Anti-PPP3CA (Aa 1-84) Polyclonal Antibody (DPAB- DC2401) This Product Is for Research Use Only and Is Not Intended for Diagnostic Use

Total Page：16

File Type：pdf, Size：1020Kb

Anti-PPP3CA (aa 1-84) polyclonal antibody (DPAB- DC2401) This product is for research use only and is not intended for diagnostic use. PRODUCT INFORMATION Antigen Description PPP3CA (protein phosphatase 3, catalytic subunit, alpha isozyme) is a protein-coding gene. Diseases associated with PPP3CA include osteomyelitis, and down syndrome critical region, and among its related super-pathways are Fc epsilon RI signaling pathway and BCR signaling pathway. GO annotations related to this gene include enzyme binding and calcium ion binding. An important paralog of this gene is PPP3CC. Immunogen PPP3CA (NP_000935, 1 a.a. ~ 84 a.a) partial recombinant protein with GST tag. The sequence is MSEPKAIDPKLSTTDRVVKAVPFPPSHRLTAKEVFDNDGKPRVDILKAHLMKEGRLEESVALRIIT EGASILRQEKNLLDIDAP Source/Host Mouse Species Reactivity Human Conjugate Unconjugated Applications WB (Cell lysate), WB (Recombinant protein), ELISA, Size 50 μl Buffer 50 % glycerol Preservative None Storage Store at -20°C or lower. Aliquot to avoid repeated freezing and thawing. GENE INFORMATION Gene Name PPP3CA protein phosphatase 3, catalytic subunit, alpha isozyme [ Homo sapiens (human) ] Official Symbol PPP3CA Synonyms PPP3CA; protein phosphatase 3, catalytic subunit, alpha isozyme; CALN; CCN1; CNA1; CALNA; PPP2B; CALNA1; serine/threonine-protein phosphatase 2B catalytic subunit alpha isoform; 45-1 Ramsey Road, Shirley, NY 11967, USA Email: [email protected] Tel: 1-631-624-4882 Fax: 1-631-938-8221 1 © Creative Diagnostics All Rights Reserved calcineurin A alpha; CAM-PRP catalytic subunit; calmodulin-dependent calcineurin A subunit alpha isoform; protein phosphatase 2B, catalytic subunit, alpha isoform; protein phosphatase 3 (formerly 2B), catalytic subunit, alpha isoform; Entrez Gene ID 5530 Protein Refseq NP_000935 UniProt ID Q08209 Chromosome Location 4q24 Pathway Alzheimers disease; Alzheimers Disease; Amphetamine addiction; Amyotrophic lateral sclerosis (ALS) Function calcium ion binding; calmodulin binding; calmodulin-dependent protein phosphatase activity; drug binding 45-1 Ramsey Road, Shirley, NY 11967, USA Email: [email protected] Tel: 1-631-624-4882 Fax: 1-631-938-8221 2 © Creative Diagnostics All Rights Reserved.

Copy Link

Recommended publications

Single Nucleotide Polymorphisms Within Calcineurin-Encoding Genes
Annals of Applied Sport Science, vol. 4, no. 2, pp. 01-08, Summer 2016 DOI: 10.18869/acadpub.aassjournal.4.2.1 Original Article www.aassjournal.com www.AESAsport.com ISSN (Online): 2322 – 4479 Received: 06/03/2016 ISSN (Print): 2476–4981 Accepted: 26/06/2016 Single Nucleotide Polymorphisms within Calcineurin-Encoding Genes are Associated with Response to Aerobic Training in Han Chinese Males 1Rong-mei Xu, 2Tao Lu, 2Lingxian Yan, 1Qinghua Song* 1The Center of Physical Health, Henan Polytechnic University, Jiaozuo 454000, Henan Province, China. 2 The Lab of Human Body Science, Henan Polytechnic University, Jiaozuo 454000, Henan Province, China. ABSTRACT Calcineurin, which functions in calcium signaling, is expressed in skeletal and cardiac muscle and has been linked to sensitivity to muscle strength training. It is also proposed to contribute to individual aerobic endurance. To investigate the relationship between calcineurin-encoding genes and aerobic endurance traits, 126 young-adult Han Chinese males were enrolled in an aerobic exercise training study. Participants were genotyped for polymorphisms within the 5 genes (PPP3CA, PPP3CB, PPP3CC, PPP3R1 and PPP3R2) encoding calcineurin using restriction fragment length polymorphism polymerase chain reaction (PCR-RFLP) or matrix-assisted laser desorption ionization time-of-flight mass spectrometry (MALDI-TOF MS). Participants underwent 18 weeks of aerobic exercise training (running). Before and after the training period, maximal oxygen uptake (VO2max) and 12 km/h running economy were measured. Statistical analyses were performed using chi-square test and analysis of variance. The baseline value of VO2max was significantly associated with rs3804423 and rs2850965 loci in the PPP3CA gene (P<0.05).
