(Gan-Mai-Da-Zao Decoction) for Post- Stroke Depression Based on Network Pharmacology and Molecular Docking
Total Page:16
File Type:pdf, Size:1020Kb
Load more
Recommended publications
-
Analysis of Gene Expression Data for Gene Ontology
ANALYSIS OF GENE EXPRESSION DATA FOR GENE ONTOLOGY BASED PROTEIN FUNCTION PREDICTION A Thesis Presented to The Graduate Faculty of The University of Akron In Partial Fulfillment of the Requirements for the Degree Master of Science Robert Daniel Macholan May 2011 ANALYSIS OF GENE EXPRESSION DATA FOR GENE ONTOLOGY BASED PROTEIN FUNCTION PREDICTION Robert Daniel Macholan Thesis Approved: Accepted: _______________________________ _______________________________ Advisor Department Chair Dr. Zhong-Hui Duan Dr. Chien-Chung Chan _______________________________ _______________________________ Committee Member Dean of the College Dr. Chien-Chung Chan Dr. Chand K. Midha _______________________________ _______________________________ Committee Member Dean of the Graduate School Dr. Yingcai Xiao Dr. George R. Newkome _______________________________ Date ii ABSTRACT A tremendous increase in genomic data has encouraged biologists to turn to bioinformatics in order to assist in its interpretation and processing. One of the present challenges that need to be overcome in order to understand this data more completely is the development of a reliable method to accurately predict the function of a protein from its genomic information. This study focuses on developing an effective algorithm for protein function prediction. The algorithm is based on proteins that have similar expression patterns. The similarity of the expression data is determined using a novel measure, the slope matrix. The slope matrix introduces a normalized method for the comparison of expression levels throughout a proteome. The algorithm is tested using real microarray gene expression data. Their functions are characterized using gene ontology annotations. The results of the case study indicate the protein function prediction algorithm developed is comparable to the prediction algorithms that are based on the annotations of homologous proteins. -
Single Nucleotide Polymorphisms Within Calcineurin-Encoding Genes
Annals of Applied Sport Science, vol. 4, no. 2, pp. 01-08, Summer 2016 DOI: 10.18869/acadpub.aassjournal.4.2.1 Original Article www.aassjournal.com www.AESAsport.com ISSN (Online): 2322 – 4479 Received: 06/03/2016 ISSN (Print): 2476–4981 Accepted: 26/06/2016 Single Nucleotide Polymorphisms within Calcineurin-Encoding Genes are Associated with Response to Aerobic Training in Han Chinese Males 1Rong-mei Xu, 2Tao Lu, 2Lingxian Yan, 1Qinghua Song* 1The Center of Physical Health, Henan Polytechnic University, Jiaozuo 454000, Henan Province, China. 2 The Lab of Human Body Science, Henan Polytechnic University, Jiaozuo 454000, Henan Province, China. ABSTRACT Calcineurin, which functions in calcium signaling, is expressed in skeletal and cardiac muscle and has been linked to sensitivity to muscle strength training. It is also proposed to contribute to individual aerobic endurance. To investigate the relationship between calcineurin-encoding genes and aerobic endurance traits, 126 young-adult Han Chinese males were enrolled in an aerobic exercise training study. Participants were genotyped for polymorphisms within the 5 genes (PPP3CA, PPP3CB, PPP3CC, PPP3R1 and PPP3R2) encoding calcineurin using restriction fragment length polymorphism polymerase chain reaction (PCR-RFLP) or matrix-assisted laser desorption ionization time-of-flight mass spectrometry (MALDI-TOF MS). Participants underwent 18 weeks of aerobic exercise training (running). Before and after the training period, maximal oxygen uptake (VO2max) and 12 km/h running economy were measured. Statistical analyses were performed using chi-square test and analysis of variance. The baseline value of VO2max was significantly associated with rs3804423 and rs2850965 loci in the PPP3CA gene (P<0.05). -
