Network-Based Identification of Genetic Factors in Ageing, Lifestyle
Total Page:16
File Type:pdf, Size:1020Kb

Load more
Recommended publications
-
Mouse Rtn1 Knockout Project (CRISPR/Cas9)
https://www.alphaknockout.com Mouse Rtn1 Knockout Project (CRISPR/Cas9) Objective: To create a Rtn1 knockout Mouse model (C57BL/6J) by CRISPR/Cas-mediated genome engineering. Strategy summary: The Rtn1 gene (NCBI Reference Sequence: NM_153457 ; Ensembl: ENSMUSG00000021087 ) is located on Mouse chromosome 12. 9 exons are identified, with the ATG start codon in exon 1 and the TAG stop codon in exon 9 (Transcript: ENSMUST00000078505). Exon 2 will be selected as target site. Cas9 and gRNA will be co-injected into fertilized eggs for KO Mouse production. The pups will be genotyped by PCR followed by sequencing analysis. Note: Mice homozygous for a null allele are viable with no gross abnormalities. Exon 2 starts from about 10.34% of the coding region. Exon 2 covers 33.08% of the coding region. The size of effective KO region: ~774 bp. The KO region does not have any other known gene. Page 1 of 8 https://www.alphaknockout.com Overview of the Targeting Strategy Wildtype allele 5' gRNA region gRNA region 3' 1 2 9 Legends Exon of mouse Rtn1 Knockout region Page 2 of 8 https://www.alphaknockout.com Overview of the Dot Plot (up) Window size: 15 bp Forward Reverse Complement Sequence 12 Note: The 774 bp section of Exon 2 is aligned with itself to determine if there are tandem repeats. No significant tandem repeat is found in the dot plot matrix. So this region is suitable for PCR screening or sequencing analysis. Overview of the Dot Plot (down) Window size: 15 bp Forward Reverse Complement Sequence 12 Note: The 774 bp section of Exon 2 is aligned with itself to determine if there are tandem repeats. -
Identification of the Binding Partners for Hspb2 and Cryab Reveals
Brigham Young University BYU ScholarsArchive Theses and Dissertations 2013-12-12 Identification of the Binding arP tners for HspB2 and CryAB Reveals Myofibril and Mitochondrial Protein Interactions and Non- Redundant Roles for Small Heat Shock Proteins Kelsey Murphey Langston Brigham Young University - Provo Follow this and additional works at: https://scholarsarchive.byu.edu/etd Part of the Microbiology Commons BYU ScholarsArchive Citation Langston, Kelsey Murphey, "Identification of the Binding Partners for HspB2 and CryAB Reveals Myofibril and Mitochondrial Protein Interactions and Non-Redundant Roles for Small Heat Shock Proteins" (2013). Theses and Dissertations. 3822. https://scholarsarchive.byu.edu/etd/3822 This Thesis is brought to you for free and open access by BYU ScholarsArchive. It has been accepted for inclusion in Theses and Dissertations by an authorized administrator of BYU ScholarsArchive. For more information, please contact [email protected], [email protected]. Identification of the Binding Partners for HspB2 and CryAB Reveals Myofibril and Mitochondrial Protein Interactions and Non-Redundant Roles for Small Heat Shock Proteins Kelsey Langston A thesis submitted to the faculty of Brigham Young University in partial fulfillment of the requirements for the degree of Master of Science Julianne H. Grose, Chair William R. McCleary Brian Poole Department of Microbiology and Molecular Biology Brigham Young University December 2013 Copyright © 2013 Kelsey Langston All Rights Reserved ABSTRACT Identification of the Binding Partners for HspB2 and CryAB Reveals Myofibril and Mitochondrial Protein Interactors and Non-Redundant Roles for Small Heat Shock Proteins Kelsey Langston Department of Microbiology and Molecular Biology, BYU Master of Science Small Heat Shock Proteins (sHSP) are molecular chaperones that play protective roles in cell survival and have been shown to possess chaperone activity. -