[Show full text]
Protein Interactions in the Cancer Proteome† Cite This: Mol
Molecular BioSystems View Article Online PAPER View Journal | View Issue Small-molecule binding sites to explore protein– protein interactions in the cancer proteome† Cite this: Mol. BioSyst., 2016, 12,3067 David Xu,ab Shadia I. Jalal,c George W. Sledge Jr.d and Samy O. Meroueh*aef The Cancer Genome Atlas (TCGA) oﬀers an unprecedented opportunity to identify small-molecule binding sites on proteins with overexpressed mRNA levels that correlate with poor survival. Here, we analyze RNA-seq and clinical data for 10 tumor types to identify genes that are both overexpressed and correlate with patient survival. Protein products of these genes were scanned for binding sites that possess shape and physicochemical properties that can accommodate small-molecule probes or therapeutic agents (druggable). These binding sites were classified as enzyme active sites (ENZ), protein–protein interaction sites (PPI), or other sites whose function is unknown (OTH). Interestingly, the overwhelming majority of binding sites were classified as OTH. We find that ENZ, PPI, and OTH binding sites often occurred on the same structure suggesting that many of these OTH cavities can be used for allosteric modulation of Creative Commons Attribution 3.0 Unported Licence. enzyme activity or protein–protein interactions with small molecules. We discovered several ENZ (PYCR1, QPRT,andHSPA6)andPPI(CASC5, ZBTB32,andCSAD) binding sites on proteins that have been seldom explored in cancer. We also found proteins that have been extensively studied in cancer that have not been previously explored with small molecules that harbor ENZ (PKMYT1, STEAP3,andNNMT) and PPI (HNF4A, MEF2B,andCBX2) binding sites. All binding sites were classified by the signaling pathways to Received 29th March 2016, which the protein that harbors them belongs using KEGG.
[Show full text]
Calcineurin a (PPP3CA) (NM 000944) Human Tagged ORF Clone Product Data
OriGene Technologies, Inc. 9620 Medical Center Drive, Ste 200 Rockville, MD 20850, US Phone: +1-888-267-4436 [email protected] EU: [email protected] CN: [email protected] Product datasheet for RC219136 Calcineurin A (PPP3CA) (NM_000944) Human Tagged ORF Clone Product data: Product Type: Expression Plasmids Product Name: Calcineurin A (PPP3CA) (NM_000944) Human Tagged ORF Clone Tag: Myc-DDK Symbol: PPP3CA Synonyms: ACCIID; CALN; CALNA; CALNA1; CCN1; CNA1; IECEE; IECEE1; PPP2B Vector: pCMV6-Entry (PS100001) E. coli Selection: Kanamycin (25 ug/mL) Cell Selection: Neomycin This product is to be used for laboratory only. Not for diagnostic or therapeutic use. View online » ©2021 OriGene Technologies, Inc., 9620 Medical Center Drive, Ste 200, Rockville, MD 20850, US 1 / 5 Calcineurin A (PPP3CA) (NM_000944) Human Tagged ORF Clone – RC219136 ORF Nucleotide >RC219136 representing NM_000944 Sequence: Red=Cloning site Blue=ORF Green=Tags(s) TTTTGTAATACGACTCACTATAGGGCGGCCGGGAATTCGTCGACTGGATCCGGTACCGAGGAGATCTGCC GCCGCGATCGCC ATGTCCGAGCCCAAGGCAATTGATCCCAAGTTGTCGACGACCGACAGGGTGGTGAAAGCTGTTCCATTTC CTCCAAGTCACCGGCTTACAGCAAAAGAAGTGTTTGATAATGATGGAAAACCTCGTGTGGATATCTTAAA GGCGCATCTTATGAAGGAGGGAAGGCTGGAAGAGAGTGTTGCATTGAGAATAATAACAGAGGGTGCATCA ATTCTTCGACAGGAAAAAAATTTGCTGGATATTGATGCGCCAGTCACTGTTTGTGGGGACATTCATGGAC AATTCTTTGATTTGATGAAGCTCTTTGAAGTCGGGGGATCTCCTGCCAACACTCGCTACCTCTTCTTAGG GGACTATGTTGACAGAGGGTACTTCAGTATTGAATGTGTGCTGTATTTGTGGGCCTTGAAAATTCTCTAC CCCAAAACACTGTTTTTACTTCGTGGAAATCATGAATGTAGACATCTAACAGAGTATTTCACATTTAAAC AAGAATGTAAAATAAAGTATTCAGAACGCGTATATGATGCCTGTATGGATGCCTTTGACTGCCTTCCCCT
[Show full text]
Association of the PPP3CA C. 249G> a Variant with Clinical Outcomes Of
