DOCSLIB.ORG

Survey of Common Eye Diseases in Laboratory Mouse Strains

Total Page：16

File Type：pdf, Size：1020Kb

Download full-text PDF Read full-text
Survey of Common Eye Diseases in Laboratory Mouse Strains Genetics Survey of Common Eye Diseases in Laboratory Mouse Strains Bo Chang, Ron Hurd, Jieping Wang, and Patsy Nishina The Jackson Laboratory, Bar Harbor, Maine Correspondence: Bo Chang, The PURPOSE. As in human populations, in which founder mutations have been identified in groups Jackson Laboratory, 600 Main Street , of families, a number of founder mutations have been observed across strains in mice. In this Bar Harbor, ME 04609; report, we provide a phenotype and genotype survey of three common eye diseases in the [email protected]. collection of JAX mice strains at The Jackson Laboratory (JAX). These eye diseases are retinal Submitted: April 24, 2013 degeneration 1 (Pde6brd1), retinal degeneration 8 (Crb1rd8), and cone photoreceptor Accepted: June 20, 2013 function loss 3 (Gnat2cpfl3). Citation: Chang B, Hurd R, Wang J, METHODS. Ocular lesions for rd1 and rd8 were evaluated by fundus examination and fundus Nishina P. Survey of common eye photography, and the abnormal retinal function observed in mice homozygous for cpfl3 was diseases in laboratory mouse strains. assessed by ERG. Genotyping protocols for rd1, rd8, and cpfl3 mutations were performed by Invest Ophthalmol Vis Sci. 2013;54:4974–4981. DOI:10.1167/ PCR with appropriate primers. iovs.13-12289 RESULTS. We have actively screened retired breeders for surface dysmorphologies, and for intraocular defects by indirect ophthalmoscopy, slit-lamp biomicroscopy, and ERG to discover new spontaneous mutations in strains from the Genetic Resource Science (GRS) production colony. Through this process, we have found that of the strains screened, 99 strains carried the rd1 mutation, 85 strains carried the rd8 mutation, and 20 strains carried the cpfl3 mutation. CONCLUSIONS. Of the 1000 of strains screened during this study, 204 carried one of three founder mutations in Pde6b, Crb1,orGnat2. Since these three retinal mutations occur commonly in various mouse strains, genotyping for these mutations, and/or avoiding mouse strains or stocks carrying these mutant alleles when studying new retinal disorders is recommended. The robust PCR genotyping protocols to test for these common alleles are described herein. Keywords: retinal degeneration, fundus photography, spontaneous mutation, animal model, eye diseases iscovery of human retinal degenerations generally is our understanding of the function of specific genes and how Didentified by self-reports of visual problems with subse- they lead to disease when disrupted. Studies of mouse models quent eye examinations. However, determining the etiology of human retinal degeneration have contributed to our and the disease progression, elucidating the mechanisms understanding of the pathophysiology, as well as the etiology, underlying the disease, and exploring methods for delaying or of these diseases, and allowed for development of gene-based ameliorating retinal degenerations can be impeded by ethical therapy to delay the progression of disease and increase visual considerations of exploratory experimentation on humans. function.3,4 Also, human eye tissue (including biopsies) seldom is available Historically, the first retinal degeneration model was for study because it is difficult to obtain tissue from the eye described by Clyde E. Keeler more than 80 years ago. It without risk of further damage to the patient’s vision, and if subsequently was identified as a disruption in phosphodiester- samples are available, they usually are at the end stages of the ase 6 beta (Pde6brd1, formerly rd1, rd, identical to Keeler disease process. rodless retina, r).5–7 The second retinal degeneration model Animal models have advanced our understanding of eye was discovered 50 years later, and named retinal degeneration- diseases significantly as they allow for sampling of tissue slow (Rds or Rd2).8 The third retinal degeneration was throughout development and disease progression, for invasive discovered in 1993 and named retinal degeneration 3, rd3.9 studies, and for rapid genetic analysis. Use of mouse models, in Subsequently, during the last 20 years, many additional mouse particular, has increased through the past decades due to their models of retinal degeneration have been discovered as the ability to be modified genetically. In addition to manipulation by tools used commonly in human clinical eye examinations have genetic