BEDALES ASSOCIATION & OLD BEDALIAN NEWSLETTER 2018

CONTENTS

WELCOME 2

HEAD’S REFLECTIONS ON 2017 3

OB EVENTS – REVIEWS OF 2017 5

UPCOMING REUNIONS 13

A YEAR AT BEDALES 14

PROFESSIONAL GUIDANCE FOR BEDALIANS 18

THE RETURN OF THE LUPTON HALL 20

MEMORIES OF INNES ‘GIGI’ MEO 23

SAYES COURT 24

DRAWING ON THE LESSONS OF THE PAST 27

THE JOHN BADLEY FOUNDATION 29

THE BEDALES GRANTS TRUST FUND 34

OB PROFILES 36

BEDALES EVENTS 2018 40

FROM DEEPEST DORSET TO HAMPSHIRE 41

ON THE BUSES 42

MCCALDIN ARTS 43

20 YEARS OF CECILY’S FUND AT BEDALES 45

2017 IN THE ARCHIVES 47

STAFF PROFILES 48

NEWS IN BRIEF 54

OBITUARIES 61 Kay Bennett (née Boddington) 61 Thomas Cassirer 61 Ralph Wedgwood 62 Gervase de Peyer 63 Michael J C Gordon FRS 64 George Murray 65 Robin Murray 66 Adrianne Reveley (née Moore) 67 Josephine Averill Simons (née Wheatcroft) 68 Francis (Bill) Thornycroft 69 Professor Dame Margaret Turner-Warwick 71

BIRTHS, ENGAGEMENTS, MARRIAGES & DEATHS 73

UNIVERSITY DESTINATIONS 2017 74

Contents • 1 WELCOME

elcome to the Bedales WAssociation Newsletter 2018. The programme of Association events developed in 2016 continued and expanded last year; there have been reunions in Bristol and Oxford and at Bedales on Parents’ Day for the classes of 1972/3, 1992 and 2007. Former parents also had a lunch party on the same day. There was a tree-planting gathering for the class of 1966, a STEM sector event at the Royal College of Surgeons, sporting, social and fundraising events. The Eckersley Lecture was delivered by Professor Eleanor Maguire this year. The Stansted Payers performed as usual in August and for cricket players, the annual Stoner Cricket Week provided an opportunity for current and OB players to enjoy some friendly competition in July. The Association AGM was again held at the 1901 Arts Around the school, visiting OBs members are encouraged to join any Club in London. Lisa Cooper from the [MPPFIHIPMKLXIHXS½RHXLI0YTXSR of the events of interest. Additionally Accounts department reached her Hall is back in business for music some events are advertised in the Bedales 25th work anniversary and performances, having been restored monthly e-bulletin. was presented with a woodcut of the to working condition (see page 20). As always I would like to thank Lupton Hall by the Association. The Art and Design building which XLSWIMRXLI)\XIVREP6IPEXMSRW3J½GI Some may already have read opened in 2016 has won prestigious OBs and friends of the Association in a monthly e-bulletin about the architectural awards and, most who have worked so hard to organise Digitisation Project to preserve importantly, has proved to be a very events during the year, and to The Bedales Chronicle; the Association popular working environment. welcome Leana Seriau back from has supported this initiative but This year the school celebrates her maternity leave. further funds are needed. Anyone its 125th anniversary. Plans for this wishing to contribute can request and for Association events are Sylvia Kahn-Freund (1964-70) particular pages/years to be covered posted on the school website on Chair of the Bedales Association (see page 47). the Events section. Association Steering Group

CONTACT THE Newsletter Editorial Committee ALUMNI LIAISON TEAM Robert Booth (1958-63) Paul Cormack (1940-47) Leana Seriau Philip Parsons Matthew Rice (1975-80) %PYQRM0MEMWSR1EREKIV %PYQRM3J½GIV E: [email protected] E: [email protected] The editorial committee is looking for additional members. T: 01730 711 572 T: 01730 711 631 Should you wish to join, please contact Leana Seriau.

STAY CONNECTED to your Old Bedalian community OB Bulletins *EGIFSSO Twitter LinkedIn Subscribe: [email protected] Like us: Bedales School Follow us: @bedalesschool Join us: Bedales Alumni

2 • Welcome HEAD’S REFLECTIONS ON 2017

here is too much of me already in Tthis edition, as I have been treated XSERI\XIRWMZIWXEJJTVS½PIFIJSVI my departure in the summer, so my VI¾IGXMSRWLIVIEVIFVMIJ-JXLMW]IEVLEW had a theme, it is a suitably Janus-like one, of looking back at the old, whilst welcoming the new. Our new Art & Design Building FIGEQIXLI½VWXWGLSSPFYMPHMRKXS win the RIBA Client of the Year award. -QEHIQ]½VWXERHSRP]EGGITXERGI speech. You will be glad to know that our willingness to consult broadly and to stay true to the school’s ethos, whilst being canny with the budgeting and contract, got gold stars. Meanwhile the restoration of the Lupton Hall has won plaudits. Read more about this in Anna the coming year will be over £1.5 million, joined Bedales in April 1980. Becoming /IE]´W½RIEVXMGPISRTEKI E½KYVIHIEVXSQ]LIEVX Catering Manager in 2000, Dave Student numbers across the three At Dunhurst we said goodbye in July assisted in or presided over at least schools have remained healthy. This to Jane Grubb who had done a sterling 25,000 meals. As well as managing will enable us to continue to invest job in raising standards of teaching and the sometimes lively environment in the future. Ensuring that there is learning at Dunhurst in her six years of kitchen and dining hall with great a greater sense of coherence and there. Jane has served her pupils in her patience, professionalism and care, continuity across the 3-18 spectrum own inimitable, energetic, unstuffy but Dave has been the most genial and has been a big part of my role. Trying always kind way. This coming July we friendly of faces on a day to day, meal XSQMXMKEXIXLIIJJIGXSJEFSZIMR¾EXMSR will also say goodbye to Jo Webbern by meal basis. He has listened and fee increases through increasing who has likewise been a great colleague responded to student suggestions, bursary provision has been a priority ERHE½RILIEHJSVNYWXSZIVIMKLX knowing how to sort the wheat from too. In that light I commend to you the years at Dunannie. Welcoming and the chaff and always responding to the articles (on pages 29 and 34) about working alongside Dunhurst new head, bewildering range of requests with the John Badley Foundation and the Colin Baty (whom some of you will great understanding. It says something Bedales Grants Trust Fund. Together remember from his time as an even both about Dave and the affection in with grants from other educational fresher-faced fellow at Dunhurst in the which he is held that he has had three trusts and underpinned by the school’s early noughties), has been a delight. wholehearted, spirited and suitably contribution (6% of fee income), the I have two other goodbyes to long noisy send offs by governors, staff EQSYRXSJ½RERGMEPEWWMWXERGIKMZIRMR serving colleagues. Dave Greenman ERHWXYHIRXWMRXLI½REP[IIOWSJXLI Autumn term. As we approached Nick Gleed’s departure at the end of the Summer term, a call went out to OB musicians to EWOMJXLI][ERXIHXSTIVJSVQMRLMW½REP Summer Concert. We had a wonderful response from OBs whom Nick has inspired over his 27 years at Bedales. The repertoire was uncompromisingly ambitious with the Elgar Concerto for Cello and Orchestra and Mozart’s Great Mass in C minor, along with Vivaldi’s Gloria and Nick himself playing the Eclogue for Piano and Strings of Gerald Finzi,

,IEH´W6I¾IGXMSRWSRˆ3 HEAD’S REFLECTIONS ON 2017

whose music Nick describes in the music as a quintessentially Bedalian 8LI½REPFMXSJ.ERYWPMOI[SVOMWXS programme as capturing John Badley’s activity. Early on in my time he alerted say how lucky I think the school is that ambitions for Bedales; in particular me to Hector Jacks’s comment about Magnus Bashaarat will be taking over “its beguiling lyricism and nuanced music being the way that Bedales as Head from September this year. counter points sustained within a ±PMWXIRWXSMXWIPJ²2MGO´WEFMPMX]XS I also think he is a lucky chap to have GSR½HIRXP]PMFIVEPWXVYGXYVI² articulate some of the school’s core the prospect of leading your school This quote captures three things beliefs has been a salient feature of his and getting to know something of the central to Nick: his passionate belief in XMQILIVI8LIJEGXXLEXIZIRMRLMW½REP diverse splendour that makes up the the school’s founding vision; the intrinsic ]IEV½ZIWXYHIRXW[IRXSRXSQYWMG OB community. merit of music; and the striving for the conservatoires speaks volumes for his highest possible standards in classical MR¾YIRGIERHLMWPIKEG] Keith Budge

17 years at Bedales! longest stint alongside Keith Budge up the headship role. Ollo then at Bedales left 6.2 in July 2017. Ollo continued successfully through e believe that so far, the Catton joined Dunannie in September Dunannie, Dunhurst and Bedales, Wstudent to have served the 2001, the same year that Keith took and has now taken up a place to read Medicine at the University of Bristol. Ollo can claim to have matched Keith’s 17 years here on the Bedales estate as he also spent time at the Hive Nursery before Dunannie! The previous page shows Ollo and Keith outside Dunannie. Pictured below is Ollo’s cohort whilst at Dunnanie, and re-visiting the school last summer. Back row: Julia Brown, Jo Webbern, Catherine Claasen, Keith Budge, Eliza Denton, Polly Caines, Imi Gibbon, Molly Beardall, Michael Paterson, George Robson, Harry Green, Anastasia Sheldon, Ollo Catton. Front row: Tom and Mollie from Dunannie, Tessie Mitchell

Top row: Eliza Denton, Ellie Rodbert, Anastasia Sheldon, Polly Caines, Sebastian Bluestone, ?, Ollo Catton. Second row: Catherine Claasen, Christina Canter, Jacqui Uttley, Mike Atkinson. Third row: Michael Paterson, Sammy Marshall, Katrina Troth, Sarah Webster, Harry Green, George Robson, Jamie Brash, Max Johnson. Bottom Row: Alex Shields, Tessie Mitchell, Kitty Kennedy, Imi Gibbon, Molly Beardall, ?, ?