Single Nucleotide Polymorphisms Within Calcineurin-Encoding Genes
Annals of Applied Sport Science, vol. 4, no. 2, pp. 01-08, Summer 2016 DOI: 10.18869/acadpub.aassjournal.4.2.1 Original Article www.aassjournal.com www.AESAsport.com ISSN (Online): 2322 – 4479 Received: 06/03/2016 ISSN (Print): 2476–4981 Accepted: 26/06/2016 Single Nucleotide Polymorphisms within Calcineurin-Encoding Genes are Associated with Response to Aerobic Training in Han Chinese Males 1Rong-mei Xu, 2Tao Lu, 2Lingxian Yan, 1Qinghua Song* 1The Center of Physical Health, Henan Polytechnic University, Jiaozuo 454000, Henan Province, China. 2 The Lab of Human Body Science, Henan Polytechnic University, Jiaozuo 454000, Henan Province, China. ABSTRACT Calcineurin, which functions in calcium signaling, is expressed in skeletal and cardiac muscle and has been linked to sensitivity to muscle strength training. It is also proposed to contribute to individual aerobic endurance. To investigate the relationship between calcineurin-encoding genes and aerobic endurance traits, 126 young-adult Han Chinese males were enrolled in an aerobic exercise training study. Participants were genotyped for polymorphisms within the 5 genes (PPP3CA, PPP3CB, PPP3CC, PPP3R1 and PPP3R2) encoding calcineurin using restriction fragment length polymorphism polymerase chain reaction (PCR-RFLP) or matrix-assisted laser desorption ionization time-of-flight mass spectrometry (MALDI-TOF MS). Participants underwent 18 weeks of aerobic exercise training (running). Before and after the training period, maximal oxygen uptake (VO2max) and 12 km/h running economy were measured. Statistical analyses were performed using chi-square test and analysis of variance. The baseline value of VO2max was significantly associated with rs3804423 and rs2850965 loci in the PPP3CA gene (P<0.05). -
A Computational Approach for Defining a Signature of Β-Cell Golgi Stress in Diabetes Mellitus
Page 1 of 781 Diabetes A Computational Approach for Defining a Signature of β-Cell Golgi Stress in Diabetes Mellitus Robert N. Bone1,6,7, Olufunmilola Oyebamiji2, Sayali Talware2, Sharmila Selvaraj2, Preethi Krishnan3,6, Farooq Syed1,6,7, Huanmei Wu2, Carmella Evans-Molina 1,3,4,5,6,7,8* Departments of 1Pediatrics, 3Medicine, 4Anatomy, Cell Biology & Physiology, 5Biochemistry & Molecular Biology, the 6Center for Diabetes & Metabolic Diseases, and the 7Herman B. Wells Center for Pediatric Research, Indiana University School of Medicine, Indianapolis, IN 46202; 2Department of BioHealth Informatics, Indiana University-Purdue University Indianapolis, Indianapolis, IN, 46202; 8Roudebush VA Medical Center, Indianapolis, IN 46202. *Corresponding Author(s): Carmella Evans-Molina, MD, PhD ([email protected]) Indiana University School of Medicine, 635 Barnhill Drive, MS 2031A, Indianapolis, IN 46202, Telephone: (317) 274-4145, Fax (317) 274-4107 Running Title: Golgi Stress Response in Diabetes Word Count: 4358 Number of Figures: 6 Keywords: Golgi apparatus stress, Islets, β cell, Type 1 diabetes, Type 2 diabetes 1 Diabetes Publish Ahead of Print, published online August 20, 2020 Diabetes Page 2 of 781 ABSTRACT The Golgi apparatus (GA) is an important site of insulin processing and granule maturation, but whether GA organelle dysfunction and GA stress are present in the diabetic β-cell has not been tested. We utilized an informatics-based approach to develop a transcriptional signature of β-cell GA stress using existing RNA sequencing and microarray datasets generated using human islets from donors with diabetes and islets where type 1(T1D) and type 2 diabetes (T2D) had been modeled ex vivo. To narrow our results to GA-specific genes, we applied a filter set of 1,030 genes accepted as GA associated. -