engineering, a large number of spontaneous and been adapted for use with the smaller mouse eyes.10,11 chemically-induced mutations have been identified by screen- Interestingly, through screening many retired breeders of ing mice using indirect ophthalmoscopy and ERG at The different mouse strains at JAX, mutations in Pde6b, Crb1, and Jackson Laboratory (JAX; Bar Harbor, ME), where many mouse Gnat2 have been found to recur in high frequency. Because the models of retinal degeneration and diseases have been strains examined all bore the same respective mutations within discovered.1,2 These mouse models have increased significantly these particular genes, this suggested that they were founder Copyright 2013 The Association for Research in Vision and Ophthalmology, Inc. www.iovs.org j ISSN: 1552-5783 4974 Downloaded from iovs.arvojournals.org on 09/28/2021 Common Eye Diseases in Mice IOVS j July 2013 j Vol. 54 j No. 7 j 4975 FIGURE 1. Fundus photographs of normal pigmented (A) and albino (C) mice as well as fundus photographs of mice bearing the Pdeb6rd1 mutation in pigmented (B) and albino (D) background. mutations that had been propagated across multiple strains in accordance with the ARVO Statement for the Use of Animals through the years of model development and inbreeding.12–14 in Ophthalmic and Vision Research. As significant retinal pathology occurs in the presence of rd1 rd8 Pde6b and Crb1 , and functional deficits occurs in the Clinical Retinal Evaluation presence of Gnat2cpfl3, interpretation of disease phenotypes resulting from different gene/mutations and experimental Mouse eyes, dilated with 1% atropine (Alcon Laboratories, Inc., studies where behavioral performance is an end point, Fort Worth, TX), were evaluated by indirect ophthalmoscopy respectively, may be confounded. Knowledge of the genotype with a 90 diopter lens. If a mouse strain showed signs of early for the common disease alleles in these experimental models and rapid retinal degeneration, such as attenuation of retinal will aid in the proper selection of mouse strains for use in vessels or areas of depigmentation (Fig. 1B), the mouse strain research studies and interpretation of data generated from was genotyped for the rd1 mutation. If a mouse strain in the them. C57BL/6 genetic background or related background showed a retinal spotting phenotype (Fig. 2A), the mouse strain was typed for the rd8 mutation. Fundus photographs were taken MATERIALS AND METHODS with the Micron III retinal imaging microscope from Phoenix Research Laboratories (Phoenix, AZ). Mice The mice screened in this study were bred and maintained in Simplified Screening for Functional ERG standardized conditions at the Production and Research Animal Alterations Facilities at JAX. They were maintained on a NIH31 6% fat chow diet and provided acidified water, in a pathogen-free Attenuation of retinal vessels and disturbances in the retinal vivarium environment with a 14-hr light/10-hr dark cycle. One pigment epithelium are detected easily by indirect ophthal- pair of retired breeders from the JAX Mouse Repository was moscopy. However, even if the retina has a normal screened for each strain. All experiments were approved by the appearance, retinal function still may be impaired. Therefore, Institutional Animal Care and Use Committee, and conducted all strains with a normal fundus appearance by indirect Downloaded from iovs.arvojournals.org on 09/28/2021 Common Eye Diseases in Mice IOVS j July 2013 j Vol. 54 j No. 7 j 4976 FIGURE 2. Fundus photographs of mice homozygous for the Crb1rd8 mutations with the typical pattern of white retinal spots (A), with a few white retinal spots (B), and with no retinal white spots (C). ophthalmoscopy were screened for functional deficits by base of the tail for grounding, a gold loop electrode was placed ERG. Because the standard ERG test is time consuming, between the gum and cheek, and the active gold loop requiring approximately 30 to 60 minutes per mouse (not electrode was placed gently on the cornea slightly below the including the time necessary for dark adaption), we have middle of the eye. A drop of 2.5% Gonioscopic Prism Solution developed a simple screening ERG test that takes less than 10 (Wilson Ophthalmic, Mustang, OK) was placed on the cornea minutes per mouse to detect for functional deficits, such as and electrode to assure a good contact and to prevent drying of 14,15 retinal cone photoreceptor function loss (achromatopsia) the eye surface. In the simplified test, 10 flashes of the highest 16,17 andnob-wave(nob)mutations. light intensity (light intensity ¼ 1.9 log cd/m2) were averaged. Briefly, one eye per mouse was dilated with 1% cyclopen- If a mouse had a photopic b-wave amplitude at or above 100 tolate hydrochloride ophthalmic solution (Bausch & Lomb, lV and implicit times at approximately 50 ms, the mouse was Inc., Tampa, FL). A group of 5 to 10 mice could be dilated at considered normal (Fig. 3A), whereas a mouse with a b-wave the same time. Mice were weighed to determine the proper dosage of anesthesia (0.1 mL/20 g body weight of a mixture of amplitude at or below 50 lV and/or implicit times longer than 0.8 mL ketamine [Ketamine KCL injection USP, 100 mg/mL;