4ˆ,IEH´W6I¾IGXMSRWSR OB EVENTS – REVIEWS OF 2017

STEM Gathering – 28 February 2017

An enjoyable STEM drinks party for OB scientists took place in London at the Royal College of Surgeons. Also present were current and former Science and Mathematics teachers. This was the second in a series of social events which bring together Bedalians who share similar professions.

House of MinaLima – 21 March 2017

OBs, along with students, staff and parents, came together for a magical evening hosted by graphic designer Miraphora Mina (1978-85) and her business partner Eduardo Lima at the House of MinaLima in Soho. Guests were treated to private tours of the enchanting four storey Victorian townhouse, which showcases graphic art from the Harry Potter ½PQW[LMGL[EWGVIEXIHF]XLIHYS The MinaLima exhibition and Q&A session provided an illuminating insight into both the creative and technical aspects of graphic design. The evening raised more than £1,500 for the John Badley Foundation. Bristol Reunion – 9 March 2017

A group of sixteen OBs currently studying in and around Bristol met up at the Hotel du Vin to share their post-Bedales experiences. Between them they represented the universities of Bath, Bristol, and the West of England, together with the Bristol Old Vic Theatre School and the Royal Agricultural University in 'MVIRGIWXIV.SMRMRKXLIQJSVXLIIRNS]EFPIIZIRMRK[IVI%PYQRM3J½GIV4LMPMT 4EVWSRWERH9RMZIVWMX]0MEMWSR3J½GIV7EVEL3EOPI]8LI][IVIHIPMKLXIHXS get positive feedback from the OBs who have embarked on courses such as Agriculture, Chemistry, Engineering, English, History of Art, Law, Music and Physics.

OB Events – Reviews of 2017 • 5 OB EVENTS – REVIEWS OF 2017

Joe Pemberton Football Tournament – 8 April 2017 Beyond Bedales Higher Education and Careers Fair – 10 June 2017 A football tournament organised by Joe Pemberton (2008-13) raised £500 for Cancer Research UK. The OBs from the classes of 2014-16 kindly returned to WYGGIWWJYPERRYEPIZIRXJIEXYVIH½ZIXIEQWXLIGYVVIRX support current 6.1s at the Beyond Bedales Careers and Bedales XI, 2015 leavers, 2013 leavers, 2012 leavers and Higher Education Fair. Their experiences ranged from a staff team led by Head of Tennis, Graeme Coulter. studying at university, art or music colleges to internships, The tournament, which is in its third year, took the form work placements and gap years. The event is designed to of a round-robin and saw the 2013 leavers crowned the give 6.1s a better idea of life after Bedales and encourage victors. If you would like to put together a team for the discussions about university options and career paths. 2018 tournament (all ages welcome), please contact The students greatly enjoyed the event and felt more Philip Parsons ([email protected]). GSR½HIRXEFSYXXLIMVGLSMGIWKSMRKJSV[EVH

Oxford Reunion – 8 June 2017 who left Bedales back in the 1960s, right through to the recent class of A varied group of OBs met at Quod 2016. The range and variety of subjects Restaurant & Bar in Oxford for a reunion studied and subsequent careers was IZIRX*SVXLI½VWXXMQIRSXSRP][IVI impressive; not only did contemporaries those currently studying at Oxford enjoy meeting up but it was interesting universities invited, but also OBs living for older OBs to compare themselves and working locally. This included some with current undergraduates.

Visit from Ellie Nunn and Imogen Stubbs – 17 June 2017 and how to positively learn from failure. Ellie has kindly offered to come back to A very convivial and sunny lunch in the played in their lives. A key theme of talk with drama students in the future Art & Design building raised hundreds the talk was about teaching children and share tips on how to persevere in for the John Badley Foundation. The to seek what makes them truly happy a hugely competitive profession. lunch was kindly hosted by Ellie Nunn (2003-09) and mother Imogen Stubbs, both actresses, who spoke about their GEVIIVWERHXLIMR¾YIRGI&IHEPIWLEH

6 • OB Events – Reviews of 2017 OB EVENTS – REVIEWS OF 2017

10, 25 & 44/45-Year Reunions – 1 July 2017

The 10, 25 and 44/45-year reunions were well attended and the beautiful day saw the OBs in high spirits. The classes of 1972 and 1973 enjoyed lunch in the marquee on the Mem Pitch before the Bedales Association as a whole gathered for a drinks reception outside the Dining Hall. The classes of 1992 and 2007 then held their respective barbeques. Special thanks go to Sam Jukes-Adams (née Henham-Barrow, 1987-92), Sirio Quintavalle (1987-92), Zoe Graham (2002-07) and 'EVPSW7GLYWXIV (2002-07) for all their help with the reunion organisation.

OB Events – Reviews of 2017 • 7 OB EVENTS – REVIEWS OF 2017

Nick Gleed’s leaving concert – 1 July 2017

Several generations of Bedalians bade farewell to Director of Music, Nick Gleed, during the Summer Concert in which OBs, current students, staff and former staff came together for an impressive tour de force of ensemble playing and singing. Perhaps the most poignant moment of the evening was Published by Finzi (a former Bedalian melancholic, nostalgic undertone; Nick Gleed’s performance of Gerald parent) in the year of Nick’s birth, [SRHIVJYPP]½XXMRKJSVXEOMRKSRI´WPIEZI Finzi’s Eclogue for piano and strings. it evokes a pastoral idyll but with a of Bedales.

Bedales Association AGM and Drinks Reception – 12 July 2017

The Bedales Association hosted an evening gathering for OBs, former staff and former parents at the 1901 Arts Club in Waterloo. The event consisted of the Association’s 34th Annual General Meeting and a drinks reception. It will be taking place again in 2018 on Wednesday 11 July.

A Level Results Day – 17 August 2017

The class of 2017 gained university places at some of the most prestigious institutions in the world including Oxbridge, leading conservatoires, art colleges and medical schools. Three OBs celebrated Oxbridge places along with two 2016 leavers. Two OBs have secured places to study medicine. Five took up places at music conservatoires. One gained a place at the prestigious The Stansted Players – 24-27 August 2017 Northern School of Contemporary Dance. Five designers secured places The cherished institution, the Stansted Players, at renowned universities. Five other offered its 27th annual production in the OBs have moved to study abroad in 3PMZMIV8LIEXVI8LSQEW2SVXSR´W½ZIEGX the Netherlands, USA and Canada (see comedy Speed the Plough was produced as Destinations of Leavers on page 74). ever by Alastair Langlands (staff 1973-2001). The music was arranged by 2MGO+PIIH (staff 1990-2017) and lighting arranged by Janet Auty (staff 1991-2015). OB performers included (SQMRMG%WLXSR, Sam Bibby, Olivia Brett, Serena Brett, Christy Calloway Gale, 0YG]'SEXIW, Tom Kingsley Jones,6IFIGGE Langlands,+ISVKI7MRGPEMV, Flo Robson, Jordan Theis, James Thomas,-QSKIR;IPGL and Alex Yetman.

8 • OB Events – Reviews of 2017 OB EVENTS – REVIEWS OF 2017

Visit from Mike Sadler – Bedales v OBs Football – minutes of the match. History would 19 September 2017 9 September 2017 suggest that at this stage, OB strength and experience – led by .EGO(IERI Mike Sadler (1933-37), founding It took the drama of a penalty shoot (2004-09) – would see them close member of the SAS and now aged 98, out to determine who would have the out the game. Bedales had different returned to Bedales with friend and honour of claiming the trophy in the plans as they drew the game at fellow former military colleague Mark Bedales Boys’ 1st XI v Old Bedalians RSVQEPXMQIERHWIXYTEKVIEX½REPI Hanson (1977-84). Mike entertained a annual football match. Bedales took In one of the closest games in years, small group with reminiscences – from a slightly unexpected 2-0 lead but it was Bedales who won the penalty his time at school, through his initial EWTMVMXIH½KLXFEGOJVSQXLI3&W shootout 4-3. Jack has vowed to contact with the founding members of saw a change of fortunes and they VIQEMRMRTSWXJSV±SRIQSVI]IEV² the SAS, to tales of his escapades in the took a 3-2 advantage into the last 15 to redress the balance of power. Second World War, and the expedition to the Antarctic he undertook following his war service. The group [EWIWTIGMEPP]½\EXIHF]XLIEGGSYRX of his famous 100 mile, four day walk, whilst a navigator with the Long Range Desert Group, with only a goatskin tied together with bootlaces as a water container. When asked what he misses most about those days he says ±WSQER]MRXIVIWXMRKTISTPI²

OB Careers Talk – 22 September 2017 50-Year Reunion – 24 September 2017 A group of OBs from the class The class of 1967 returned to Bedales for their 50-year reunion which coincided of 2007 made a special visit to with the school’s Badley Celebration Weekend. They enjoyed a music performance talk to 6.2 students about their in the Library, lunch outside the Dining Hall and tours by 6.2s. studies and careers since leaving Bedales. Many thanks to the group, which included an Art Director in an avant garde theatre company (2EXEWLE,EZIPSGO), a solicitor specialising in sport (Billy Jenks), a Chinese and Management graduate now working in renewable energy (.EQMI1G-ZSV), a rising star in a global digital company (Rhiannon Taylor) and a Biomedical Science PhD graduate now in management consultancy ('EVPSW7GLYWXIV).