Supplementary Table 1: Adhesion Genes Data Set
Supplementary Table 1: Adhesion genes data set PROBE Entrez Gene ID Celera Gene ID Gene_Symbol Gene_Name 160832 1 hCG201364.3 A1BG alpha-1-B glycoprotein 223658 1 hCG201364.3 A1BG alpha-1-B glycoprotein 212988 102 hCG40040.3 ADAM10 ADAM metallopeptidase domain 10 133411 4185 hCG28232.2 ADAM11 ADAM metallopeptidase domain 11 110695 8038 hCG40937.4 ADAM12 ADAM metallopeptidase domain 12 (meltrin alpha) 195222 8038 hCG40937.4 ADAM12 ADAM metallopeptidase domain 12 (meltrin alpha) 165344 8751 hCG20021.3 ADAM15 ADAM metallopeptidase domain 15 (metargidin) 189065 6868 null ADAM17 ADAM metallopeptidase domain 17 (tumor necrosis factor, alpha, converting enzyme) 108119 8728 hCG15398.4 ADAM19 ADAM metallopeptidase domain 19 (meltrin beta) 117763 8748 hCG20675.3 ADAM20 ADAM metallopeptidase domain 20 126448 8747 hCG1785634.2 ADAM21 ADAM metallopeptidase domain 21 208981 8747 hCG1785634.2|hCG2042897 ADAM21 ADAM metallopeptidase domain 21 180903 53616 hCG17212.4 ADAM22 ADAM metallopeptidase domain 22 177272 8745 hCG1811623.1 ADAM23 ADAM metallopeptidase domain 23 102384 10863 hCG1818505.1 ADAM28 ADAM metallopeptidase domain 28 119968 11086 hCG1786734.2 ADAM29 ADAM metallopeptidase domain 29 205542 11085 hCG1997196.1 ADAM30 ADAM metallopeptidase domain 30 148417 80332 hCG39255.4 ADAM33 ADAM metallopeptidase domain 33 140492 8756 hCG1789002.2 ADAM7 ADAM metallopeptidase domain 7 122603 101 hCG1816947.1 ADAM8 ADAM metallopeptidase domain 8 183965 8754 hCG1996391 ADAM9 ADAM metallopeptidase domain 9 (meltrin gamma) 129974 27299 hCG15447.3 ADAMDEC1 ADAM-like, -
Protein Interactions in the Cancer Proteome† Cite This: Mol
Molecular BioSystems View Article Online PAPER View Journal | View Issue Small-molecule binding sites to explore protein– protein interactions in the cancer proteome† Cite this: Mol. BioSyst., 2016, 12,3067 David Xu,ab Shadia I. Jalal,c George W. Sledge Jr.d and Samy O. Meroueh*aef The Cancer Genome Atlas (TCGA) offers an unprecedented opportunity to identify small-molecule binding sites on proteins with overexpressed mRNA levels that correlate with poor survival. Here, we analyze RNA-seq and clinical data for 10 tumor types to identify genes that are both overexpressed and correlate with patient survival. Protein products of these genes were scanned for binding sites that possess shape and physicochemical properties that can accommodate small-molecule probes or therapeutic agents (druggable). These binding sites were classified as enzyme active sites (ENZ), protein–protein interaction sites (PPI), or other sites whose function is unknown (OTH). Interestingly, the overwhelming majority of binding sites were classified as OTH. We find that ENZ, PPI, and OTH binding sites often occurred on the same structure suggesting that many of these OTH cavities can be used for allosteric modulation of Creative Commons Attribution 3.0 Unported Licence. enzyme activity or protein–protein interactions with small molecules. We discovered several ENZ (PYCR1, QPRT,andHSPA6)andPPI(CASC5, ZBTB32,andCSAD) binding sites on proteins that have been seldom explored in cancer. We also found proteins that have been extensively studied in cancer that have not been previously explored with small molecules that harbor ENZ (PKMYT1, STEAP3,andNNMT) and PPI (HNF4A, MEF2B,andCBX2) binding sites. All binding sites were classified by the signaling pathways to Received 29th March 2016, which the protein that harbors them belongs using KEGG. -