Load more

Recommended publications
  • RPE65 Mutant Dog/ Leber Congenital Amaurosis
    Rpe65 mutant dogs Pde6A mutant dogs Cngb1 mutant dogs rAAV RPE65 Mutant Dog/ Leber Congenital Amaurosis Null mutation in Rpe65 retinal function (ERG & dim light vision) Failure of 11-cis retinal supply to photoreceptors (visual cycle) Retina only slow degeneration (S-cones and area centralis degeneration – variable) RPE lipid inclusions 8 Mo 3.5 yr The Visual (Retinoid) Cycle retinal pigment All-trans-retinol epithelium (Vitamin A) RPE65 11-cis-retinal Visual pigments All-trans-retinal rod and cone outer segments All-trans-retinol Gene supplementation therapy for RPE65 Leber Congenital Amaurosis Initial trials in dogs – very successful Outcome in humans Some improvement in visual function Appears to not preserve photoreceptors in longer term Questions Is there preservation of photoreceptors? Why is outcome in humans not so successful? Does RPE65 Gene Therapy Preserve Photoreceptors? Rpe65-/- dogs: Early loss of S-cones Slow LM cone loss Very slow rod loss Exception – region of high density of photoreceptors – rapid loss Gene therapy preservation of photoreceptors Limitations to Human Functional Rescue and Photoreceptor Preservation Hypothesis The dose of gene therapy delivered is a limiting factor for the efficacy of treatment Specific aim To compare the clinical efficacy and the levels of expression of RPE65 protein and the end product of RPE65 function (11-cis retinal) of various doses of RPE65 gene therapy in Rpe65 -/- dogs Methods Tested total dose of 8x108 to 1x1011 vg/eye ERG Scotopic b wave Vision testing % correct choice RPE65 protein expression Dose of gene therapy +/+ 8x108 4x109 2x1010 1x1011 RPE65 GAPDH RPE65 protein expression RPE65/DAPI/ autofluorescence Chromophore levels 11-cis retinal levels undetectable In Rpe65 -/- All-trans retinal Chromophore vs clinical outcomes Scotopic b wave r2 = 0.91 p < 0.0001 Vision testing % correct choice r2 = 0.58 p = 0.02 RPE65 gene expression Human vs.
    [Show full text]
  • Supplementary Information Integrative Analyses of Splicing in the Aging Brain: Role in Susceptibility to Alzheimer’S Disease
    Supplementary Information Integrative analyses of splicing in the aging brain: role in susceptibility to Alzheimer’s Disease Contents 1. Supplementary Notes 1.1. Religious Orders Study and Memory and Aging Project 1.2. Mount Sinai Brain Bank Alzheimer’s Disease 1.3. CommonMind Consortium 1.4. Data Availability 2. Supplementary Tables 3. Supplementary Figures Note: Supplementary Tables are provided as separate Excel files. 1. Supplementary Notes 1.1. Religious Orders Study and Memory and Aging Project Gene expression data1. Gene expression data were generated using RNA- sequencing from Dorsolateral Prefrontal Cortex (DLPFC) of 540 individuals, at an average sequence depth of 90M reads. Detailed description of data generation and processing was previously described2 (Mostafavi, Gaiteri et al., under review). Samples were submitted to the Broad Institute’s Genomics Platform for transcriptome analysis following the dUTP protocol with Poly(A) selection developed by Levin and colleagues3. All samples were chosen to pass two initial quality filters: RNA integrity (RIN) score >5 and quantity threshold of 5 ug (and were selected from a larger set of 724 samples). Sequencing was performed on the Illumina HiSeq with 101bp paired-end reads and achieved coverage of 150M reads of the first 12 samples. These 12 samples will serve as a deep coverage reference and included 2 males and 2 females of nonimpaired, mild cognitive impaired, and Alzheimer's cases. The remaining samples were sequenced with target coverage of 50M reads; the mean coverage for the samples passing QC is 95 million reads (median 90 million reads). The libraries were constructed and pooled according to the RIN scores such that similar RIN scores would be pooled together.