OB Events – Reviews of 2017 • 9 OB EVENTS – REVIEWS OF 2017

Great South Run – 22 October 2017

A team of 34 Bedales runners entered the Great South Run and raised an impressive £8,000 for two charities. As well as pupils, staff and parents, four OBs took part in the race: Georgie Deane (2006-14), 0YG].SLRWSR  , Lizzie Reynolds (2010-14) and Albie Waterton (2012-14). Funds were raised for Cecily’s Fund (see page 45) which was set up in memory of 'IGMP])EWX[SSH  and the John Badley *SYRHEXMSR%PFMI[EWEFIRI½GMEV]SJE.&*FYVWEV]LMQWIPJ ERHWEMHLI±RIZIVQMWWIWERSTTSVXYRMX]XSKMZIFEGO²8LI team was sponsored by fundraising platform Pledgit, founded by Billy Jenks (2002-07), and the Country House Company. Bedales will be entering a team for the event again this year on Sunday 21 October 2018 and encourages OBs to enter (contact Rob Reynolds: [email protected]).

Visit from John Ridding – 14 November 2017

John Ridding (1978-83), CEO of the Financial Times group, gave a Civics talk about news in the era of upheaval. Alongside quality news and its cost, he spoke to fascinated students about the prevalence of fake news, which has always been there, but is now systematic and operating at scale.

Visit from Joanna Hardy – to the fascinating world of the 1 November 2017 ‘King of Gems’. Using pictures of her research travels to illustrate her Renowned author and BBC Antiques talk, Joanna took the audience on a Roadshow jewellery specialist, journey along the harsh terrain of Joanna Hardy (1974-78) delivered the silk trading routes of China, to a fundraising lecture for current and the most exciting recent ruby deposit former students, staff and parents. discovered, in Mozambique. The Fresh from launching her new book, proceeds from the event went to Ruby, Joanna introduced the audience the John Badley Foundation.

Manchester Reunion – 30 November 2017

A reunion was held in Manchester, a popular choice for Bedalians, particularly SZIVXLITEWXX[S]IEVW)MKLX3&WMRXLIMV½VWXERHWIGSRH]IEVWEX Manchester were joined by two more from Leeds and three Bedales teachers. They had an enjoyable evening of food and drink. Subjects being studied included Music, Middle Eastern Studies, History and Politics, Three-Dimensional Design and Philosophy, and there was general agreement that Manchester and Leeds were great places to live and work in.

10 • OB Events – Reviews of 2017 OB EVENTS – REVIEWS OF 2017

the ceremony by Nick Adams were read out: “The idea of contributing something to Bedales sprang from our ½JXMIXLVIYRMSRPEWXEYXYQR8LIVI[EW among the group a generous affection, and a warm energy that impelled us to look for some way to leave a lasting memory of the occasion. The tree is for ourselves, for those classmates who could not be here, and for the school that brought us together. On visits to Bedales we will GSQIXS½RHSYVXVIIVIQIQFIVMRK one another and our precious time here. Fifty years from now the tree will be in its early maturity, as we were when we were here as students. Class of ‘66 Oak Tree Planting Ceremony For coming generations this tree will represent the connection of the class ore than 40 OBs who left Bedales by the tree. Raising the money was of 1966 to one another, to the school, Min 1966 held a 50-year reunion the easy bit, and within a few months ERHXSREXYVI²8LIKVSYTWLS[RMR during Badley Weekend in September we had more than £700 in the kitty. the photo then adjourned to the 2016. This was a one-off special reunion The next thing was to choose a tree Harrow for an excellent lunch. in that the idea for the gathering and WTIGMIW8LMW[EWEFMXQSVIHMJ½GYPX For anyone attempting something much of the organisation was done but guided by the school we settled similar in future it is a surprisingly by Johnny Robinson (1960-66) ably on a twelve year old oak (Quercus rewarding exercise, but allow plenty assisted by the school. The reunion, robur) sapling. Agreeing on the of time – at least six months from was great fun, and during the day wording was more time consuming WXEVXXS½RMWL%PWSFITVITEVIHXS 2MGO%HEQW  suggested but eventually there was a consensus make decisions, after giving folk a that the class should celebrate the on ‘A Gift from the Class of 66, on deadline to consider things like the occasion, their time at Bedales, and as the occasion of their 50-year reunion’. kind of tree to plant or any related a memento for those no longer with 8LIRI\XXEWO[EWXS½RHEWMXIERH wording. Bedales staff will give you us, by planting a tree in the grounds. after some serious consideration a lots of help. %W-PMZIMR4IXIVW½IPHERHEQE ½RIWMXIRIEVXLIWERHTMXSZIVPSSOMRK There were nine OBs present, member of the Bedales Association the new football pitches to the south together with three partners. The Steering Group (the alumni of Steephurst was chosen. OBs were: Alison Ball, Charles Bevan, committee), I volunteered to follow On a glorious Sunday in May, nine Jessica Bridges (French), Judy Daniel up on the proposal, which was of us from the Class of 66 attended (Lovell), Christopher Irwin, Gail warmly endorsed by Bedales. I started the planting ceremony joined by Keith Newton (Engert), Simon Laughlin, by sending round emails asking for Budge, Rob Reynolds, Andrew Martin Marcus Olliff, and Hugh Russell. donations, and suggestions for the and James Lathwell from the school. wording on the plaque to be placed Some simple words prepared for Charles Bevan (1961-66)

BEDALES ASSOCIATION AGM & DRINKS RECEPTION 2SXMGIMWLIVIF]KMZIRSJXLIXL%RRYEP+IRIVEP1IIXMRKSJXLI&IHEPIW%WWSGMEXMSRXSFILIPHEXXLI1901 Arts Club on Wednesday 11 July 2018 at 6.30pm8LIIZIRMRKKEXLIVMRKJSV3&WJSVQIVWXEJJERHJSVQIVTEVIRXW[MPPGSRWMWX SJEHVMROWVIGITXMSRERHXLI%+1 4PIEWIGSR½VQ]SYVEXXIRHERGI[MXL0IERE7IVMEY PWIVMEY$FIHEPIWSVKYO *YVXLIVMRJSVQEXMSR[MPPFIWIRXZME IQEMPMRHYIGSYVWI-J]SYGYVVIRXP]HSRSXVIGIMZIIQEMPWJVSQ&IHEPIWTPIEWIGSRXEGX0IEREXSFIEHHIHXSXLI distribution list.

OB Events – Reviews of 2017 • 11 OB EVENTS – REVIEWS OF 2017

and is still much involved with them Birthday Party – now we are 70! ERH½ZIKVERHGLMPHVIR7LILEWHSRI all sorts of work to keep the wolf t is not something that would have been easy to imagine in the early 60s from the door, with wood and glass, Iwhen we were new to Bedales. Yet, we found ourselves face to face over with old people and antiques, in ½JX]]IEVWPEXIVEXETEVX]JSVXLI'PEWWSJ8LIJEGIXLEX]SY´VIPSSOMRK libraries and with architects, in school at looks older to begin with, but then the years drop away. What produces and in gardens, and as an Alexander the dropping away is hard to pin down. It might be a way of conversing, or it teacher. She is currently teaching might be a way of standing. It’s perceptible, fairly sudden, and depends on the herself the clarinet. person you’re talking to. About half of our Block turned up at the afternoon party organised by .IVIQ]%QFEGLI  and Robin Walesby (1959-64), Deirdre Parrinder (1957-65) has been at Robin and wife Romayne’s home in June. We enjoyed reminiscing over old an Acupuncturist for 30 years. She is photographs and a race card for Le Mans. It was most wonderfully relaxed, currently working in a GP surgery and not frightening at all. [MXLXSVXYVIERHXVEJ½GOMRKWYVZMZSVW She has a child of 23. John Cox (1963-65) Viv Peto (née Soper, 1959-63) was as a Health Researcher at Oxford University A few lines about some of the attendees: 8MQ,YXGLMRWSR  has looking at issues to do with quality of [SVOIHMRXLI½PQMRHYWXV]EWER life in Parkinson’s disease. Recently did .IQ%QFEGLI  is retired Art Director and Production Designer a Fine Art degree and now puts her from a career in social work. He is now since 1965, also occasionally teaching creative ideas into local community Labour Councillor for Wandsworth EX½PQWGLSSPW projects. She lives in Oxford near her Council and Opposition Speaker for three children, six grand-children, and Education and Children’s Services. Jane Hyland (1960-64) was principal one great-grand child. He helps care for six grandchildren and cellist in the National Orchestra of still plays a canny game of tennis. Wales and in the Staatstheater Kassel, Robin Walesby (1959-64) was a Germany. She then played in the BBC Cardiothoracic Surgeon at the Royal Judith Barber (1957-65) was with the Symphony Orchestra before becoming Free and University College London *SVIMKRERH'SQQSR[IEPXL3J½GIJSV freelance and is now combining teaching Hospital. He and his Anaesthetist wife 30 years. Postings included Northern and playing in various ensembles. of 44 years, Romayne, are now retired Ireland (on secondment) in 1972, and travel between London, Sydney Dar es Salaam, Rome and Paris. She ;IRH]2MGLSPPW RqI,SYKL and Trinidad biannually to visit their was awarded an MBE in 1984. She has been a single parent to three boys, three sons and four grandchildren. spent 11 years as Fellowship Manager at the Winston Churchill Memorial Trust followed by seven years on the WCMT Advisory Council. She is now retired and living in Battersea.

John Cox (1963-65) was pleased to ½RHETLSXSSJXLITEMRXIHGIMPMRKMR the Prefects’ Library (now painted over) and continues as a painter of sorts and particularly of star maps.

Charles Hattersley (1959-64) worked for Geophysical Surveys International, Pye, Philips, then Tyco in sales and marketing. Retired in 2010. He and Breda have two girls, Corinna & Alicia Tom Hilton (1961-63), Geoffrey Winnicott (1959-64), Martin Farrell (1960-65), Judith Barber (1959-65) and a granddaughter, Willow. and Jackie Roelen (née Reid, 1959-65)

12 • OB Events – Reviews of 2017 UPCOMING REUNIONS

LMW]IEVXLIXLVIIWYQQIVVIYRMSRW[MPPFIXEOMRKTPEGISR4EVIRXW´(E]7EXYVHE].YRI%PPXLIYWYEPIZIRXWERH Tentertainments will be available.