Location Analysis of Estrogen Receptor Target Promoters Reveals That
Location analysis of estrogen receptor ␣ target promoters reveals that FOXA1 defines a domain of the estrogen response Jose´ e Laganie` re*†, Genevie` ve Deblois*, Ce´ line Lefebvre*, Alain R. Bataille‡, Franc¸ois Robert‡, and Vincent Gigue` re*†§ *Molecular Oncology Group, Departments of Medicine and Oncology, McGill University Health Centre, Montreal, QC, Canada H3A 1A1; †Department of Biochemistry, McGill University, Montreal, QC, Canada H3G 1Y6; and ‡Laboratory of Chromatin and Genomic Expression, Institut de Recherches Cliniques de Montre´al, Montreal, QC, Canada H2W 1R7 Communicated by Ronald M. Evans, The Salk Institute for Biological Studies, La Jolla, CA, July 1, 2005 (received for review June 3, 2005) Nuclear receptors can activate diverse biological pathways within general absence of large scale functional data linking these putative a target cell in response to their cognate ligands, but how this binding sites with gene expression in specific cell types. compartmentalization is achieved at the level of gene regulation is Recently, chromatin immunoprecipitation (ChIP) has been used poorly understood. We used a genome-wide analysis of promoter in combination with promoter or genomic DNA microarrays to occupancy by the estrogen receptor ␣ (ER␣) in MCF-7 cells to identify loci recognized by transcription factors in a genome-wide investigate the molecular mechanisms underlying the action of manner in mammalian cells (20–24). This technology, termed 17-estradiol (E2) in controlling the growth of breast cancer cells. ChIP-on-chip or location analysis, can therefore be used to deter- We identified 153 promoters bound by ER␣ in the presence of E2. mine the global gene expression program that characterize the Motif-finding algorithms demonstrated that the estrogen re- action of a nuclear receptor in response to its natural ligand. -
Gene Expression Is Related to Parental Origin and Regional Coordinate Control
Journal of Human Genetics (2009) 54, 193–198 & 2009 The Japan Society of Human Genetics All rights reserved 1434-5161/09 $32.00 www.nature.com/jhg ORIGINAL ARTICLE William’s syndrome: gene expression is related to parental origin and regional coordinate control Jeremy C Collette1, Xiao-Ning Chen1, Debra L Mills2, Albert M Galaburda3, Allan L Reiss4, Ursula Bellugi5 and Julie R Korenberg1,6 William’s syndrome (WS) features a spectrum of neurocognitive and behavioral abnormalities due to a rare 1.5 MB deletion that includes about 24–28 genes on chromosome band 7q11.23. Study of the expression of these genes from the single normal copy provides an opportunity to elucidate the genetic and epigenetic controls on these genes as well as their roles in both WS and normal brain development and function. We used quantitative RT-PCR to determine the transcriptional level of 14 WS gene markers in a cohort of 77 persons with WS and 48 normal controls. Results reported here: (1) show that the expression of the genes deleted in WS is decreased in some but not all cases, (2) demonstrate that the parental origin of the deletion contributes to the level of expression of GTF2I independently of age and gender and (3) indicate that the correlation of expression between GTF2I and some other genes in the WS region differs in WS subjects and normal controls, which in turn points toward a regulatory role for this gene. Interspecies comparisons suggest GTF2I may play a key role in normal brain development. Journal of Human Genetics (2009) 54, 193–198; doi:10.1038/jhg.2009.5; published online 13 March 2009 Keywords: William’s syndrome; gene expression; RT-PCR; parental origin; GTF2I INTRODUCTION As an approach toward understanding the role of the deleted genes William’s syndrome (WS) is a neurogenetic disorder affecting human in WS, we have characterized WS subjects according to genetic, social/ development and adult cognition. -