    [Show full text]
  • Single Nucleotide Polymorphisms Within Calcineurin-Encoding Genes
    Annals of Applied Sport Science, vol. 4, no. 2, pp. 01-08, Summer 2016 DOI: 10.18869/acadpub.aassjournal.4.2.1 Original Article www.aassjournal.com www.AESAsport.com ISSN (Online): 2322 – 4479 Received: 06/03/2016 ISSN (Print): 2476–4981 Accepted: 26/06/2016 Single Nucleotide Polymorphisms within Calcineurin-Encoding Genes are Associated with Response to Aerobic Training in Han Chinese Males 1Rong-mei Xu, 2Tao Lu, 2Lingxian Yan, 1Qinghua Song* 1The Center of Physical Health, Henan Polytechnic University, Jiaozuo 454000, Henan Province, China. 2 The Lab of Human Body Science, Henan Polytechnic University, Jiaozuo 454000, Henan Province, China. ABSTRACT Calcineurin, which functions in calcium signaling, is expressed in skeletal and cardiac muscle and has been linked to sensitivity to muscle strength training. It is also proposed to contribute to individual aerobic endurance. To investigate the relationship between calcineurin-encoding genes and aerobic endurance traits, 126 young-adult Han Chinese males were enrolled in an aerobic exercise training study. Participants were genotyped for polymorphisms within the 5 genes (PPP3CA, PPP3CB, PPP3CC, PPP3R1 and PPP3R2) encoding calcineurin using restriction fragment length polymorphism polymerase chain reaction (PCR-RFLP) or matrix-assisted laser desorption ionization time-of-flight mass spectrometry (MALDI-TOF MS). Participants underwent 18 weeks of aerobic exercise training (running). Before and after the training period, maximal oxygen uptake (VO2max) and 12 km/h running economy were measured. Statistical analyses were performed using chi-square test and analysis of variance. The baseline value of VO2max was significantly associated with rs3804423 and rs2850965 loci in the PPP3CA gene (P<0.05).
    [Show full text]
  • A Multistep Bioinformatic Approach Detects Putative Regulatory
    BMC Bioinformatics BioMed Central Research article Open Access A multistep bioinformatic approach detects putative regulatory elements in gene promoters Stefania Bortoluzzi1, Alessandro Coppe1, Andrea Bisognin1, Cinzia Pizzi2 and Gian Antonio Danieli*1 Address: 1Department of Biology, University of Padova – Via Bassi 58/B, 35131, Padova, Italy and 2Department of Information Engineering, University of Padova – Via Gradenigo 6/B, 35131, Padova, Italy Email: Stefania Bortoluzzi - [email protected]; Alessandro Coppe - [email protected]; Andrea Bisognin - [email protected]; Cinzia Pizzi - [email protected]; Gian Antonio Danieli* - [email protected] * Corresponding author Published: 18 May 2005 Received: 12 November 2004 Accepted: 18 May 2005 BMC Bioinformatics 2005, 6:121 doi:10.1186/1471-2105-6-121 This article is available from: http://www.biomedcentral.com/1471-2105/6/121 © 2005 Bortoluzzi et al; licensee BioMed Central Ltd. This is an Open Access article distributed under the terms of the Creative Commons Attribution License (http://creativecommons.org/licenses/by/2.0), which permits unrestricted use, distribution, and reproduction in any medium, provided the original work is properly cited. Abstract Background: Searching for approximate patterns in large promoter sequences frequently produces an exceedingly high numbers of results. Our aim was to exploit biological knowledge for definition of a sheltered search space and of appropriate search parameters, in order to develop a method for identification of a tractable number of sequence motifs. Results: Novel software (COOP) was developed for extraction of sequence motifs, based on clustering of exact or approximate patterns according to the frequency of their overlapping occurrences.
