletal muscle . .1 1.1.1 Extracellular structure . .2 1.1.2 Intracellular structure . .3 1.2 Desmin in muscle physiology .
[Show full text]
Evolutionary History of the Human Multigene Families Reveals
Pervaiz et al. BMC Evolutionary Biology (2019) 19:128 https://doi.org/10.1186/s12862-019-1441-0 RESEARCH ARTICLE Open Access Evolutionary history of the human multigene families reveals widespread gene duplications throughout the history of animals Nashaiman Pervaiz1, Nazia Shakeel1, Ayesha Qasim1, Rabail Zehra1, Saneela Anwar1, Neenish Rana1, Yongbiao Xue2, Zhang Zhang2, Yiming Bao2* and Amir Ali Abbasi1* Abstract Background: The hypothesis that vertebrates have experienced two ancient, whole genome duplications (WGDs) is of central interest to evolutionary biology and has been implicated in evolution of developmental complexity. Three-way and Four-way paralogy regions in human and other vertebrate genomes are considered as vital evidence to support this hypothesis. Alternatively, it has been proposed that such paralogy regions are created by small-scale duplications that occurred at different intervals over the evolution of life. Results: To address this debate, the present study investigates the evolutionary history of multigene families with at least three-fold representation on human chromosomes 1, 2, 8 and 20. Phylogenetic analysis and the tree topology comparisons classified the members of 36 multigene families into four distinct co-duplicated groups. Gene families falling within the same co-duplicated group might have duplicated together, whereas genes belong to different co-duplicated groups might have distinct evolutionary origins. Conclusion: Taken together with previous investigations, the current study yielded no proof in favor of WGDs hypothesis. Rather, it appears that the vertebrate genome evolved as a result of small-scale duplication events, that cover the entire span of the animals’ history. Keywords: Human, Whole genome duplications, Segmental duplications, Paralogons, Paralogy regions, Vertebrate, Multigene families, Phylogenetic analysis Background explanation for the complexity of modern-day vertebrate To elucidate the genetic underpinnings of major changes genome [1].
[Show full text]
Tesi Guarasci.Pdf
Index Summary 2 Chapter I. General Introduction 4 Chapter II. Original Research Work: Epigenetic signature: implications for mitochondrial quality control in human aging 29 Conclusive Remarks 66 Appendix. Published Works 68 1 Summary During my PhD program, my work has been addressed to the study of the role of epigenetic modifications in aging and in age-related phenotypes. Epigenetics is the study of changes in gene expression that do not involve changes to the underlying DNA sequence. These changes affect cellular phenotypic expression by regulating relative gene expression levels. They are a common and natural process in living cells and are tightly controlled by pre-programmed mechanisms. Epigenetics modifications can be influenced by multiple factors including environmental conditions, lifestyle, nutrition, use of drugs, disease state and age. Patterns of DNA methylation, the best known and characterized epigenetic modification, change during aging; indeed, with increasing aging, genome-wide methylation levels decrease, meanwhile genomic regions, including CpG islands, become more methylated. Analyses of the above patterns provided new perspectives for establishing powerful biomarkers of human aging which have the potential to generate accurate prediction not only of the chronological but also of the biological age. The first section of the PhD thesis consists in a comprehensive overview of the general features of DNA methylation and its implication in age and age-related diseases. The topic is addressed referring to the methylation patterns established not only at nuclear but also at mitochondrial genome level. In addition, the influence of a number of environmental factors on the above patterns is also discussed. In the second section, an original research work, carried out in order to identify novel biomarkers of aging, is reported.