1 Supporting Information for a Microrna Network Regulates
Supporting Information for A microRNA Network Regulates Expression and Biosynthesis of CFTR and CFTR-ΔF508 Shyam Ramachandrana,b, Philip H. Karpc, Peng Jiangc, Lynda S. Ostedgaardc, Amy E. Walza, John T. Fishere, Shaf Keshavjeeh, Kim A. Lennoxi, Ashley M. Jacobii, Scott D. Rosei, Mark A. Behlkei, Michael J. Welshb,c,d,g, Yi Xingb,c,f, Paul B. McCray Jr.a,b,c Author Affiliations: Department of Pediatricsa, Interdisciplinary Program in Geneticsb, Departments of Internal Medicinec, Molecular Physiology and Biophysicsd, Anatomy and Cell Biologye, Biomedical Engineeringf, Howard Hughes Medical Instituteg, Carver College of Medicine, University of Iowa, Iowa City, IA-52242 Division of Thoracic Surgeryh, Toronto General Hospital, University Health Network, University of Toronto, Toronto, Canada-M5G 2C4 Integrated DNA Technologiesi, Coralville, IA-52241 To whom correspondence should be addressed: Email: [email protected] (M.J.W.); yi- [email protected] (Y.X.); Email: [email protected] (P.B.M.) This PDF file includes: Materials and Methods References Fig. S1. miR-138 regulates SIN3A in a dose-dependent and site-specific manner. Fig. S2. miR-138 regulates endogenous SIN3A protein expression. Fig. S3. miR-138 regulates endogenous CFTR protein expression in Calu-3 cells. Fig. S4. miR-138 regulates endogenous CFTR protein expression in primary human airway epithelia. Fig. S5. miR-138 regulates CFTR expression in HeLa cells. Fig. S6. miR-138 regulates CFTR expression in HEK293T cells. Fig. S7. HeLa cells exhibit CFTR channel activity. Fig. S8. miR-138 improves CFTR processing. Fig. S9. miR-138 improves CFTR-ΔF508 processing. Fig. S10. SIN3A inhibition yields partial rescue of Cl- transport in CF epithelia. -
Protein Interactions in the Cancer Proteome† Cite This: Mol
Molecular BioSystems View Article Online PAPER View Journal | View Issue Small-molecule binding sites to explore protein– protein interactions in the cancer proteome† Cite this: Mol. BioSyst., 2016, 12,3067 David Xu,ab Shadia I. Jalal,c George W. Sledge Jr.d and Samy O. Meroueh*aef The Cancer Genome Atlas (TCGA) offers an unprecedented opportunity to identify small-molecule binding sites on proteins with overexpressed mRNA levels that correlate with poor survival. Here, we analyze RNA-seq and clinical data for 10 tumor types to identify genes that are both overexpressed and correlate with patient survival. Protein products of these genes were scanned for binding sites that possess shape and physicochemical properties that can accommodate small-molecule probes or therapeutic agents (druggable). These binding sites were classified as enzyme active sites (ENZ), protein–protein interaction sites (PPI), or other sites whose function is unknown (OTH). Interestingly, the overwhelming majority of binding sites were classified as OTH. We find that ENZ, PPI, and OTH binding sites often occurred on the same structure suggesting that many of these OTH cavities can be used for allosteric modulation of Creative Commons Attribution 3.0 Unported Licence. enzyme activity or protein–protein interactions with small molecules. We discovered several ENZ (PYCR1, QPRT,andHSPA6)andPPI(CASC5, ZBTB32,andCSAD) binding sites on proteins that have been seldom explored in cancer. We also found proteins that have been extensively studied in cancer that have not been previously explored with small molecules that harbor ENZ (PKMYT1, STEAP3,andNNMT) and PPI (HNF4A, MEF2B,andCBX2) binding sites. All binding sites were classified by the signaling pathways to Received 29th March 2016, which the protein that harbors them belongs using KEGG. -