    [Show full text]
  • Protein Kinase A-Mediated Septin7 Phosphorylation Disrupts Septin Filaments and Ciliogenesis
    cells Article Protein Kinase A-Mediated Septin7 Phosphorylation Disrupts Septin Filaments and Ciliogenesis Han-Yu Wang 1,2, Chun-Hsiang Lin 1, Yi-Ru Shen 1, Ting-Yu Chen 2,3, Chia-Yih Wang 2,3,* and Pao-Lin Kuo 1,2,4,* 1 Department of Obstetrics and Gynecology, College of Medicine, National Cheng Kung University, Tainan 701, Taiwan; [email protected] (H.-Y.W.); [email protected] (C.-H.L.); [email protected] (Y.-R.S.) 2 Institute of Basic Medical Sciences, College of Medicine, National Cheng Kung University, Tainan 701, Taiwan; [email protected] 3 Department of Cell Biology and Anatomy, College of Medicine, National Cheng Kung University, Tainan 701, Taiwan 4 Department of Obstetrics and Gynecology, National Cheng-Kung University Hospital, Tainan 704, Taiwan * Correspondence: [email protected] (C.-Y.W.); [email protected] (P.-L.K.); Tel.: +886-6-2353535 (ext. 5338); (C.-Y.W.)+886-6-2353535 (ext. 5262) (P.-L.K.) Abstract: Septins are GTP-binding proteins that form heteromeric filaments for proper cell growth and migration. Among the septins, septin7 (SEPT7) is an important component of all septin filaments. Here we show that protein kinase A (PKA) phosphorylates SEPT7 at Thr197, thus disrupting septin filament dynamics and ciliogenesis. The Thr197 residue of SEPT7, a PKA phosphorylating site, was conserved among different species. Treatment with cAMP or overexpression of PKA catalytic subunit (PKACA2) induced SEPT7 phosphorylation, followed by disruption of septin filament formation. Constitutive phosphorylation of SEPT7 at Thr197 reduced SEPT7-SEPT7 interaction, but did not affect SEPT7-SEPT6-SEPT2 or SEPT4 interaction.
    [Show full text]
  • 1 Supporting Information for a Microrna Network Regulates
    Supporting Information for A microRNA Network Regulates Expression and Biosynthesis of CFTR and CFTR-ΔF508 Shyam Ramachandrana,b, Philip H. Karpc, Peng Jiangc, Lynda S. Ostedgaardc, Amy E. Walza, John T. Fishere, Shaf Keshavjeeh, Kim A. Lennoxi, Ashley M. Jacobii, Scott D. Rosei, Mark A. Behlkei, Michael J. Welshb,c,d,g, Yi Xingb,c,f, Paul B. McCray Jr.a,b,c Author Affiliations: Department of Pediatricsa, Interdisciplinary Program in Geneticsb, Departments of Internal Medicinec, Molecular Physiology and Biophysicsd, Anatomy and Cell Biologye, Biomedical Engineeringf, Howard Hughes Medical Instituteg, Carver College of Medicine, University of Iowa, Iowa City, IA-52242 Division of Thoracic Surgeryh, Toronto General Hospital, University Health Network, University of Toronto, Toronto, Canada-M5G 2C4 Integrated DNA Technologiesi, Coralville, IA-52241 To whom correspondence should be addressed: Email: [email protected] (M.J.W.); yi- [email protected] (Y.X.); Email: [email protected] (P.B.M.) This PDF file includes: Materials and Methods References Fig. S1. miR-138 regulates SIN3A in a dose-dependent and site-specific manner. Fig. S2. miR-138 regulates endogenous SIN3A protein expression. Fig. S3. miR-138 regulates endogenous CFTR protein expression in Calu-3 cells. Fig. S4. miR-138 regulates endogenous CFTR protein expression in primary human airway epithelia. Fig. S5. miR-138 regulates CFTR expression in HeLa cells. Fig. S6. miR-138 regulates CFTR expression in HEK293T cells. Fig. S7. HeLa cells exhibit CFTR channel activity. Fig. S8. miR-138 improves CFTR processing. Fig. S9. miR-138 improves CFTR-ΔF508 processing. Fig. S10. SIN3A inhibition yields partial rescue of Cl- transport in CF epithelia.