Journal name: Pharmacogenomics and Personalized Medicine Article Designation: ORIGINAL RESEARCH Year: 2017 Volume: 10 Pharmacogenomics and Personalized Medicine Dovepress Running head verso: Salgado et al Running head recto: PPP3CA c.249G>A variant and kidney transplantation open access to scientific and medical research DOI: http://dx.doi.org/10.2147/PGPM.S131390 Open Access Full Text Article ORIGINAL RESEARCH Association of the PPP3CA c.249G>A variant with clinical outcomes of tacrolimus-based therapy in kidney transplant recipients Patricia C Salgado1 Background: The effects of genetic variants related to the pharmacodynamic mechanisms of Fabiana DV Genvigir1 immunosuppressive drugs on their therapeutic efficacy and safety have been poorly explored. Claudia R Felipe2 This study was performed to investigate the influence of the PPP3CA c.249G>A variant on the Helio Tedesco-Silva Jr2 clinical outcomes of kidney transplant recipients. Jose O Medina-Pestana2 Patients and methods: A total of 148 Brazilian patients received tacrolimus (TAC)-based immunosuppressive therapy for 90 days post-kidney transplantation. The PPP3CA rs3730251 Sonia Q Doi3 (c.249G>A) polymorphism was determined by real-time polymerase chain reaction. Single- Mario H Hirata1 nucleotide polymorphism (SNP) data for CYP3A5 rs776746 (CYP3A5*3C; g.6986A G) were 1 > Rosario DC Hirata used to eliminate the confounding effects of this variant. 1Department of Clinical and Results: The PPP3CA c.249G>A SNP did not influence early TAC exposure, renal function, or Toxicological Analysis, School of other laboratory parameters, including levels of urea, creatinine, glucose, and lipids, and blood Pharmaceutical Sciences, University of Sao Paulo, 2Division of Nephrology, counts. This variant also did not account for the cumulative incidence of biopsy-confirmed Hospital do Rim, Federal University acute rejection or delayed graft function.
[Show full text]
Gene Expression in the Brain of a Migratory Songbird During Breeding and Migration
Boss et al. Movement Ecology (2016) 4:4 DOI 10.1186/s40462-016-0069-6 RESEARCH Open Access Gene expression in the brain of a migratory songbird during breeding and migration John Boss1,2, Miriam Liedvogel3,6, Max Lundberg3, Peter Olsson4, Nils Reischke3, Sara Naurin3, Susanne Åkesson5, Dennis Hasselquist3, Anthony Wright1, Mats Grahn1 and Staffan Bensch3* Abstract Background: We still have limited knowledge about the underlying genetic mechanisms that enable migrating species of birds to navigate the globe. Here we make an attempt to get insight into the genetic architecture controlling this complex innate behaviour. We contrast the gene expression profiles of two closely related songbird subspecies with divergent migratory phenotypes. In addition to comparing differences in migratory strategy we include a temporal component and contrast patterns between breeding adults and autumn migrating juvenile birds of both subspecies. The two willow warbler subspecies, Phylloscopus trochilus trochilus and P. t. acredula, are remarkably similar both in phenotype and genotype and have a narrow contact zone in central Scandinavia. Here we used a microarray gene chip representing 23,136 expressed sequence tags (ESTs) from the zebra finch Taeniopygia guttata to identify mRNA level differences in willow warbler brain tissue in relation to subspecies and season. Results: Out of the 22,109 EST probe sets that remained after filtering poorly binding probes, we found 11,898 (51.8 %) probe sets that could be reliably and uniquely matched to a total of 6,758 orthologous zebra finch genes. The two subspecies showed very similar levels of gene expression with less than 0.1 % of the probe sets being significantly differentially expressed.