Genome Sequences of Tropheus Moorii and Petrochromis Trewavasae, Two Eco‑Morphologically Divergent Cichlid Fshes Endemic to Lake Tanganyika C
www.nature.com/scientificreports OPEN Genome sequences of Tropheus moorii and Petrochromis trewavasae, two eco‑morphologically divergent cichlid fshes endemic to Lake Tanganyika C. Fischer1,2, S. Koblmüller1, C. Börger1, G. Michelitsch3, S. Trajanoski3, C. Schlötterer4, C. Guelly3, G. G. Thallinger2,5* & C. Sturmbauer1,5* With more than 1000 species, East African cichlid fshes represent the fastest and most species‑rich vertebrate radiation known, providing an ideal model to tackle molecular mechanisms underlying recurrent adaptive diversifcation. We add high‑quality genome reconstructions for two phylogenetic key species of a lineage that diverged about ~ 3–9 million years ago (mya), representing the earliest split of the so‑called modern haplochromines that seeded additional radiations such as those in Lake Malawi and Victoria. Along with the annotated genomes we analysed discriminating genomic features of the study species, each representing an extreme trophic morphology, one being an algae browser and the other an algae grazer. The genomes of Tropheus moorii (TM) and Petrochromis trewavasae (PT) comprise 911 and 918 Mbp with 40,300 and 39,600 predicted genes, respectively. Our DNA sequence data are based on 5 and 6 individuals of TM and PT, and the transcriptomic sequences of one individual per species and sex, respectively. Concerning variation, on average we observed 1 variant per 220 bp (interspecifc), and 1 variant per 2540 bp (PT vs PT)/1561 bp (TM vs TM) (intraspecifc). GO enrichment analysis of gene regions afected by variants revealed several candidates which may infuence phenotype modifcations related to facial and jaw morphology, such as genes belonging to the Hedgehog pathway (SHH, SMO, WNT9A) and the BMP and GLI families. -
Functions of Nogo Proteins and Their Receptors in the Nervous System
REVIEWS Functions of Nogo proteins and their receptors in the nervous system Martin E. Schwab Abstract | The membrane protein Nogo-A was initially characterized as a CNS-specific inhibitor of axonal regeneration. Recent studies have uncovered regulatory roles of Nogo proteins and their receptors — in precursor migration, neurite growth and branching in the developing nervous system — as well as a growth-restricting function during CNS maturation. The function of Nogo in the adult CNS is now understood to be that of a negative regulator of neuronal growth, leading to stabilization of the CNS wiring at the expense of extensive plastic rearrangements and regeneration after injury. In addition, Nogo proteins interact with various intracellular components and may have roles in the regulation of endoplasmic reticulum (ER) structure, processing of amyloid precursor protein and cell survival. Nogo proteins were discovered, and have been exten- The amino-terminal segments of the proteins sively studied, in the context of injury and repair of fibre encoded by the different RTN genes have differing tracts in the CNS1 — a topic of great research interest lengths and there is no homology between them3,5. The and clinical relevance. However, much less in known N termini of the RTN4 products Nogo-A and Nogo-B are about the physiological functions of Nogo proteins in identical, consisting of a 172-amino acid sequence that development and in the intact adult organism, including is encoded by a single exon (exon 1) that is followed by in the brain. Through a number of recent publications, a short exon 2 and, in Nogo-A, by the very long exon Nogo proteins have emerged as important regulators of 3 encoding 800 amino acids2,6 (FIG. -