Class of 2008 Reunion Class of 1978 Reunion The 10 year reunion for the class of 2008 will start late afternoon and conclude The 40 year reunion for the class of with a Block Barbecue Party by the Cricket Pavillion. 1978 will start late morning and Invitations have been sent out. If you should have received one but did not, conclude with a lunch in the marquee please get in touch with Minty or Ollie: by the Cricket Pavilion. Invitations have been sent out. If you 1MRX]2MGLSPWSR 3PPMI;EXIVLSYWI should have received one but did not, [email protected] [email protected] please get in touch with Leana: 07940 657 287 07753 313 592 Leana Seriau [email protected] 01730 711 572

Past Parents’ Lunch The Bedales Association Past Parents’ Lunch Party will take place at 12.30pm in the marquee overlooking the Mem Pitch. Please join us for this informal social gathering to meet up with Class of 1993 Reunion fellow former parents. Old Bedalian The 25 year reunion for the class of 1993 will start late afternoon and conclude sons and daughters are very welcome. with a Block Barbecue Party in and around the Sotherington Barn. We would be most grateful if you Invitations have been sent out. If you should have received one but did not, could advise whether you can come please get in touch with Chloe or Paul: by contacting Mary: 'LPSI3KMPZMI RqI+YXLVMI  4EYP-WEEG 1EV],ERGS\ [email protected] [email protected] [email protected] 07342 200759 07725 509 918 01730 711 695

PARENTS’ DAY 2018 Saturday 30 June %PPQIQFIVWSJXLI&IHEPIW%WWSGMEXMSREVI[IPGSQI Q Exhibitions Q Afternoon Tea Q Concert in the Quad Q Dance & Drama performance Q Bedales Association Drinks Reception Q Performance by Gyles Brandreth (1961-66) 4PIEWIVIWIVZIXMGOIXW[IPPMREHZERGIJSVGSRGIVXERH TIVJSVQERGIWXSEZSMHHMWETTSMRXQIRX*VIIXMGOIXW available from our website (www.bedales.org.uk/events) SVXLI8MGOIX7SYVGI&S\3J½GI (£1.50 telephone booking fee applies).

Upcoming Reunions • 13 A YEAR AT BEDALES %WIPIGXMSRSJWXSVMIWJVSQXLIWGLSSP´W[IIOP]FYPPIXMRXSKMZIE¾EZSYVSJPMJIEX&IHEPIWMR

January – Entrepreneur visits Bedales By Tom Reynolds, 6.2, Business Studies Don Co-founder of Pret A Manger, Sinclair Beecham MBE, came to talk to us as part of the Civics programme. Sinclair helped shed light on the world of business to many of the Economics and Business Studies students. It was interesting hearing about his relationship with co-founder Julian Metcalfe and their earlier business ventures. I was impressed by Sinclair’s relaxed style, which prompted lots of questions from the audience ranging from his favourite Pret dish to their food preparation process and pricing structure. Some of us were lucky enough to carry on the conversation with Sinclair at a dinner hosted by Keith and Moony Budge where he took more questions from many of the Economics March – “Most successful yet” Bedales Dance Performs students, offering more insight into his business style: a By Anastasia Sheldon, 6.2, Dance Don conviction-driven and customer-focused approach. Many Dancers across all the year groups came together to perform thanks to Sinclair Beecham for such a compelling talk. an evening of eclectic dance pieces at our most successful &IHEPIW(ERGI4IVJSVQW]IX8LI&PSGOWQEHIXLIMV½VWX Bedales Assessed Course appearance with Hunted, showing February – Swiss snow, physics and protons animalistic movement intertwined with energetic throws By Winnie Guo and Harry Green, 6.2 and lifts, showing real control and trust in each other. Block 5s choreographed their very own solos based on iconic choreography and group pieces inspired by topics they are studying across other subjects in school. Some of the dance pieces were examined that evening and a huge well done to everyone who was being moderated. As for 6.1 and 6.2 dance students, we performed our own solos and group pieces in preparation for our exam in a few weeks, using students across all ages and some students that do not even study dance. The show closed with the 6.1 and 6.2 Enrichment piece Shattered Minds.

April – Leap of faith for Student Directed Performances By Holly Stevens, 6.2 The 6.2 physicists made a trip to Geneva, Switzerland. The Student Directed Performances offered us a privileged ;IZMWMXIHXLI,MWXSV]SJ7GMIRGI1YWIYQSRXLI½VWX opportunity to work with a dedicated cast to create and day which was on the frozen icy banks of Lake Geneva. perform scripts that particularly inspired us, either through Saturday was spent at CERN, the European Organisation for Nuclear Research where they operate the largest particle physics laboratory in the world and focus on research in fundamental physics. We visited various departments in CERN and got a chance to talk to the researchers. The excellent displays and presentations were very helpful for understanding the principles behind the processes used to recreate the conditions just moments after the ‘Big Bang’ and generate and detect exotic particles including the elusive Higgs Boson. The many stages of accelerator feeding the Large Hadron Collider took protons to 99.999% of the speed of light before colliding them head-on.

14 • A Year at Bedales A YEAR AT BEDALES

reading or writing them. It was a long process that involved June – Bedales elects: the results commitment, perseverance and devotion and we’re lucky to By Jonathan Selby, Head of Government & Politics have had the faithful cast members we had. Jesse Goring and Just before the election, Bedales held its own version of the Jamie Murphy, who both wrote and then directed their plays general election. Previous Bedales mock elections (2010 and Something that Happened and Leap Of, worked increasingly 2015) have seen the Conservatives romp home but Saul LEVHXS½RMWLXLIMVWGVMTXWMRXMQIJSVFSXLVILIEVWEPERH Barrett won this election with a powerful and well-informed performance. Jesse’s play spatially explored the dynamics speech for Labour. James Grout-Smith spoke more quietly of setting a performance simultaneously in both the past for the Conservatives and Stephen Wu spoke amusingly and present while Jamie’s short but intriguing piece, of a for the Liberal Democrats. Will Morrison spoke well, at KMVPGSRZMRGIHWLIGSYPH¾]OITXERMRXIRWIXIRWMSR[MXL very short notice, for the Green Party and Arthur Lingham every nerve-wracking jump from the scaffolding. Speaking offered himself as an Independent candidate with a radical in Tongues, a play written by Andrew Bovell and directed by programme. Unlike the medieval pencil and paper version of myself, explored a complex script composed of nine separate the real election, Bedales opted for electronic voting set up PMZIWMRXIVPSGOIHF]JSYVMR½HIPMXMIWSRIQMWWMRKTIVWSRERH by Rick Cross. The Chairman suggested that voting was one a mysterious stiletto. way of responding to the recent terrorist attacks, ensuring by voting that we would not be governed by terrorism even if our lives continued to be disrupted by it. The outcome May – Dogtastic result saw Labour win but without an overall majority, Liberal By Mariangela Franchetti, Chair of Bedales Parents’ Association Democrats a close second and Conservatives a healthy third. Fundraising +VIIRERH-RHITIRHIRXGEQIJSYVXLERH½JXLVIWTIGXMZIP] but were by no means disgraced. All the candidates were well-informed and presented a cogent and cohesive case as well as raising interest in what turned out to be a fascinating election. It made for an engaging and informative evening.

July – Bedales announces new Head The Board of Governors at Bedales School has announced its new head will be Magnus Bashaarat, currently head The sun shone for the ‘Badley Behaved’ Dog Show and Fête, of Milton Abbey School. heralding a glorious afternoon of family fun. More than 80 This announcement dogs had a very social afternoon, were beautifully ‘Badley follows the news earlier behaved’ and were the stars of the show. Hundreds of this year that Keith visitors enjoyed the cream tea tent, BBQ, bar and of course Budge had decided many congratulations goes to all the winners of dog classes, to step down after the scurries, obstacle course, the 11-legged race and fête 17 years as Bedales activities. We are thrilled to announce that an incredible head in summer 2018. £4,528 was raised for the John Badley Foundation, which Before becoming head provides life changing opportunities for talented students of Milton Abbey in 2014, Magnus was previously deputy head through full bursaries. The event was the epitome of ‘work of at Stowe and a housemaster at Eton. He read English at the each for weal of all’. A huge thank you to all who came, with University of Edinburgh. Bedales Chairman of Governors, and without dogs, our band of volunteers, 1EXXLI[6MGI 1EXXLI[6MGI, welcomed the appointment: “I believe Magnus (1975-80) for commentating on all the action (and for so will continue the liberal, progressive and innovative tradition kindly donating dog show trophies and mugs), to our judges of Bedales whilst maintaining the rigorous standards we – professional gundog trainer Sarah Miles and vet, Jonathan expect of our students. Magnus is interesting and energetic Harwood, and to Animal Crackers pet shop and Hampshire and, together with his wife Camilla, will be a wonderful Search and Rescue dogs. EHHMXMSRXSXLI&IHEPIWGSQQYRMX]²1EKRYWGSQQIRXIH “I am looking forward to joining Bedales and developing