    [Show full text]
  • Novel Variants in Phosphodiesterase 6A and Phosphodiesterase 6B Genes and Its Phenotypes in Patients with Retinitis Pigmentosa in Chinese Families
    Novel Variants in Phosphodiesterase 6A and Phosphodiesterase 6B Genes and Its Phenotypes in Patients With Retinitis Pigmentosa in Chinese Families Yuyu Li Beijing Tongren Hospital, Capital Medical University Ruyi Li Beijing Tongren Hospital, Capital Medical University Hehua Dai Beijing Tongren Hospital, Capital Medical University Genlin Li ( [email protected] ) Beijing Tongren Hospital, Capital Medical University Research Article Keywords: Retinitis pigmentosa, PDE6A,PDE6B, novel variants, phenotypes Posted Date: May 20th, 2021 DOI: https://doi.org/10.21203/rs.3.rs-507306/v1 License: This work is licensed under a Creative Commons Attribution 4.0 International License. Read Full License Page 1/15 Abstract Background: Retinitis pigmentosa (RP) is a genetically heterogeneous disease with 65 causative genes identied to date. However, only approximately 60% of RP cases genetically solved to date, predicating that many novel disease-causing variants are yet to be identied. The purpose of this study is to identify novel variants in phosphodiesterase 6A and phosphodiesterase 6B genes and present its phenotypes in patients with retinitis pigmentosa in Chinese families. Methods: Five retinitis pigmentosa patients with PDE6A variants and three with PDE6B variants were identied through a hereditary eye disease enrichment panel (HEDEP), all patients’ medical and ophthalmic histories were collected, and ophthalmological examinations were performed, then we analysed the possible causative variants. Sanger sequencing was used to verify the variants. Results: We identied 20 mutations sites in eight patients, two heterozygous variants were identied per patient of either PDE6A or PDE6B variants, others are from CA4, OPTN, RHO, ADGRA3 variants. We identied two novel variants in PDE6A: c.1246G > A;p.(Asp416Asn) and c.1747T > A;p.(Tyr583Asn).
    [Show full text]
  • Gene Therapy Provides Long-Term Visual Function in a Pre-Clinical Model of Retinitis Pigmentosa Katherine J. Wert Submitted in P
    Gene Therapy Provides Long-term Visual Function in a Pre-clinical Model of Retinitis Pigmentosa Katherine J. Wert Submitted in partial fulfillment of the requirements for the degree of Doctor of Philosophy under the Executive Committee of the Graduate School of Arts and Sciences COLUMBIA UNIVERSITY 2013 © 2013 Katherine J. Wert All rights reserved ABSTRACT Gene Therapy Provides Long-term Visual Function in a Pre-clinical Model of Retinitis Pigmentosa Katherine J. Wert Retinitis pigmentosa (RP) is a photoreceptor neurodegenerative disease. Patients with RP present with the loss of their peripheral visual field, and the disease will progress until there is a full loss of vision. Approximately 36,000 cases of simplex and familial RP worldwide are caused by a mutation in the rod-specific cyclic guanosine monophosphate phosphodiesterase (PDE6) complex. However, despite the need for treatment, mouse models with mutations in the alpha subunit of PDE6 have not been characterized beyond 1 month of age or used to test the pre- clinical efficacy of potential therapies for human patients with RP caused by mutations in PDE6A. We first proposed to establish the temporal progression of retinal degeneration in a mouse model with a mutation in the alpha subunit of PDE6: the Pde6anmf363 mouse. Next, we developed a surgical technique to enable us to deliver therapeutic treatments into the mouse retina. We then hypothesized that increasing PDE6α levels in the Pde6anmf363 mouse model, using an AAV2/8 gene therapy vector, could improve photoreceptor survival and retinal function when delivered before the onset of degeneration. Human RP patients typically will not visit an eye care professional until they have a loss of vision, therefore we further hypothesized that this gene therapy vector could improve photoreceptor survival and retinal function when delivered after the onset of degeneration, in a clinically relevant scenario.