Biallelic Alteration and Dysregulation of the Hippo Pathway in Mucinous Tubular and Spindle Cell Carcinoma of the Kidney
Published OnlineFirst September 7, 2016; DOI: 10.1158/2159-8290.CD-16-0267 RESEARCH BRIEF Biallelic Alteration and Dysregulation of the Hippo Pathway in Mucinous Tubular and Spindle Cell Carcinoma of the Kidney Rohit Mehra 1 , 2 , 3 , Pankaj Vats 1 , 3 , 4 , Marcin Cieslik 3 , Xuhong Cao 3 , 5 , Fengyun Su 3 , Sudhanshu Shukla 3 , Aaron M. Udager 1 , Rui Wang 3 , Jincheng Pan 6 , Katayoon Kasaian 3 , Robert Lonigro 3 , Javed Siddiqui 3 , Kumpati Premkumar 4 , Ganesh Palapattu 7 , Alon Weizer 2 , 7 , Khaled S. Hafez 7 , J. Stuart Wolf Jr 7 , Ankur R. Sangoi 8 , Kiril Trpkov 9 , Adeboye O. Osunkoya 10 , Ming Zhou 11 , Giovanna A. Giannico 12 , Jesse K. McKenney 13 , Saravana M. Dhanasekaran 1 , 3 , and Arul M. Chinnaiyan 1 , 2 , 3 , 5 , 7 ABSTRACT Mucinous tubular and spindle cell carcinoma (MTSCC) is a relatively rare subtype of renal cell carcinoma (RCC) with distinctive morphologic and cytogenetic fea- tures. Here, we carry out whole-exome and transcriptome sequencing of a multi-institutional cohort of MTSCC (n = 22). We demonstrate the presence of either biallelic loss of Hippo pathway tumor sup- pressor genes (TSG) and/or evidence of alteration of Hippo pathway genes in 85% of samples. PTPN14 (31%) and NF2 (22%) were the most commonly implicated Hippo pathway genes, whereas other genes such as SAV1 and HIPK2 were also involved in a mutually exclusive fashion. Mutations in the context of recurrent chromosomal losses amounted to biallelic alterations in these TSGs. As a readout of Hippo pathway inactivation, a majority of cases (90%) exhibited increased nuclear YAP1 protein expression. -
Calcineurin a (PPP3CA) (NM 000944) Human Tagged ORF Clone Product Data
OriGene Technologies, Inc. 9620 Medical Center Drive, Ste 200 Rockville, MD 20850, US Phone: +1-888-267-4436 [email protected] EU: [email protected] CN: [email protected] Product datasheet for RC219136 Calcineurin A (PPP3CA) (NM_000944) Human Tagged ORF Clone Product data: Product Type: Expression Plasmids Product Name: Calcineurin A (PPP3CA) (NM_000944) Human Tagged ORF Clone Tag: Myc-DDK Symbol: PPP3CA Synonyms: ACCIID; CALN; CALNA; CALNA1; CCN1; CNA1; IECEE; IECEE1; PPP2B Vector: pCMV6-Entry (PS100001) E. coli Selection: Kanamycin (25 ug/mL) Cell Selection: Neomycin This product is to be used for laboratory only. Not for diagnostic or therapeutic use. View online » ©2021 OriGene Technologies, Inc., 9620 Medical Center Drive, Ste 200, Rockville, MD 20850, US 1 / 5 Calcineurin A (PPP3CA) (NM_000944) Human Tagged ORF Clone – RC219136 ORF Nucleotide >RC219136 representing NM_000944 Sequence: Red=Cloning site Blue=ORF Green=Tags(s) TTTTGTAATACGACTCACTATAGGGCGGCCGGGAATTCGTCGACTGGATCCGGTACCGAGGAGATCTGCC GCCGCGATCGCC ATGTCCGAGCCCAAGGCAATTGATCCCAAGTTGTCGACGACCGACAGGGTGGTGAAAGCTGTTCCATTTC CTCCAAGTCACCGGCTTACAGCAAAAGAAGTGTTTGATAATGATGGAAAACCTCGTGTGGATATCTTAAA GGCGCATCTTATGAAGGAGGGAAGGCTGGAAGAGAGTGTTGCATTGAGAATAATAACAGAGGGTGCATCA ATTCTTCGACAGGAAAAAAATTTGCTGGATATTGATGCGCCAGTCACTGTTTGTGGGGACATTCATGGAC AATTCTTTGATTTGATGAAGCTCTTTGAAGTCGGGGGATCTCCTGCCAACACTCGCTACCTCTTCTTAGG GGACTATGTTGACAGAGGGTACTTCAGTATTGAATGTGTGCTGTATTTGTGGGCCTTGAAAATTCTCTAC CCCAAAACACTGTTTTTACTTCGTGGAAATCATGAATGTAGACATCTAACAGAGTATTTCACATTTAAAC AAGAATGTAAAATAAAGTATTCAGAACGCGTATATGATGCCTGTATGGATGCCTTTGACTGCCTTCCCCT -