[Show full text]
(Q36.1;Q24) with a Concurrent Submicroscopic Del(4)(Q23q24) in an Adult with Polycythemia Vera
cancers Case Report A Novel Acquired t(2;4)(q36.1;q24) with a Concurrent Submicroscopic del(4)(q23q24) in An Adult with Polycythemia Vera Eigil Kjeldsen Cancer Cytogenetic Section, HemoDiagnostic Laboratory, Department of Hematology, Aarhus University Hospital, Tage-Hansens Gade 2, DK-8000 Aarhus C, Denmark; [email protected]; Tel.: +45-7846-7398; Fax: +45-7846-7399 Received: 6 June 2018; Accepted: 21 June 2018; Published: 25 June 2018 Abstract: Background: Polycythemia vera (PV) is a clonal myeloid stem cell disease characterized by a growth-factor independent erythroid proliferation with an inherent tendency to transform into overt acute myeloid malignancy. Approximately 95% of the PV patients harbor the JAK2V617F mutation while less than 35% of the patients harbor cytogenetic abnormalities at the time of diagnosis. Methods and Results: Here we present a JAK2V617F positive PV patient where G-banding revealed an apparently balanced t(2;4)(q35;q21), which was confirmed by 24-color karyotyping. Oligonucleotide array-based Comparative Genomic Hybridization (aCGH) analysis revealed an interstitial 5.4 Mb large deletion at 4q23q24. Locus-specific fluorescent in situ hybridization (FISH) analyses confirmed the mono-allelic 4q deletion and that it was located on der(4)t(2;4). Additional locus-specific bacterial artificial chromosome (BAC) probes and mBanding refined the breakpoint on chromosome 2. With these methods the karyotype was revised to 46,XX,t(2;4)(q36.1;q24)[18]/46,XX[7]. Conclusions: This is the first report on a PV patient associated with an acquired novel t(2;4)(q36.1;q24) and a concurrent submicroscopic deletion del(4)(q23q24).
[Show full text]
For Poststroke Depression Based on Network Pharmacology and Molecular Docking
Hindawi Evidence-Based Complementary and Alternative Medicine Volume 2021, Article ID 2126967, 14 pages https://doi.org/10.1155/2021/2126967 Research Article Exploring the Mechanism of Action of Herbal Medicine (Gan-Mai-Da-Zao Decoction) for Poststroke Depression Based on Network Pharmacology and Molecular Docking Zhicong Ding ,1 Fangfang Xu,1 Qidi Sun,2 Bin Li,1 Nengxing Liang,1 Junwei Chen,1 and Shangzhen Yu 1,3 1Jinan University, Guangzhou 510632, China 2Yangzhou University, Yangzhou 225009, China 3Wuyi Hospital of Traditional Chinese Medicine, Jiangmen 529000, China Correspondence should be addressed to Shangzhen Yu; [email protected] Received 19 May 2021; Accepted 14 August 2021; Published 23 August 2021 Academic Editor: Ghulam Ashraf Copyright © 2021 Zhicong Ding et al. -is is an open access article distributed under the Creative Commons Attribution License, which permits unrestricted use, distribution, and reproduction in any medium, provided the original work is properly cited. Background. Poststroke depression (PSD) is the most common and serious neuropsychiatric complication occurring after ce- rebrovascular accidents, seriously endangering human health while also imposing a heavy burden on society. Nevertheless, it is diﬃcult to control disease progression. Gan-Mai-Da-Zao Decoction (GMDZD) is eﬀective for PSD, but its mechanism of action in PSD is unknown. In this study, we explored the mechanism of action of GMDZD in PSD treatment using network pharmacology and molecular docking. Material and methods. We obtained the active components of all drugs and their targets from the public database TCMSP and published articles. -en, we collected PSD-related targets from the GeneCards and OMIM databases.