    [Show full text]
  • Protein Interactions in the Cancer Proteome† Cite This: Mol
    Molecular BioSystems View Article Online PAPER View Journal | View Issue Small-molecule binding sites to explore protein– protein interactions in the cancer proteome† Cite this: Mol. BioSyst., 2016, 12,3067 David Xu,ab Shadia I. Jalal,c George W. Sledge Jr.d and Samy O. Meroueh*aef The Cancer Genome Atlas (TCGA) offers an unprecedented opportunity to identify small-molecule binding sites on proteins with overexpressed mRNA levels that correlate with poor survival. Here, we analyze RNA-seq and clinical data for 10 tumor types to identify genes that are both overexpressed and correlate with patient survival. Protein products of these genes were scanned for binding sites that possess shape and physicochemical properties that can accommodate small-molecule probes or therapeutic agents (druggable). These binding sites were classified as enzyme active sites (ENZ), protein–protein interaction sites (PPI), or other sites whose function is unknown (OTH). Interestingly, the overwhelming majority of binding sites were classified as OTH. We find that ENZ, PPI, and OTH binding sites often occurred on the same structure suggesting that many of these OTH cavities can be used for allosteric modulation of Creative Commons Attribution 3.0 Unported Licence. enzyme activity or protein–protein interactions with small molecules. We discovered several ENZ (PYCR1, QPRT,andHSPA6)andPPI(CASC5, ZBTB32,andCSAD) binding sites on proteins that have been seldom explored in cancer. We also found proteins that have been extensively studied in cancer that have not been previously explored with small molecules that harbor ENZ (PKMYT1, STEAP3,andNNMT) and PPI (HNF4A, MEF2B,andCBX2) binding sites. All binding sites were classified by the signaling pathways to Received 29th March 2016, which the protein that harbors them belongs using KEGG.
    [Show full text]
  • Phylogenetic and Evolutionary Analysis of the Septin Protein Family in Metazoan
    View metadata, citation and similar papers at core.ac.uk brought to you by CORE provided by Elsevier - Publisher Connector FEBS Letters 581 (2007) 5526–5532 Phylogenetic and evolutionary analysis of the septin protein family in metazoan Lihuan Cao1, Xiangming Ding1, Wenbo Yu, Xianmei Yang, Suqin Shen, Long Yu* State Key Laboratory of Genetic Engineering, Institute of Genetics, School of Life Sciences, Fudan University, Shanghai 200433, PR China Received 9 August 2007; revised 11 October 2007; accepted 19 October 2007 Available online 29 October 2007 Edited by Takashi Gojobori have a P-loop [8,9] which is defined by the Walker A motif Abstract Septins, a conserved family of cytoskeletal GTP- binding proteins, were presented in diverse eukaryotes. Here, a (GxxGxGKST), Walker B motif (DxxG), and the GTP-speci- comprehensive phylogenetic and evolutionary analysis for septin ficity motif (xKxD). Septins differ from most other members of proteins in metazoan was carried out. First, we demonstrated this subclass in that they lack an asparagine at position 1 of the that all septin proteins in metazoan could be clustered into four GTP-specificity motif (i.e. not NKxD, but AKAD or GKAD) subgroups, and the representative homologue of every subgroup [7]. Recently, the crystal structures of the human SEPT2 G was presented in the non-vertebrate chordate Ciona intestinalis, domain and the heterotrimeric human SEPT2-SEPT6-SEPT7 indicating that the emergence of the four septin subgroups should complex had been determined. The septin complex structure have occurred prior to divergence of vertebrates and inverte- revealed a universal bipolar polymer building block, composed brates, and the expansion of the septin gene number in verte- of an extended G domain, which forms oligomers and fila- brates was mainly by the duplication of pre-existing genes ments by conserved interactions between adjacent nucleotide- rather than by the appearance of new septin subgroup.