[Show full text]
IL-1Β Regulates FHL2 and Other Cytoskeleton-Related Genes in Human Chondrocytes
IL-1β Regulates FHL2 and Other Cytoskeleton-Related Genes in Human Chondrocytes Helga Joos,1 Wolfgang Albrecht,2 Stefan Laufer,3 Heiko Reichel,4 and Rolf E Brenner1 1Division for Biochemistry of Joint and Connective Tissue Diseases, Department of Orthopedics, University of Ulm, Ulm, Germany; 2ratiopharm group, Department of Drug Research, Ulm, Germany; 3Institute of Pharmacy, Department of Pharmaceutical and Medicinal Chemistry, Eberhard-Karls University Tübingen, Tübingen, Germany; 4Department of Orthopedics, University of Ulm, Ulm, Germany In osteoarthritis (OA), cartilage destruction is associated not only with an imbalance of anabolic and catabolic processes but also with alterations of the cytoskeletal organization in chondrocytes, although their pathogenetic origin is largely unknown so far. Therefore, we have studied possible effects of the proinflammatory cytokine IL-1β on components of the cytoskeleton in OA chondrocytes on gene expression level. Using a whole genome array, we found that IL-1β is involved in the regulation of many cytoskeleton-related genes. Apart from well-known cytoskeletal components, the expression and regulation of four genes cod- ing for LIM proteins were shown. These four genes were previously undescribed in the chondrocyte context. Quantitative PCR analysis confirmed significant downregulation of Fhl1, Fhl2, Lasp1, and Pdlim1 as well as Tubb and Vim by IL-1β. Inhibition of p38 mitogen-activated protein kinase (MAPK) by SB203580 counteracted the influence of IL-1β on Fhl2 and Tubb expression, indicat- ing partial involvement of this signaling pathway. Downregulation of the LIM-only protein FHL2 was confirmed additionally on the protein level. In agreement with these results, IL-1β induced changes in the morphology of chondrocytes, the organization of the cytoskeleton, and the cellular distribution of FHL2.
[Show full text]
Cell Leukemia Virus Tax Oncoprotein
bioRxiv preprint doi: https://doi.org/10.1101/2021.08.25.457680; this version posted August 25, 2021. The copyright holder for this preprint (which was not certified by peer review) is the author/funder. All rights reserved. No reuse allowed without permission. Interactome and structural basis for targeting the human T- cell leukemia virus Tax oncoprotein Sibusiso B. Maseko1, Inge Van Molle2, Karim Blibek1, Christoph Gorgulla3-5, Julien Olivet1, Jeremy Blavier1, Charlotte Vandermeulen1, Stéphanie Skupiewski1, Deeya Saha1, Thandokuhle Ntombela6, Julianne Lim7, Frederique Lembo8, Aurelie Beauvois9, Malik Hamaidia9, Jean-Paul Borg8, Pascale Zimmermann8,10, Frank Delvigne11, Luc Willems9,11, Johan Van Weyenbergh12, Dae-Kyum Kim7, 13-15, Franck Dequiedt16, Haribabu Arthanari3-5, Alexander N. Volkov2,17,*, Jean-Claude Twizere1,11,18,* 1Laboratory of Viral Interactomes, Unit of Molecular Biology of Diseases, GIGA Institute, University of Liege, Liège, Belgium. 2VIB-VUB Center for Structural Biology, Flemish Institute of Biotechnology (VIB), Pleinlaan 2, Brussels, Belgium. 3Department of Biological Chemistry and Molecular Pharmacology, Blavatnik Institute, Harvard Medical School, Boston, MA, USA. 4Department of Physics, Faculty of Arts and Sciences, Harvard University, Cambridge, MA, USA. 5Department of Cancer Biology, Dana-Farber Cancer Institute, Boston, MA, USA. 6Catalysis and Peptide Research Unit, School of Health Sciences, University of KwaZulu Natal, Durban 4001, South Africa. 7Center for Personalized Medicine, Roswell Park Comprehensive Cancer Cen- ter, Buffalo, New York, USA. 8Aix Marseille Univ, CNRS, INSERM, Institut Paoli-Calmettes, CRCM, Equipe labellisée Ligue ‘Cell polarity, Cell signaling and Cancer, Marseille, France. 9Laboratory of Cellular and Molecular Epigenetics, Cancer Unit, GIGA Institute, University of Liege, Liege, Belgium. 10Department of Human Genetics, KU Leuven, Belgium.