[Show full text]
The Human Gene Connectome As a Map of Short Cuts for Morbid Allele Discovery
The human gene connectome as a map of short cuts for morbid allele discovery Yuval Itana,1, Shen-Ying Zhanga,b, Guillaume Vogta,b, Avinash Abhyankara, Melina Hermana, Patrick Nitschkec, Dror Friedd, Lluis Quintana-Murcie, Laurent Abela,b, and Jean-Laurent Casanovaa,b,f aSt. Giles Laboratory of Human Genetics of Infectious Diseases, Rockefeller Branch, The Rockefeller University, New York, NY 10065; bLaboratory of Human Genetics of Infectious Diseases, Necker Branch, Paris Descartes University, Institut National de la Santé et de la Recherche Médicale U980, Necker Medical School, 75015 Paris, France; cPlateforme Bioinformatique, Université Paris Descartes, 75116 Paris, France; dDepartment of Computer Science, Ben-Gurion University of the Negev, Beer-Sheva 84105, Israel; eUnit of Human Evolutionary Genetics, Centre National de la Recherche Scientifique, Unité de Recherche Associée 3012, Institut Pasteur, F-75015 Paris, France; and fPediatric Immunology-Hematology Unit, Necker Hospital for Sick Children, 75015 Paris, France Edited* by Bruce Beutler, University of Texas Southwestern Medical Center, Dallas, TX, and approved February 15, 2013 (received for review October 19, 2012) High-throughput genomic data reveal thousands of gene variants to detect a single mutated gene, with the other polymorphic genes per patient, and it is often difficult to determine which of these being of less interest. This goes some way to explaining why, variants underlies disease in a given individual. However, at the despite the abundance of NGS data, the discovery of disease- population level, there may be some degree of phenotypic homo- causing alleles from such data remains somewhat limited. geneity, with alterations of specific physiological pathways under- We developed the human gene connectome (HGC) to over- come this problem.
[Show full text]
Cardiomyocyte-Specific Deletion of Orai1 Reveals Its Protective Role in Angiotensin-II-Induced Pathological Cardiac Remodeling
cells Article Cardiomyocyte-Speciﬁc Deletion of Orai1 Reveals Its Protective Role in Angiotensin-II-Induced Pathological Cardiac Remodeling Sebastian Segin 1,2, Michael Berlin 1,2, Christin Richter 1, Rebekka Medert 1,2, Veit Flockerzi 3, Paul Worley 4, Marc Freichel 1,2 and Juan E. Camacho Londoño 1,2,* 1 Pharmakologisches Institut, Ruprecht-Karls-Universität Heidelberg, INF 366, 69120 Heidelberg, Germany; [email protected] (S.S.); [email protected] (M.B.); [email protected] (C.R.); [email protected] (R.M.); [email protected] (M.F.) 2 DZHK (German Centre for Cardiovascular Research), Partner Site Heidelberg/Mannheim, 69120 Heidelberg, Germany 3 Experimentelle und Klinische Pharmakologie und Toxikologie, Universität des Saarlandes, 66421 Homburg, Germany; [email protected] 4 The Solomon H. Snyder Department of Neuroscience, Johns Hopkins University, School of Medicine, Baltimore, MD 21205, USA; [email protected] * Correspondence: [email protected]; Tel.: +49-6221-54-86863; Fax: +49-6221-54-8644 Received: 26 March 2020; Accepted: 24 April 2020; Published: 28 April 2020 Abstract: Pathological cardiac remodeling correlates with chronic neurohumoral stimulation and abnormal Ca2+ signaling in cardiomyocytes. Store-operated calcium entry (SOCE) has been described in adult and neonatal murine cardiomyocytes, and Orai1 proteins act as crucial ion-conducting constituents of this calcium entry pathway that can be engaged not only by passive Ca2+ store depletion but also by neurohumoral stimuli such as angiotensin-II. In this study, we, therefore, analyzed the consequences of Orai1 deletion for cardiomyocyte hypertrophy in neonatal and adult cardiomyocytes as well as for other features of pathological cardiac remodeling including cardiac contractile function in vivo.
[Show full text]
Datasheet: VPA00329KT Product Details
Datasheet: VPA00329KT Description: CALCINEURIN A ANTIBODY WITH CONTROL LYSATE Specificity: CALCINEURIN A Format: Purified Product Type: PrecisionAb™ Polyclonal Isotype: Polyclonal IgG Quantity: 2 Westerns Product Details Applications This product has been reported to work in the following applications. This information is derived from testing within our laboratories, peer-reviewed publications or personal communications from the originators. Please refer to references indicated for further information. For general protocol recommendations, please visit www.bio-rad-antibodies.com/protocols. Yes No Not Determined Suggested Dilution Western Blotting 1/1000 PrecisionAb antibodies have been extensively validated for the western blot application. The antibody has been validated at the suggested dilution. Where this product has not been tested for use in a particular technique this does not necessarily exclude its use in such procedures. Further optimization may be required dependant on sample type. Target Species Human Species Cross Reacts with: Mouse Reactivity N.B. Antibody reactivity and working conditions may vary between species. Product Form Purified IgG - liquid Preparation 20μl Rabbit polyclonal antibody purified by affinity chromatography Buffer Solution Phosphate buffered saline Preservative 0.09% Sodium Azide (NaN3) Stabilisers 1% Bovine Serum Albumin Immunogen KLH-conjugated synthetic peptide corresponding to aa 438-466 of human calcineurin A External Database Links UniProt: Q08209 Related reagents Entrez Gene: 5530 PPP3CA Related reagents Synonyms CALNA, CNA Page 1 of 2 Specificity Rabbit anti Human calcineurin A antibody recognizes calcineurin A, also known as PPP3CA, CAM-PRP catalytic subunit, calcineurin A alpha, calmodulin-dependent calcineurin A subunit alpha isoform and protein phosphatase 2B, catalytic subunit, alpha isoform. Rabbit anti Human calcineurin A antibody detects a band of 59 kDa.