A Year at Bedales • 15 A YEAR AT BEDALES

the school’s impressive contribution to education. It will be personal experience and opinions on each subject. As a a privilege to build on Keith’s rich legacy and to lead John group we collectively agreed that the book concerned solely &EHPI]´WMRWTMVMRKZMWMSRJSVIHYGEXMRK]SYRKTISTPI²1EKRYW middle class white educated women and was very much a will take up the Bedales headship in September 2018. product of its time, yet Friedan spoke about issues that are still prevalent in modern day society. At certain points, we did digress from the topics in the book and addressed our own August – ‘Lest We Forget’ concerns about sexism and the notion of feminism. We shall By Ruth Whiting (Head of History 1963-2000) regroup again just before Christmas after reading our next As part of the Commonwealth War Graves Commission book which is from Nigeria. The group is also very eager to ‘Lest We Forget’ campaign, Bedales has been publishing on the assert that all genders are welcome. school website details of all the Bedalians who died in the First World War on the centenaries of their deaths. Here’s an extract of one example published in August. The school is extremely October – What is Good? grateful to Ruth Whiting for her extensive research work. By Clare Jarmy, Head of Philosophy, Religion and Ethics Harry Mettam Procter 04/03/1855-27/08/1917. Bedales 1909-1912, Captain 1st Battalion (Attached 9th Batt.) West Yorkshire Regiment (Prince of Wales’s Own). Harry was the second son of Charles Webster Procter and his wife Elizabeth Anne née Rice….On 1st December 1911 the Chronicle Editor Vyv Trubshawe proudly announced XLEXJSVXLI½VWXXMQIXLIQEKE^MRIGSRXEMRIHMPPYWXVEXMSRW undertaken at great speed by two Bedalians. “I must thank them both (H M Procter and F Best) most heartily for the trouble they have taken and especially for their kindness MRTVIWIRXMRKXLIFPSGOW²LI[VSXI,EVV]LEHTVSHYGIH a cartoon drawing of Bedalians decorating the Great Hall for Christmas at risk to life and limb. Vyv commented, “Our Bedales was very lucky to welcome Professor Simon well-known comic artist, Mr. Harry Procter, here depicts a Blackburn to speak on the subject ‘What is Good?’ in the QSWX±VS]EPERHERGMIRX²GYWXSQ,IJIPX¯ERHUYMXIVMKLXP] Lupton Hall on 11 October. Mainly aimed at the Sixth Form, too – that the girls would be protected under the tables, safe Bedales Philosophy, Religion and Ethics A Level students from the falling bodies and suchlike dangers. The hardened were joined by around 70 students from Churcher’s College, WYJJVEKIXXIWLS[IZIVLEZIHEVIHXSWEPP]JSVXL²©-R Alton College and Queen Mary’s College. Simon Blackburn, Harry returned home from Art School in London (Stratford Emeritus Professor of Philosophy at Cambridge University, Studios) for the summer holidays, spending time with friends started with a very contemporary dilemma. On the one and family including his cousin Jack Procter, his uncle John’s hand, it is hard to say that ‘good’ or ‘evil’ are part of the world youngest son. On 21st August, two and a half weeks after in the same way that dogs, chairs and pizzas are part of the war had been declared, Harry and John enlisted as privates world (as GE Moore would say, this is to make something MRXLI;IWX=SVOWLMVI6IKMQIRXERHWTIRXXLIMV½VWXRMKLXEW non-natural into something natural: a naturalistic fallacy), recruits together. Read more at: www.bedales.org.uk/home/ yet, don’t we also want to say that there are things that are history-bedales/ww1 good, and things that are evil? Many students are faced with the dilemma that perhaps in ethics, it is all just subjective: just a matter of taste. On the other hand, we also feel September – New book club focuses on feminism passionately about ethical issues. Students want to convince By Orla Flint, 6.1 others about the morality of veganism, or the immorality of 8LI*IQMRMWX&SSO'PYFLEHMXW½VWXQIIXMRKMRXLI factory conditions in less developed economies. No problem, Steephurst common room, hosted by Emily Seeber. Whilst Blackburn says. We can meaningfully talk ethically, even if we enjoying lovely cupcakes, crisps and hummus, we discussed are dubious about ethical ‘facts’. Look to the practice, he says: multiple issues concerning our current book: The Feminine what would someone with practical wisdom, someone who Mystique by Betty Friedan. Subjects such as sexist education is good at ‘acting well’, do? After a great talk, there were some systems, modern paternal roles and outdated societal excellent questions, and some meaningful discussion. conventions arose and the group discussed their own

16 • A Year at Bedales A YEAR AT BEDALES

November – From Bach to Funk: the Cecilia Concert local luxury childrenswear brand No Added Sugar, students By Eloise Evans, 6.2, Music Don TVIWIRXIHPMRIYTWSJWM\SYX½XWXSXLIGSQTER]JSYRHIV Deborah Medhurst and her team. Students from across the two schools have joined forces to produce a range of innovative childrenswear designs. No Added Sugar visited Bedales and launched the project by introducing the brief and setting the theme of ‘the wonder of you’ for pupils to interpret. Students were given the opportunity to receive feedback from the team to help focus their designs, ensuring they met the brand’s ethos and edgy style. Through hand and digital rendering, pupils produced innovative print and silhouette ideas based on how children see the world. This year’s St Cecilia Concert was full of a variety of different genres, and instruments. Involving Block 3 all the way through to 6.2, it was a concert for all ages. Beginning with Marches, [VMXXIRF].47SYWEERHEVVERKIHWTIGM½GEPP]JSVXLIWGLSSP´W concert band, the evening certainly got off to a triumphant start. The concert was full of excitement and rather interesting and different arrangements of the more traditional pieces. Take for example the cello ensemble which played an arrangement of JS Bach’s Jesus bleibet meine Freude for seven cellos and a double bass. The unique and inspiring pieces did not stop there; the percussion band played an arrangement of Under the Sea from The Little Mermaid, and in the second half the breath-taking choir and barbershop both showed the power and strength of the human voice. To end the concert, the RI[P]JSVQIH.E^^&ERHTPE]IHWSQISPHGPEWWMGWERH½RMWLIH Our pupils have gained a valuable insight into industry practice with Baby It’s Cold Outside[LMGLHI½RMXIP]KSXIZIV]SRIMRXS whilst sharing ideas and learning how to work in partnership. the spirt of Christmas! The concert was in aid of Cecily’s Fund. Many congratulations to Rufus Seagrim, 6.1 and Paige Winstone, Group 1 and to Carraic O’Donnell 6.1 and Pendle 0MZIWI]+VSYT[LSLEZIFIIRMHIRXM½IHEWHIWMKRMRK December – Collaborative project with added ‘wonder’ the most effective collections, winning internships to work By Louise Fellingham, Teacher of Design with No Added Sugar in the new year. Sincerest thanks to As an exciting conclusion to our collaborative project between Deborah for enabling such a unique and stimulating learning 6.1 Fashion students, Group 1 pupils from Dunhurst, and the experience for our students.

A Year at Bedales • 17 PROFESSIONAL GUIDANCE FOR BEDALIANS

he higher education (HE) and now elects to study at European ½VQMRXLIMVYRMZIVWMX]TVIJIVIRGIWXS Tcareers landscape for school leavers universities, and we expect this to grow. consider a post-A Level application GERFIGSQTPI\ERH¾YMH [LMPWXJSV Applying to overseas universities can tied in with a gap year. It removes at some the choices are straightforward, be complex and time-consuming, as is least some of the uncertainty from the for others they may be less so. Through the associated business of identifying process for them, and we see it more the Bedales Professional Guidance and and pursuing international funding and more – hence our commitment Alumni Liaison teams, the school offers opportunities. to offering help to recent leavers with a range of approaches – not only for The choices available to our leavers UCAS applications and access to the current students, but also for those GERFIHMJ½GYPXERHRSXSRP]GSZIV network of OBs. who have recently left the school and further study but also employment, with The role of OBs in talking about deferred a decision regarding university the increased emphasis by government their experiences with students and and course choices. Old Bedalians and employers on apprenticeships. recent ex-students can be invaluable can also play a crucial role in helping These look to be an excellent option – especially for those struggling to students make good decisions about for some of our students who know make a choice. Old Bedalians tend to their further study and careers. what they want to do and more and be an adventurous bunch – ambitious, Bedales offers a well-resourced, more are thinking about it. For course imaginative and willing to tear up the highly-structured and regularly options, we might steer students script when it seems appropriate to do reviewed HE pathway to sixth form towards facilitating subjects – those so. We are always keen to recruit more WXYHIRXWMRGPYHMRKHMWGYWWMSRTVS½PMRK XLEXYRMZIVWMXMIWLEZIMHIRXM½IHEW OBs to this end, so please do get in interviews and the Beyond Bedales having admissions currency across a touch if you would like to be involved. Fair, which sees mainly undergraduate range of courses. Alternatively, overseas It isn’t a big commitment, and our alumni return and discuss with current universities can be less demanding in GYVVIRXZSPYRXIIVW[MPPGSR½VQXLEXMX students their various career interests, terms of grade requirements, and be can be fun and rewarding. courses, institutions and trajectories. more wedded to a generalist ‘liberal Each department regularly visits EVXW´ETTVSEGL1SVIWTIGM½GEPP][I Vikki Alderson-Smart universities to keep up to date with may encourage those who are less than Head of Professional Guidance what they are offering and what they require from our students. For example, there has been a recent trend for university applicants to be admitted on lower grades than those expressed in offers. This is a consequence of universities’ recent expansion, fewer students coming to UK universities from abroad and everyone getting used to the ‘new normal’ in terms of linear A Level grades. Accordingly, we have advised students to ‘stretch’ their applications, and to be aware of incentives on offer from some universities to those applicants making XLIQXLIMV½VWXGLSMGI Also, there has been a rise in interest amongst Bedales students in studying in the US and Canada – whereas it used to be the case that one or two each year would take up that option, many now consider it. A steady trickle of students

-J]SY[SYPHPMOIXSSJJIVGEVIIVWYTTSVXXS&IHEPIW7M\XL*SVQWXYHIRXWERHVIGIRXPIEZIVWTPIEWIKIXMRXSYGL[MXL Leana Seriau, Alumni Liaison Manager; [email protected].

18 • Professional Guidance for Bedalians PROFESSIONAL GUIDANCE FOR BEDALIANS

hen she left Bedales in 2014, She wanted to study abroad, but on applications and reassurance, with W'LEVPMI6MHHMGO  quickly found that courses tended to the consequence that Charlie is now was adamant that she didn’t want be at Masters level. However, Vikki studying for an undergraduate degree to just fall into higher education. Alderson-Smart and Sarah Oakley, in Ecology and Wildlife Conservation Rather, she was keen to get to of the Bedales Professional Guidance at Bournemouth University, her work in Ecological Conservation, team, were on-hand to provide advice preferred choice. a passion that had grown steadily whilst she was at school. Charlie travelled with friends to the Far East, and whilst there became involved in a marine conservation project, whetting her appetite for more. She then headed to Brazil where she helped set up a non-governmental organisation providing tennis coaching for deprived children, from scratch. Since leaving Bedales, Charlie had completed an online course in Marine Biology, but it occurred to her over time that if she were to TVSKVIWWMRLIVGLSWIR½IPHXLIR she would need a degree. More MQTSVXERXMRLIVHIGMWMSRXS½RHE course, however, was the discovery of a renewed zest for learning – vital, she believes, for success in higher education. The trouble was that she didn’t know where to start.