[Show full text]
Effects of Paternal Obesity on the Metabolic Profile of Offspring: Alterations In
Effects of Paternal Obesity on the Metabolic Profile of Offspring: Alterations in Gastrocnemius Muscle GLUT4 Trafficking and Mesenteric Adipose Tissue Transcriptome A dissertation presented to the faculty of the College of Arts and Sciences of Ohio University In partial fulfillment of the requirements for the degree Doctor of Philosophy Xinhao Liu August 2018 © 2018 Xinhao Liu. All Rights Reserved 2 This dissertation titled Effects of Paternal Obesity on the Metabolic Profile of Offspring: Alterations in Gastrocnemius Muscle GLUT4 Trafficking and Mesenteric Adipose Tissue Transcriptome by XINHAO LIU has been approved for the Department of Biological Science and the College of Arts and Sciences by Felicia V. Nowak Associate Professor of Biomedical Science Joseph Shields Interim Dean, College of Arts and Sciences 3 ABSTRACT LIU, XINHAO, Ph.D., August 2018, Molecular and Cellular Biology Effects of Paternal Obesity on the Metabolic Profile of Offspring: Alterations in Gastrocnemius Muscle GLUT4 Trafficking and Mesenteric Adipose Tissue Transcriptome Director of Dissertation: Felicia V. Nowak Parental obesity increases the risk of obesity in offspring. The overall hypothesis of this work is that offspring inherit altered epigenetic marks from parents that are obese due to consumption of high fat diet (HFD). The first specific hypothesis was that decreased GLUT4 synthesis or impaired trafficking to plasma membrane occurs in insulin resistant HFDO. This study measured expression of total glucose transporter 4, (GLUT4), the major insulin-stimulated transporter of glucose into muscle and adipose cells, as well as its subcellular distribution in the gastrocnemius muscle. The data showed that the level of total GLUT-4, as indicated by a 46kd protein band, exhibits no difference between LFDO and HFDO at 1.5, 6 or 12 months.
[Show full text]
STAT3 Targets Suggest Mechanisms of Aggressive Tumorigenesis in Diffuse Large B Cell Lymphoma
STAT3 Targets Suggest Mechanisms of Aggressive Tumorigenesis in Diffuse Large B Cell Lymphoma Jennifer Hardee*,§, Zhengqing Ouyang*,1,2,3, Yuping Zhang*,4 , Anshul Kundaje*,†, Philippe Lacroute*, Michael Snyder*,5 *Department of Genetics, Stanford University School of Medicine, Stanford, CA 94305; §Department of Molecular, Cellular, and Developmental Biology, Yale University, New Haven, CT 06520; and †Department of Computer Science, Stanford University School of Engineering, Stanford, CA 94305 1The Jackson Laboratory for Genomic Medicine, Farmington, CT 06030 2Department of Biomedical Engineering, University of Connecticut, Storrs, CT 06269 3Department of Genetics and Developmental Biology, University of Connecticut Health Center, Farmington, CT 06030 4Department of Biostatistics, Yale School of Public Health, Yale University, New Haven, CT 06520 5Corresponding author: Department of Genetics, Stanford University School of Medicine, Stanford, CA 94305. Email: [email protected] DOI: 10.1534/g3.113.007674 Figure S1 STAT3 immunoblotting and immunoprecipitation with sc-482. Western blot and IPs show a band consistent with expected size (88 kDa) of STAT3. (A) Western blot using antibody sc-482 versus nuclear lysates. Lanes contain (from left to right) lysate from K562 cells, GM12878 cells, HeLa S3 cells, and HepG2 cells. (B) IP of STAT3 using sc-482 in HeLa S3 cells. Lane 1: input nuclear lysate; lane 2: unbound material from IP with sc-482; lane 3: material IP’d with sc-482; lane 4: material IP’d using control rabbit IgG. Arrow indicates the band of interest. (C) IP of STAT3 using sc-482 in K562 cells. Lane 1: input nuclear lysate; lane 2: material IP’d using control rabbit IgG; lane 3: material IP’d with sc-482.
[Show full text]