[Show full text]
(Gan-Mai-Da-Zao Decoction) for Post- Stroke Depression Based on Network Pharmacology and Molecular Docking
Exploring The Mechanism of Action of Herbal Medicine (Gan-Mai-Da-Zao Decoction) For Post- Stroke Depression Based On Network Pharmacology And Molecular Docking Zhi-Cong Ding Jinan University Fang-Fang Xu Jinan University Qi-Di Sun Yangzhou University Bin Li Jinan University Neng-Xing Liang Jinan University Jun-Wei Chen Jinan University Shang-Zhen Yu ( [email protected] ) Jinan University https://orcid.org/0000-0003-0930-6092 Research Keywords: post-stroke depression, Gan-Mai-Da-Zao decoction, network pharmacology, GO and KEGG pathway enrichment, molecular docking Posted Date: May 17th, 2021 DOI: https://doi.org/10.21203/rs.3.rs-508953/v1 License: This work is licensed under a Creative Commons Attribution 4.0 International License. Read Full License Page 1/24 Abstract Backgrounds: Post-stroke depression is the most common and serious neuropsychiatric complication occurring after cerebrovascular accidents, seriously endangering human health while also imposing a heavy burden on society. Even so, it is dicult to have drugs to contain the progression of the disease. It’s reported that Gan-Mai-Da-Zao decoction was effective to PSD, but it is unknown on its mechanism of action for PSD. In this study, we aimed to explore the possible mechanisms of action of Gan-Mai-Da-Zao decoction in the treatment of PSD using network pharmacology and molecular docking. Material and methods: We obtained the active components and their targets of all drugs from the public database TCMSP and published articles. Then, we collected the PSD-related targets from GeneCards and OMIM databases. Cytoscape 3.8.2 was applied to construct PPI and composite target disease networks.
[Show full text]
An Expanded Proteome of Cardiac T-Tubules☆
Cardiovascular Pathology 42 (2019) 15–20 Contents lists available at ScienceDirect Cardiovascular Pathology Original Article An expanded proteome of cardiac t-tubules☆ Jenice X. Cheah, Tim O. Nieuwenhuis, Marc K. Halushka ⁎ Department of Pathology, Division of Cardiovascular Pathology, Johns Hopkins University SOM, Baltimore, MD, USA article info abstract Article history: Background: Transverse tubules (t-tubules) are important structural elements, derived from sarcolemma, found Received 27 February 2019 on all striated myocytes. These specialized organelles create a scaffold for many proteins crucial to the effective Received in revised form 29 April 2019 propagation of signal in cardiac excitation–contraction coupling. The full protein composition of this region is un- Accepted 17 May 2019 known. Methods: We characterized the t-tubule subproteome using 52,033 immunohistochemical images covering Keywords: 13,203 proteins from the Human Protein Atlas (HPA) cardiac tissue microarrays. We used HPASubC, a suite of Py- T-tubule fi Proteomics thon tools, to rapidly review and classify each image for a speci c t-tubule staining pattern. The tools Gene Cards, Caveolin String 11, and Gene Ontology Consortium as well as literature searches were used to understand pathways and relationships between the proteins. Results: There were 96 likely t-tubule proteins identified by HPASubC. Of these, 12 were matrisome proteins and 3 were mitochondrial proteins. A separate literature search identified 50 known t-tubule proteins. A comparison of the 2 lists revealed only 17 proteins in common, including 8 of the matrisome proteins. String11 revealed that 94 of 127 combined t-tubule proteins generated a single interconnected network. Conclusion: Using HPASubC and the HPA, we identified 78 novel, putative t-tubule proteins and validated 17 within the literature.
[Show full text]