Professional Guidance for Bedalians • 19 THE RETURN OF THE LUPTON HALL

remarkable buildings for Bedales on its new Hampshire site. It would be by far Gimson’s most important architectural commission. The scheme which Gimson drew up was for a brick quadrangle, like an Oxford college, with the Library and Lupton Hall forming the east range. First to be built was the Hall, designed for music, theatre and assemblies, in 1911. Gimson died in 1919 and though the other three sides of the Quadrangle were never built, the Covered Way and 0MFVEV][IVI½RMWLIH[MXLXLI0MFVEV] as a memorial to Bedalians killed in the First World War. The hall that Geoffrey Lupton himself helped raise was a profoundly Bedalian stucture, and an antidote to the grandiose assembly halls of traditional 8LI0YTXSR,EPPEX&IHEPIWEVSYRHEW+MQWSRMRXIRHIHMXXSPSSO9RPMOIXVEHMXMSREPWGLSSPLEPPW public schools. Expressing John Badley’s there was no panelling or plasterwork or portaits of former headmasters egalitarian ideas about education and his belief in the importance of making any Bedalians returning to at school in recent times about the as well as thinking, the Lupton Hall Mthe school over the last few building and you would be surprised echoed the great agricultural barns of decades will have found it an unsettling by the response, ‘never heard of it’, the Middle Ages which Gimson adored experience. On the one hand it is ‘I don’t think I’ve ever been in there’, for their simplicity, splendour and familiar, the blue sign on Church Road, ‘is it part of the Library?’. When in the craftsmanship. A monumental cruck the barnyard, the brick path winding to mid-1990s the school got too big to frame of English oak forms the skeleton Steephurst, the smell of the wood in ½XMR[LSPIWGLSSPKEXLIVMRKWQSZIH of the building, while the walls and the cricket pavilion. But in other ways it to the Quad, while the building of the roof are of hand-made local brick is quite different: new teaching buildings Olivier theatre around the same time and tile. Gimson designed not just the in place of the old encampment of created a new venue for drama. As a WLIPPFYXXLI½\XYVIWFIRGLIWPMKLX prefab classrooms, unlovely retractable result the noble old Lupton Hall was ½XXMRKWERHWTIEOIV´WPIGXIVRGVIEXMRK seating in the Quad, and the mysterious abandoned, and so it has remained, EX&IHEPIWEVKYEFP]XLI½RIWX%VXWERH ½WLMRXLIHMXGLSRXLIFEGOHVMZI untouched and almost unused for Crafts assemblage in the whole country. seems to have gone (was it ever very nearly 30 years. I visited a few In 1954 the Library and Lupton Hall really there?). But no change has been years ago when helping the school were listed grade 1, putting them in QSVIFEJ¾MRKXSXLI3&XLERXLI select an architect for a new art and the top 2.5% of all listed buildings disappearance of the Lupton Hall. design building, and was shocked to see in England, particularly remarkable *SVEPQSWXEGIRXYV]XLMWQEKRM½GIRX the old place greying and sad. A plan given they were then little more than structure was the centre of Bedales. began to form to bring this spectacular a generation old. Morning notices, Sunday Jaws, assemblies, building back to life, a plan which this Over the decades that followed handshaking, patchy plays, lovely ]IEVLEW½REPP]GSQIXSJVYMXMSR the Lupton Hall was changed to suit concerts, hilarious sketch nights, all took The Lupton Hall was the brainchild the times in ways that eroded the place under its soaring cruck frame, of Geoffrey Lupton (1893-1901). After perfection of Gimson’s design. The the numbers of people skulking in trying, and then abandoning, the family Covered Way originally extended across the Sand Quarry measurable exactly IRKMRIIVMRK½VQ0YTXSRFIGEQIE the end of the Hall, leading to the by the inches of bench seating left student of the brilliant Arts and Crafts Library, but in 1967 a large rectangular empty every evening. The days and architect and furniture maker, Ernest opening was knocked through and weeks were punctuated by loitering Gimson. Inspired by this experience, at this section was incorporated into the in the Covered Way, trooping in and the age of just 24, Lupton provided the Lupton Hall to increase the space. squeezing up. But ask any of the kids funds for Gimson to create a series of Also in the mid-twentieth century

20 • The Return of the Lupton Hall THE RETURN OF THE LUPTON HALL

heavy green curtains (crowned by the never easily be – an IT room or science PMOIMXWSVMKMREPWTPIRHSYV%RH½REPP][I bee) were hung permanently to cloak lab – but to use it again for one of the wanted to make the spaces (including the stage for theatrical performances main functions for which it had been in the green rooms below and the 1950s and the great round window at the designed, musical performance. This brick extension to the west) as usable back of the stage was blacked out, would give the school’s brilliant music as possible by Bedalians. giving it the appearance that most of department, still operating from the After close study of the drawings us remember. warren of tiny rooms in the Music School, and photographs of the Lupton Hall Since the Lupton Hall fell out of EQEKRM½GIRXGSRGIVXLEPPERH[SYPH MRMXW½VWXHIGEHIW[ITYXXSKIXLIV regular use in the mid-1990s there not necessitate damaging or contentious our plans which were executed over have been various attempts to revive major changes to the building. the summer of 2017. As the school it, but without success. With its To work out how best to repair and now has a purpose-built theatre, the WXIITP]WPSTMRKWXEKIERH¾SSVXLI modify the Lupton Hall we approached stage curtains in the Lupton Hall are FYMPHMRKMWRSXE¾I\MFPISRI8LIVI 6MGLEVH+VMJ½XLWSRISJXLIGSYRXV]´W no longer needed, and so these have was a proposal a decade or so ago leading conservation architects and a been taken out enabling the large east to convert it into a ‘contemporary great admirer of Bedales’s Arts and window to be revealed and repaired library suite’ which was to include the Crafts buildings. Working with Richard and to become, as Gimson intended, MRWIVXMSRSJEQI^^ERMRI¾SSVEGVSWW and his colleague Kathryn Harris, and the focus of the building. The steep part of the hall. Some thought this was contractors R W Armstrong, we decided slope of the stage, which made concerts the answer. Personally I was appalled. that we should try and do three and talks really challenging, has been There was no question that a solution XLMRKW½VWXEHHVIWWEWIVMIWSJWIVMSYW removed by carefully dropping the was needed, but it was not this. Luckily maintenance and conservation issues back of the stage on its original joists that plan was shelved. which were long overdue. Second, to to sit almost level with the front. The new scheme which we devised remove from the hall the later changes At the rear, west, end we could not a year or so ago had a different starting which were no longer functionally reinstate the Covered Way without point. We were not going to try to turn necessary, and which would enable us making dramatic and very expensive the Lupton Hall into something it could to restore the building to something alterations, so instead we inserted

The Return of the Lupton Hall • 21 THE RETURN OF THE LUPTON HALL

brick arches into the stark rectangular room. Along the way major repairs not least from the students who have opening knocked through in the 1960s, were undertaken to the windows and been performing and the audiences allowing the main volume and what other original features, the building who have come to hear them. For was the Covered Way to be read as services were reorganised, the oak those who never realised it was there, distinct entities once again, and creating frame cleaned and the interior painted the Lupton Hall has been a revelation. EJS]IVEVIEMR[LMGLEPIZIP¾SSVLEW and given additional lighting. The To those of us who knew it well, been reinstated. The rotten and ugly scaffolding pole which had long served it feels like justice has at last been windows onto the Orchard, inserted as the handrail in the Covered Way done to this hallowed hall. A few in what had been unglazed openings, (how did it come to that?) has gone ½RMWLMRKXSYGLIWVIQEMRXSJSPPS[ have been removed and instead and a handsome iron replacement one of which will be the relocation new leaded windows, following the has taken its place. Meanwhile in the here of Stanley Spencer’s painting of language of the Library and the rest of Library repairs were undertaken and the interior of the Lupton Hall; its the Lupton Hall have been made and discrete wiring has brought power subject, as old hands will remember, installed. Under the stage the green sockets to the bays to allow laptops to A Music Lesson At Bedales. VSSQW[IVIVITEMVIHERHVI½XXIHEW FITPYKKIHMRXLIVIJSVXLI½VWXXMQI music practice rooms, and the 1950s The reactions to the revitalised Anna Keay (1987-92) extension converted into a seminar Lupton Hall have been wonderful, Bedales Governor