Calcineurin a (PPP3CA) (NM 000944) Human Tagged ORF Clone Product Data
OriGene Technologies, Inc. 9620 Medical Center Drive, Ste 200 Rockville, MD 20850, US Phone: +1-888-267-4436 [email protected] EU: [email protected] CN: [email protected] Product datasheet for RC219136 Calcineurin A (PPP3CA) (NM_000944) Human Tagged ORF Clone Product data: Product Type: Expression Plasmids Product Name: Calcineurin A (PPP3CA) (NM_000944) Human Tagged ORF Clone Tag: Myc-DDK Symbol: PPP3CA Synonyms: ACCIID; CALN; CALNA; CALNA1; CCN1; CNA1; IECEE; IECEE1; PPP2B Vector: pCMV6-Entry (PS100001) E. coli Selection: Kanamycin (25 ug/mL) Cell Selection: Neomycin This product is to be used for laboratory only. Not for diagnostic or therapeutic use. View online » ©2021 OriGene Technologies, Inc., 9620 Medical Center Drive, Ste 200, Rockville, MD 20850, US 1 / 5 Calcineurin A (PPP3CA) (NM_000944) Human Tagged ORF Clone – RC219136 ORF Nucleotide >RC219136 representing NM_000944 Sequence: Red=Cloning site Blue=ORF Green=Tags(s) TTTTGTAATACGACTCACTATAGGGCGGCCGGGAATTCGTCGACTGGATCCGGTACCGAGGAGATCTGCC GCCGCGATCGCC ATGTCCGAGCCCAAGGCAATTGATCCCAAGTTGTCGACGACCGACAGGGTGGTGAAAGCTGTTCCATTTC CTCCAAGTCACCGGCTTACAGCAAAAGAAGTGTTTGATAATGATGGAAAACCTCGTGTGGATATCTTAAA GGCGCATCTTATGAAGGAGGGAAGGCTGGAAGAGAGTGTTGCATTGAGAATAATAACAGAGGGTGCATCA ATTCTTCGACAGGAAAAAAATTTGCTGGATATTGATGCGCCAGTCACTGTTTGTGGGGACATTCATGGAC AATTCTTTGATTTGATGAAGCTCTTTGAAGTCGGGGGATCTCCTGCCAACACTCGCTACCTCTTCTTAGG GGACTATGTTGACAGAGGGTACTTCAGTATTGAATGTGTGCTGTATTTGTGGGCCTTGAAAATTCTCTAC CCCAAAACACTGTTTTTACTTCGTGGAAATCATGAATGTAGACATCTAACAGAGTATTTCACATTTAAAC AAGAATGTAAAATAAAGTATTCAGAACGCGTATATGATGCCTGTATGGATGCCTTTGACTGCCTTCCCCT -
SULT1E1 Inhibits Cell Proliferation and Invasion by Activating Pparγ in Breast Cancer
Journal of Cancer 2018, Vol. 9 1078 Ivyspring International Publisher Journal of Cancer 2018; 9(6): 1078-1087. doi: 10.7150/jca.23596 Research Paper SULT1E1 inhibits cell proliferation and invasion by activating PPARγ in breast cancer Yali Xu1, Xiaoyan Lin1, Jiawen Xu1, Haiyan Jing1, Yejun Qin1, Yintao Li2 1. Department of Pathology, Shandong Provincial Hospital Affiliated to Shandong University, Jinan, Shandong, P.R. China 2. Department of Medical Oncology, Shandong Cancer Hospital and Institute, Jinan, Shandong, P.R. China Corresponding author: Yejun Qin, Department of Pathology, Shandong Provincial Hospital Affiliated to Shandong University, No. 324 Jingwu Road, Jinan, Shandong, 250021, China. Tel: +86-531-68776430. E-mail: [email protected] and Yintao Li, Department of Medical Oncology, Shandong Cancer Hospital and Institute, Shandong University, No. 440 Jiefang Road, Jinan, Shandong, 250117, China. Tel: +86-531-87984777. E-mail: [email protected] © Ivyspring International Publisher. This is an open access article distributed under the terms of the Creative Commons Attribution (CC BY-NC) license (https://creativecommons.org/licenses/by-nc/4.0/). See http://ivyspring.com/terms for full terms and conditions. Received: 2017.10.31; Accepted: 2018.01.29; Published: 2018.02.28 Abstract Sulfotransferase family 1E member 1 (SULT1E1) is known to catalyze sulfoconjugation and play a crucial role in the deactivation of estrogen homeostasis, which is involved in tumorigenesis and the progression of breast and endometrial cancers. Our previous study has shown that the protein levels of SULT1E1 were decreased in breast cancer; however, the underlying mechanism is still poorly understood. In this study, we explored the functional and molecular mechanisms by which SULT1E1 influenced breast cancer. -