Anti-PPP3CA (Aa 1-84) Polyclonal Antibody (DPAB- DC2401) This Product Is for Research Use Only and Is Not Intended for Diagnostic Use
Anti-PPP3CA (aa 1-84) polyclonal antibody (DPAB- DC2401) This product is for research use only and is not intended for diagnostic use. PRODUCT INFORMATION Antigen Description PPP3CA (protein phosphatase 3, catalytic subunit, alpha isozyme) is a protein-coding gene. Diseases associated with PPP3CA include osteomyelitis, and down syndrome critical region, and among its related super-pathways are Fc epsilon RI signaling pathway and BCR signaling pathway. GO annotations related to this gene include enzyme binding and calcium ion binding. An important paralog of this gene is PPP3CC. Immunogen PPP3CA (NP_000935, 1 a.a. ~ 84 a.a) partial recombinant protein with GST tag. The sequence is MSEPKAIDPKLSTTDRVVKAVPFPPSHRLTAKEVFDNDGKPRVDILKAHLMKEGRLEESVALRIIT EGASILRQEKNLLDIDAP Source/Host Mouse Species Reactivity Human Conjugate Unconjugated Applications WB (Cell lysate), WB (Recombinant protein), ELISA, Size 50 μl Buffer 50 % glycerol Preservative None Storage Store at -20°C or lower. Aliquot to avoid repeated freezing and thawing. GENE INFORMATION Gene Name PPP3CA protein phosphatase 3, catalytic subunit, alpha isozyme [ Homo sapiens (human) ] Official Symbol PPP3CA Synonyms PPP3CA; protein phosphatase 3, catalytic subunit, alpha isozyme; CALN; CCN1; CNA1; CALNA; PPP2B; CALNA1; serine/threonine-protein phosphatase 2B catalytic subunit alpha isoform; 45-1 Ramsey Road, Shirley, NY 11967, USA Email: [email protected] Tel: 1-631-624-4882 Fax: 1-631-938-8221 1 © Creative Diagnostics All Rights Reserved calcineurin A alpha; CAM-PRP catalytic -
Insights Into the Genetic Architecture of the Human Face
bioRxiv preprint doi: https://doi.org/10.1101/2020.05.12.090555; this version posted May 14, 2020. The copyright holder for this preprint (which was not certified by peer review) is the author/funder, who has granted bioRxiv a license to display the preprint in perpetuity. It is made available under aCC-BY-NC-ND 4.0 International license. Insights into the genetic architecture of the human face Julie D. White1†*, Karlijne Indencleef2,3,4†*, Sahin Naqvi5,6, Ryan J. Eller7, Jasmien Roosenboom8, Myoung Keun Lee8, Jiarui Li2,3, Jaaved Mohammed5,9, Stephen Richmond10, Ellen E. Quillen11,12, Heather L. Norton13, Eleanor Feingold14, Tomek Swigut5,9, Mary L. Marazita8,14, Hilde Peeters15, Greet Hens4, John R. Shaffer8,14, Joanna Wysocka5,9, Susan Walsh7, Seth M. Weinberg8,14,16, Mark D. Shriver1, Peter Claes2,3,15,17,18* Affiliations: 1Department of Anthropology, Pennsylvania State University, State College, PA, 16802, USA 2Department of Electrical Engineering, ESAT/PSI, KU Leuven, Leuven, 3000, Belgium 3Medical Imaging Research Center, UZ Leuven, Leuven, 3000, Belgium 4Department of Otorhinolaryngology, KU Leuven, Leuven, 3000, Belgium 5Department of Chemical and Systems Biology, Stanford University School of Medicine, Stanford, CA, 94305, USA 6Department of Genetics, Stanford University School of Medicine, Stanford, CA, 94305, USA 7Department of Biology, Indiana University Purdue University Indianapolis, Indianapolis, IN, 46202, USA 8Department of Oral Biology, Center for Craniofacial and Dental Genetics, University of Pittsburgh, Pittsburgh,