22 • The Return of the Lupton Hall MEMORIES OF INNES ‘GIGI’ MEO

wonder if there is anyone still with I us who would know anything of Gigi Meo’s (staff 1923-40) life before he joined the Bedales staff; what led him to apply? How fascinating it would have been to listen in to the interview he must have had with the chief! He served in the First World War and sometimes started his art lessons with a hair-raising account of some war-time exploit or narrow escape. He would then ask us to illustrate the scene, drawing in charcoal from imagination. It well suited some, especially the boys, but I and a few others would plead to draw the many possibilities the outside world offered. He would mostly agree and always ½RHYWPEXIVXSQEOILMWGSQQIRXW on our work. Gigi was a charismatic character. Under jutting bushy eyebrows, his deep-set eyes had a twinkle, sometimes a hint of mockery. He commanded respect and affection; many of us were devoted admirers. He was a not knowing anything of ‘real’ life. XSPERHMRXLI½IPHFIPS[-KSXSZIV ½RIHVEYKLXWQERERHQYGLSJLMW Perhaps to show us this ‘real’ life, he or through the hedge, found the ball teaching was by example. His drawing very occasionally took us to draw and got it back over the hedge. Instead [EWI\TVIWWMZIERH¾S[MRKJYPPSJ in the docklands of Portsmouth. We of returning myself, I went to the life’s rhythms; perhaps in the same didn’t think of anything but enjoying FSXXSQSJXLI½IPH[LIVI+MKMPMZIH tradition as Augustus John. a memorable day out with exciting in a cottage. I knocked on the door, He instilled in us the understanding scenes to work from. was welcomed and straight away given that drawing is fundamental to the I have an anecdote to tell which a plate of bacon and eggs, perfectly good development of talent. That it brings back to me a very strong cooked by Gigi. He then, without delay trains the eye to see, as well as to look. memory of him. It was a cricket dispatched me back to school. And that it develops the essential link afternoon. I was a passable bowler but There were no repercussions, the between the eyes, the mind and the a very inferior thrower, yet that time whole escapade was either ignored hand. I remember him saying “A good I was placed on the boundary. The ball or not noticed. It didn’t happen again; HVE[MRKERH]SY´ZIKSXMXMRXLIFEK² came; I threw as hard as I could, but I wouldn’t have dared! He sometimes teased our “sensitive instead of going wicket way, it went REXYVIW²F]GPEWWMRKYWEWTVMZMPIKIH backwards, over my head, over a hedge, 'LDQD$UP¼HOG  

DO COME AND VISIT BEDALES

edales students and staff love WGLSSP TPIEWIXLIVIJSVIGLIGOMR Bvisits from OBs so do please with Wendy Hudson or one of GSQIERHWIIYWXSGEXGLYTERH LIVGSPPIEKYIWEX6IGITXMSR[LS look around. As you are probably [MPPFILETT]XSWII]SYFEGOEX aware, we have a legal requirement Bedales. Thank you – we hope you to register all visitors to the will understand.

Memories of Innes ‘Gigi’ Meo • 23 SAYES COURT John Evelyn’s Garden in Deptford

Former dockyard (Copyright, Roo Angell)

½VWXEVVMZIHMR(ITXJSVHSZIV]IEVW from a puddle, the knighting of Sir friend Chris said “Oh Roo, you’re I ago, and immediately fell in love. Even Francis Drake, Kit Marlowe getting interested in landscape – there used in London, a city famous for its many stabbed in the eye: Deptford stories to be a historic garden over on the villages, I had never lived somewhere all. The Dockyard brought skills and an SXLIVWMHISJXLIWMXI²%UYMGO+SSKPI [MXLWYGLEHI½ERXERHMHMSW]RGVEXMG international population, which in turn later and I was looking at a beautiful sense of identity. Proud above all of its gave birth to that independent spirit and intricately detailed plan of a garden fearsome reputation (audible in local still smouldering in Deptford today. which I instantly recognised: from my team Millwall’s chant “No one likes us, In 2011 I arrived back in Deptford ½VWXPIGXYVIMRPERHWGETILMWXSV]3L [IHSR´XGEVI² (ITXJSVHLEHFIGSQI after a period away studying Landscape %RHWSFIKERETVSNIGX[LMGLEX½VWX overlooked whilst surrounding areas Architecture, and found some of my I naively thought might take six months prospered – famously Black Cabbies friends embroiled in a brewing planning – to preserve this piece of land as would refuse fares to Deptford, and battle: the 40-acre former Dockyard open space; six years later and we’re even the police left the rookeries was to be developed. The plans showed still very much in the early stages, as it down by the river to themselves. But XLIRS[YFMUYMXSYW±PY\YV]²XS[IVWERH has evolved and grown in scope and of course, the growing rapacity of dense blocks of a Shanghai-on-Thames, ambition far beyond those early ideas. London’s housing market couldn’t and locals were thunderstruck not The story as always was the hook, be kept at bay forever, and so this only at the loss of this key to the but so much of it remained to be told. is the story of how a long-vanished area’s character, but also the inevitable That plan of Sayes Court, drawn up garden drew on this Deptford spirit effects that this would have on the in 1653 by the celebrated diarist and to stand up to international property wider neighbourhood. They welcomed horticulturalist John Evelyn, marks developers: and won. the investment in the site which had a pivotal moment in English garden The true source of Deptford’s long lain dormant, but were convinced design and is discussed and analysed by pride is visible everywhere beneath that its rich history could inform that academics around the world – but its the surface grime of the streets and development in such a way as to make connection to a real place, and what buildings. It was here that Henry VIII it an asset, rather than a threat, to the happened next, had been forgotten. founded a Royal Dockyard in 1513 to future of this very precious place. Evelyn made his home at Sayes build ships for the nascent Royal Navy, As we were poring together over Court, pursuing his interest in what was and the town quickly grew in size and archive drawings of slipways and basins to become modern science and using importance. Sir Walter Raleigh laying (and I was doing my best not to show the garden as a subject of constant down his cloak to spare Elizabeth I they were leaving me a bit cold), my experiment and development – not

24 • Sayes Court SAYES COURT

least with the new and exotic species Sayes Court, such as his pamphlet on arriving by boat at the Dockyard planting trees to alleviate London’s next door. In 1660, Evelyn became smog; his vegetarian recipe book; his one of the founding members of the instrumental role (and hard cash) in Royal Society, and was commissioned setting up the Greenwich Hospital – XS[VMXIXLIMV½VWXTYFPMGEXMSRSylva, now a World Heritage Site. But gardens or a Discourse of Forest Trees was are ephemeral, and after his death commissioned by the Admiralty in in 1706 Sayes Court quickly went order to encourage the establishment into decline, his home became the of plantations (at a time when timber parish workhouse and was eventually was as essential as oil is today), but swallowed into the growing Dockyard. Evelyn’s text went far beyond its remit. This wasn’t the end however. In 1869 Including poetry, extracts from the the Dockyard closed, and Evelyn’s classics and country sayings, Evelyn descendant decided to buy back the gave characters to the oak, the ash, site of his ancestor’s famous garden. the hornbeam and Sylva became a 8LIHMJ½GYPXMIW[LMGLLIJEGIHMR John Evelyn (Copyright, National Portrait Gallery) bestseller earning him the accolade eventually creating a public park here today of being the father of the for the people of Deptford – in the A small piece of that park still modern sustainability movement. midst of overcrowded Victorian slums exists, but the remainder (along with There are too many stories to – were to inspire the foundation of the most important parts of Evelyn’s share here of Evelyn and his work at the National Trust. garden) now lie under concrete within the development site. But here was a piece of land which had twice stood up to the pressures of its age and twice inspired extraordinary responses. How could its legacy of planting in the city and access to open space play a role in the issues facing London in the 21st Century? Joining forces with other local groups criticising many aspects of the planning application, we became heady with early success when it was rejected by the Council. Next came the more complex task of devising a proposal. We were fortunate that the illustrious history of Sayes Court opened many doors, to those who were astonished that such an opportunity existed. We drew support from amenity bodies including the Gardens Trust and National Trust, academics from Harvard and the Royal Society, celebrities from the garden world and politicians including even a Secretary of State. At the same time we worked locally to understand the myth and potential of Sayes Court for Deptford people. Workshops with primary schools revealed surprising resonances; unsure whether garden history may be too esoteric a subject for inner-city children, we were sharply Sayes Court plan (Copyright, British Library) set right by one participant who told

Sayes Court • 25 SAYES COURT

Court are now at last under way, School workshop (Copyright, Roo Angell) after the completion of a successful crowdfunding campaign with backing from current Mayor, Sadiq Khan. Evelyn has been overlooked in recent years in favour of his more piquant friend, Pepys. And yet during the Great Fire of 1666, whilst Pepys was rushing home to bury his cheese, Evelyn went to see for himself the living horror as it continued to grow, and immediately set about drawing up plans for a renewed London whose citizens could live in safety, health and beautiful surroundings. In this age of botched Universal Credit, Paradise Papers and, yes, the paranoia and apathy around Brexit, perhaps we have something to learn from his deeply unfashionable us that he had learned something tackle issues of air pollution, climate principles about the duty we each owe which made him proud of where he change, access to open space and to make the best contribution we can came from, against Deptford’s darker the role of landscape in the city. Little to the places and communities we love. reputation for poverty and crime. by little, we made inroads on the I wanted to share this story to show Together we devised a proposal developers’ plans, eventually winning that we all have the power to challenge for a future garden, not a recreation formal inclusion and provision within the status quo and effect positive change: of formal groves and parterres, but XLITPEREXMXW½REPLIEVMRK[MXL Work of Each for Weal of All. EKEVHIRJSVXLIX[IRX]½VWXGIRXYV] former Mayor, Boris Johnson. The and a centre which together would ½VWXWXEKIWSJXLIXLMVHEKIJSV7E]IW Roo Angell (1995-2000)

Future garden (Copyright, David Kohn Architects)

26 • Sayes Court DRAWING ON THE LESSONS OF THE PAST LARA and the Atelier Movement