Emerging Role of ODC1 in Neurodevelopmental Disorders and Brain Development
G C A T T A C G G C A T genes Article Emerging Role of ODC1 in Neurodevelopmental Disorders and Brain Development Jeremy W. Prokop 1,2,3,*, Caleb P. Bupp 1,4 , Austin Frisch 1, Stephanie M. Bilinovich 1 , Daniel B. Campbell 1,3,5, Daniel Vogt 1,3,5, Chad R. Schultz 1, Katie L. Uhl 1, Elizabeth VanSickle 4, Surender Rajasekaran 1,6,7 and André S. Bachmann 1,* 1 Department of Pediatrics and Human Development, Michigan State University, Grand Rapids, MI 49503, USA; [email protected] (C.P.B.); [email protected] (A.F.); [email protected] (S.M.B.); [email protected] (D.B.C.); [email protected] (D.V.); [email protected] (C.R.S.); [email protected] (K.L.U.); [email protected] (S.R.) 2 Department of Pharmacology and Toxicology, Michigan State University, East Lansing, MI 48824, USA 3 Center for Research in Autism, Intellectual, and Other Neurodevelopmental Disabilities, Michigan State University, East Lansing, MI 48824, USA 4 Spectrum Health Medical Genetics, Grand Rapids, MI 49503, USA; [email protected] 5 Neuroscience Program, Michigan State University, East Lansing, MI 48824, USA 6 Pediatric Intensive Care Unit, Helen DeVos Children’s Hospital, Grand Rapids, MI 49503, USA 7 Office of Research, Spectrum Health, Grand Rapids, MI 49503, USA * Correspondence: [email protected] (J.W.P.); [email protected] (A.S.B.) Abstract: Ornithine decarboxylase 1 (ODC1 gene) has been linked through gain-of-function variants Citation: Prokop, J.W.; Bupp, C.P.; to a rare disease featuring developmental delay, alopecia, macrocephaly, and structural brain anoma- Frisch, A.; Bilinovich, S.M.; Campbell, lies. -
Anti-PPP3CA (Aa 1-84) Polyclonal Antibody (DPAB- DC2401) This Product Is for Research Use Only and Is Not Intended for Diagnostic Use
Anti-PPP3CA (aa 1-84) polyclonal antibody (DPAB- DC2401) This product is for research use only and is not intended for diagnostic use. PRODUCT INFORMATION Antigen Description PPP3CA (protein phosphatase 3, catalytic subunit, alpha isozyme) is a protein-coding gene. Diseases associated with PPP3CA include osteomyelitis, and down syndrome critical region, and among its related super-pathways are Fc epsilon RI signaling pathway and BCR signaling pathway. GO annotations related to this gene include enzyme binding and calcium ion binding. An important paralog of this gene is PPP3CC. Immunogen PPP3CA (NP_000935, 1 a.a. ~ 84 a.a) partial recombinant protein with GST tag. The sequence is MSEPKAIDPKLSTTDRVVKAVPFPPSHRLTAKEVFDNDGKPRVDILKAHLMKEGRLEESVALRIIT EGASILRQEKNLLDIDAP Source/Host Mouse Species Reactivity Human Conjugate Unconjugated Applications WB (Cell lysate), WB (Recombinant protein), ELISA, Size 50 μl Buffer 50 % glycerol Preservative None Storage Store at -20°C or lower. Aliquot to avoid repeated freezing and thawing. GENE INFORMATION Gene Name PPP3CA protein phosphatase 3, catalytic subunit, alpha isozyme [ Homo sapiens (human) ] Official Symbol PPP3CA Synonyms PPP3CA; protein phosphatase 3, catalytic subunit, alpha isozyme; CALN; CCN1; CNA1; CALNA; PPP2B; CALNA1; serine/threonine-protein phosphatase 2B catalytic subunit alpha isoform; 45-1 Ramsey Road, Shirley, NY 11967, USA Email: [email protected] Tel: 1-631-624-4882 Fax: 1-631-938-8221 1 © Creative Diagnostics All Rights Reserved calcineurin A alpha; CAM-PRP catalytic -
Association of the PPP3CA C. 249G> a Variant with Clinical Outcomes Of