    [Show full text]
  • High Throughput Computational Mouse Genetic Analysis
    bioRxiv preprint doi: https://doi.org/10.1101/2020.09.01.278465; this version posted January 22, 2021. The copyright holder for this preprint (which was not certified by peer review) is the author/funder. All rights reserved. No reuse allowed without permission. High Throughput Computational Mouse Genetic Analysis Ahmed Arslan1+, Yuan Guan1+, Zhuoqing Fang1, Xinyu Chen1, Robin Donaldson2&, Wan Zhu, Madeline Ford1, Manhong Wu, Ming Zheng1, David L. Dill2* and Gary Peltz1* 1Department of Anesthesia, Stanford University School of Medicine, Stanford, CA; and 2Department of Computer Science, Stanford University, Stanford, CA +These authors contributed equally to this paper & Current Address: Ecree Durham, NC 27701 *Address correspondence to: [email protected] bioRxiv preprint doi: https://doi.org/10.1101/2020.09.01.278465; this version posted January 22, 2021. The copyright holder for this preprint (which was not certified by peer review) is the author/funder. All rights reserved. No reuse allowed without permission. Abstract Background: Genetic factors affecting multiple biomedical traits in mice have been identified when GWAS data that measured responses in panels of inbred mouse strains was analyzed using haplotype-based computational genetic mapping (HBCGM). Although this method was previously used to analyze one dataset at a time; but now, a vast amount of mouse phenotypic data is now publicly available, which could lead to many more genetic discoveries. Results: HBCGM and a whole genome SNP map covering 53 inbred strains was used to analyze 8462 publicly available datasets of biomedical responses (1.52M individual datapoints) measured in panels of inbred mouse strains. As proof of concept, causative genetic factors affecting susceptibility for eye, metabolic and infectious diseases were identified when structured automated methods were used to analyze the output.
    [Show full text]
  • G Protein Alpha Inhibitor 1 (GNAI1) Rabbit Polyclonal Antibody Product Data
    OriGene Technologies, Inc. 9620 Medical Center Drive, Ste 200 Rockville, MD 20850, US Phone: +1-888-267-4436 [email protected] EU: [email protected] CN: [email protected] Product datasheet for TA335036 G protein alpha inhibitor 1 (GNAI1) Rabbit Polyclonal Antibody Product data: Product Type: Primary Antibodies Applications: WB Recommended Dilution: WB Reactivity: Human, Mouse, Rat Host: Rabbit Isotype: IgG Clonality: Polyclonal Immunogen: The immunogen for anti-GNAI1 antibody: synthetic peptide directed towards the middle region of human GNAI1. Synthetic peptide located within the following region: YQLNDSAAYYLNDLDRIAQPNYIPTQQDVLRTRVKTTGIVETHFTFKDLH Formulation: Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose. Note that this product is shipped as lyophilized powder to China customers. Purification: Affinity Purified Conjugation: Unconjugated Storage: Store at -20°C as received. Stability: Stable for 12 months from date of receipt. Predicted Protein Size: 40 kDa Gene Name: G protein subunit alpha i1 Database Link: NP_002060 Entrez Gene 14677 MouseEntrez Gene 25686 RatEntrez Gene 2770 Human P63096 This product is to be used for laboratory only. Not for diagnostic or therapeutic use. View online » ©2021 OriGene Technologies, Inc., 9620 Medical Center Drive, Ste 200, Rockville, MD 20850, US 1 / 4 G protein alpha inhibitor 1 (GNAI1) Rabbit Polyclonal Antibody – TA335036 Background: Guanine nucleotide-binding proteins (G proteins) form a large family of signal-transducing molecules. They are found as heterotrimers made up of alpha, beta, and gamma subunits. Members of the G protein family have been characterized most extensively on the basis of the alpha subunit, which binds guanine nucleotide, is capable of hydrolyzing GTP, and interacts with specific receptor and effector molecules.
    [Show full text]