Journal name: Pharmacogenomics and Personalized Medicine Article Designation: ORIGINAL RESEARCH Year: 2017 Volume: 10 Pharmacogenomics and Personalized Medicine Dovepress Running head verso: Salgado et al Running head recto: PPP3CA c.249G>A variant and kidney transplantation open access to scientific and medical research DOI: http://dx.doi.org/10.2147/PGPM.S131390 Open Access Full Text Article ORIGINAL RESEARCH Association of the PPP3CA c.249G>A variant with clinical outcomes of tacrolimus-based therapy in kidney transplant recipients Patricia C Salgado1 Background: The effects of genetic variants related to the pharmacodynamic mechanisms of Fabiana DV Genvigir1 immunosuppressive drugs on their therapeutic efficacy and safety have been poorly explored. Claudia R Felipe2 This study was performed to investigate the influence of the PPP3CA c.249G>A variant on the Helio Tedesco-Silva Jr2 clinical outcomes of kidney transplant recipients. Jose O Medina-Pestana2 Patients and methods: A total of 148 Brazilian patients received tacrolimus (TAC)-based immunosuppressive therapy for 90 days post-kidney transplantation. The PPP3CA rs3730251 Sonia Q Doi3 (c.249G>A) polymorphism was determined by real-time polymerase chain reaction. Single- Mario H Hirata1 nucleotide polymorphism (SNP) data for CYP3A5 rs776746 (CYP3A5*3C; g.6986A G) were 1 > Rosario DC Hirata used to eliminate the confounding effects of this variant. 1Department of Clinical and Results: The PPP3CA c.249G>A SNP did not influence early TAC exposure, renal function, or Toxicological Analysis, School of other laboratory parameters, including levels of urea, creatinine, glucose, and lipids, and blood Pharmaceutical Sciences, University of Sao Paulo, 2Division of Nephrology, counts. This variant also did not account for the cumulative incidence of biopsy-confirmed Hospital do Rim, Federal University acute rejection or delayed graft function. -
Ornithine Decarboxylase (ODC1) Mouse Monoclonal Antibody [Clone ID: ODC-22] Product Data
OriGene Technologies, Inc. 9620 Medical Center Drive, Ste 200 Rockville, MD 20850, US Phone: +1-888-267-4436 [email protected] EU: [email protected] CN: [email protected] Product datasheet for AM20652PU-N Ornithine Decarboxylase (ODC1) Mouse Monoclonal Antibody [Clone ID: ODC-22] Product data: Product Type: Primary Antibodies Clone Name: ODC-22 Applications: IHC, WB Recommended Dilution: Western Blot: 4 μg/ml. Immunohistochemistry on paraffin sections: 8 μg/ml. Reactivity: Human Host: Mouse Isotype: IgG2b Clonality: Monoclonal Immunogen: Recombinant mouse ornithine decarboxylase. Specificity: This antibody reacts to Ornithine decarboxylase. Formulation: 1.2 % sodium acetate, with 2 mg BSA and 0.01 mg sodium azide as preservative. State: Purified State: Lyphilized purified Ig fraction Reconstitution Method: Restore with 1.2% sodium acetate or neutral PBS Concentration: 0,1 mg/ml (after reconstitution with PBS) Purification: Affinity chromatography Conjugation: Unconjugated Storage: Prior to reconstitution store at -20°C. Following reconstitution store undiluted at 2-8°C for one month or (in aliquots) at -20°C for longer. Avoid repeated freezing and thawing. Stability: Shelf life: one year from despatch. Gene Name: Homo sapiens ornithine decarboxylase 1 (ODC1), transcript variant 1 Database Link: Entrez Gene 4953 Human P11926 This product is to be used for laboratory only. Not for diagnostic or therapeutic use. View online » ©2021 OriGene Technologies, Inc., 9620 Medical Center Drive, Ste 200, Rockville, MD 20850, US 1 / 2 Ornithine Decarboxylase (ODC1) Mouse Monoclonal Antibody [Clone ID: ODC-22] – AM20652PU- N Background: Ornithine decarboxylase (ODC), the first enzyme in polyamine synthesis, is a transcriptional target of YC and a modifier of APC -dependent tumorigenesis.