R-EXXIRHIHQ]½VWXGPEWW James Napier Iat the LARA (London Atelier of Representational Art). Little did I know at the time that a) the founder and head of the school was an OB like myself, b) within six months I would have quit my job in investment research to study at 0%6%JYPPXMQIERHG ½ZI]IEVWPEXIV I would be setting up and heading up a new branch of LARA in Bristol. James Napier (1986-91) founded LARA in 2008 after studying drawing and sculpture in Florence. In Florence, James had learned what is now termed the ‘atelier’ system of teaching. Atelier and painting, still life and portraiture. from life. This is known as ‘cast drawing’. is the French word for ‘workshop’ and The entire focus of the curriculum Copying from antique sculpture has was commonly used in the names of is to enable a gradual progression a long history in art, and cast drawing nineteenth century masters’ schools. in developing the student’s ability to is essentially a formalisation of that For instance, in Paris during 1880 the achieve accuracy in their representation tradition. At LARA much time is taken aspirational art student could have of shapes, forms, light, colour and over lighting the cast to bring out the a choice of attending the École des texture. ‘Bargue drawing’ is named after best atmosphere and form from the Beaux-Arts (equivalent to the Royal its inventor Charles Bargue, who studied setup. Students then use a special type Academy) or the atelier of Carolus under Jean-Léon Gérôme and taught of compressed charcoal to enable Duran or Alexandre Cabanel. The at the École des Beaux-Arts around them to bring out strong contrasts LARA curriculum draws strongly 1870. Bargue produced one hundred ERH½RIWYFXPIXMIWMRXLIMVHVE[MRK on this nineteenth century tradition, and ninety-seven lithographic plates Drawing from life enables the student incorporating the lessons of head of classical sculpture and his students to learn all about how to translate a teachers at the École des Beaux-Arts, had to copy a selection of the plates scene in nature, with its wide range the Atelier method and great British to demonstrate their draughtsmanship. of luminosity, down into the range of painters and teachers such as Solomon Examples of these studies by students charcoal or paint, while recreating the J. Solomon and Harold Speed. including Picasso and Vincent Van Gogh impression of light. Under this system students have daily can still be seen today. One area where LARA differs from classes working on a mixture of ‘Bargue Having passed that hurdle, students the ateliers of the mid-nineteenth HVE[MRK´³GEWXHVE[MRK´½KYVIHVE[MRK progress onto drawing classical sculpture GIRXYV]MWMRXLIMR¾YIRGISJ impressionism. While the impressionists 0%6%½KYVIVSSQ were initially met with hostility by the academic institutions of their day, by the turn of the century their developments in the depiction of light were being embraced by otherwise academic painters such as John Singer Sargent, Anders Zorn, Ilya Repin and Joaquín Sorolla. At LARA, the impressionists’ understanding of colour and light is brought together with the academic tradition for draughtsmanship during the painting section of the course. At this stage, students will paint from life in XLI½KYVIVSSQ [LIVIJSVQIVP]XLI] had been drawing right from the start) as well as work on their own still life setups and portraiture.

Drawing on the Lessons of the Past • 27 DRAWING ON THE LESSONS OF THE PAST

Since Monet, the understanding of colour has improved still further, and today we are able to draw on PIWWSRWJVSQSXLIV½IPHWEWHMZIVWI as physics, biology, photography and print to understand the challenges of translating the colours of nature into paint. LARA teaches the Munsell Colour System, which breaks down colours into three separate elements: Hue, Value and Chroma. When Monet painted his haystacks over and over again under different lighting conditions and weather, he was interested in how the same object can appear to be different colours under different light. At LARA students are taught how the composition of light combines major art colleges. It was partly this GERFIPIEVRIHXLVSYKLWGMIRXM½G with local colour and the human eye realisation that led me to choose a understanding and practice. The good to produce the colours we see. different subject at university and news is that in the modern economy Both James and I studied art at end up spending six (interesting and there are employment opportunities Bedales under George Hatton valuable) years in the City of London. for graduates with these skills. LARA (staff 1977-2012) and, like many Now that I teach at LARA, I hear students and graduates work in the Bedales students before and since, this same story from older students computer games industry, illustration, we were lucky to get life drawing over and over again: “I wish this had ½PQERHWTIGMEPIJJIGXWEVGLMXIGXYVI classes and sound, practical teaching existed when I went to art school in teaching, private commission portrait in representational drawing and the 70s (or 80s or 90s), but back then TEMRXMRKERHSJGSYVWIEWJYPPXMQI½RI painting while at school. Seventeen drawing and painting just wasn’t on the artists selling in galleries in London years ago when I was weighing up GYVVMGYPYQ²-XWXVMOIWQIEWWSQI[LEX and online. The original London whether or not to go to art school, ironic that the post-modernism which studio has recently moved to a new I asked lots of OBs who were dominated western art in the latter TVIQMWIWMR'PETLEQ2SVXL8LIVI½X currently at art school what the half of the twentieth century clung so of the building was partly funded by drawing teaching was like. The answers rigidly to the romantic notion of art as the generosity of LARA’s supporters I got were all depressingly similar; genius, instinctive, untrained. including students, alumni and there was a serious lack of proper A core part of the atelier philosophy returning workshop students. Both in drawing instruction at all of the UK’s is that drawing and painting skills Bristol and London we hold full and part-time Foundation Diploma courses, a range of week-long workshops, summer schools and drop-in classes for those who either want a taster of the full-time course or who can’t commit full-time but want to learn anyway. Being part of a resurgence feels exciting. Maybe there’s a bit of that Bedalian spirit in this atelier movement: We’re the outsiders of the art world right now, but we’re independent, strong-willed and we believe in what we’re doing. The more Bedalians join us, the merrier.

Tom Greenwood (1997-2001)

28 • Drawing on the Lessons of the Past THE JOHN BADLEY FOUNDATION

Undergraduate update to go into the professional world had I not gone to Bedales. ’m Roly and I left Bedales in 2015. I wouldn’t have been able to II’m currently working as an actor attend the school if I wasn’t on a in London and have just made my bursary and I am incredibly grateful debut in the West End. Bedales was to everyone who helped make that really great for me because the skills happen. I would urge you to give and techniques that I learnt whilst I generously to support bursaries to was there, in combination with the allow other kids who might not be fantastic people I met, have massively able to afford Bedales, the chance to contributed to what I am doing now attend such a fantastic school. ERH[LEX-JIIPGSR½HIRXMR-HSR´X think I would have been as prepared Roly Botha (2010-15)

Demystifying bursaries and scholarships fund to underpin the long-term ½RERGMEPWXEFMPMX]SJXLI*SYRHEXMSR edales aims to allocate at least 6% (JBF) as a separate charity, to provide With huge support from current and Bof fee income every year – in excess 100% funded bursary places. former parents and Old Bedalians, the of £1million – to fund bursaries and The Foundation has a clear and Foundation is thrilled to report that scholarships. ambitious strategy to ultimately offer XLVIIRI[JYPPFYVWEV]FIRI½GMEVMIW There are distinct differences two new full bursary places in each year took up their places this year. between these awards: bursaries group from Block 1 to 6.2, continue There are now six JBF pupils in TVSZMHIQIERWXIWXIH½RERGMEPWYTTSVX to provide funding for our existing JBF the school – which is the most in the towards school fees; scholarships FIRI½GMEVMIWEXXLIWGLSSPERHXSTYX Foundation’s history and nearly halfway recognise particular talents and potential a little aside to build an endowment towards our target of 14 places. and provide access to a research grant. Pupils can therefore be the If you would like to discuss supporting the John Badley Foundation, or if you FIRI½GMEV]SJEFYVWEV]SVWGLSPEVWLMT have any questions, please contact Veryan Vere Hodge, Head of Development. or both, depending on their particular E: [email protected] circumstances. Our Bursar, Richard T: 01730 711697 Lushington, manages the process of For information on the bursary application process, please contact Janie Jarman. means-testing for bursary awards. Registrar E: [email protected] The school wanted to do more to T: 01730 711733 broaden access, increase diversity and The John Badley Foundation is the working title for Bedales Schools Development Trust, SJJIVJYPP½RERGMEPWYTTSVXWSMRMX Registered Charity No. 1138332. established the John Badley Foundation

The John Badley Foundation • 29 THE JOHN BADLEY FOUNDATION

Please book by emailing Mary to match. Prizes for the three most Hancox: [email protected]. creatively decorated tables. No time The whole Bedalian community is to make a picnic? Takeaway meals welcome (over 18s). can be ordered and delivered to How a Hamper Ball works: We the marquee. Welcome cocktails provide the venue, tables and chairs and jazz, live auction, dancing to – and you bring your own food, drink, the amazing Bedales All Stars Band, Hamper Ball crockery, glassware, table linen and music continues with Bedales anything you need to decorate your student DJs. Friday 29 June 2018 table. Decide if your evening will We were delighted to welcome The Memorial Pitch, 7.30pm-midnight, be a bohemian gathering or a feast Roly Botha (2010-15) to the tickets £25. worthy of a Michelin Star, and dress Hamper Ball in June 2017, who talked passionately and eloquently about how being awarded a bursary to attend Bedales had made such a difference to his life. Congratulations to Bernadette Johnen-Baxter (1991-96) and husband Karl, Mirry Downs (1991-96) and husband Simon, Livia Houghton-Zeeny (1994-96) and husband Olly – whose ‘Mad Hatter’s Tea Party’ themed table was awarded by ‘Judge Budge’ (aka Moony Budge) a Magnum of Hampshire Sparkling wine for being one of the top three best decorated tables.

John Haden Badley Society at the Royal Academy of Arts

embers of the John Haden Badley Society Mhave all kindly advised the school of their intention to remember Bedales in their will. There is a gathering every year and in June 2017, members were treated to a delicious lunch at the Royal Academy of Arts. The restaurant buzzed with Bedalian chat amongst the Old Bedalian and school parent members, Keith and Moony Budge, Simon Sharp (Head of Art) and Phil Tattersall- King (Director of Drama, Dance and the Bedales Events Programme) and the four current students who attended. Members also had the chance to view the Summer Exhibition. (MERE%VQ½IPH6% (1933-37) was welcomed as a special guest to the event, who at just three years off her centenary year, is still busy painting, and in fact had artwork on display in the Summer Exhibition 2017. In recent years, legacies have had by far the greatest impact on the school’s ability to enhance (MERE%VQ½IPH6%0MXLSKVETL teaching facilities and offer bursary support. Kindly donated to Bedales by Diana and on display in the Reading Room

30 • The John Badley Foundation THE JOHN BADLEY FOUNDATION

An Interview with John Lippiett, Chair of the John Badley Foundation, Bedales Governor and past parent

ohn Lippiett’s desire to join the Eschewing university, John went MR(SQMRMGEXLMW]IEVSJGSYVWI².SLR Jnavy was shaped at school. “I was straight to Dartmouth as an eighteen notes. “When I was out there in the a grammar school lad down on the year old in 1967. The summer of love 1970s, by now back in a bigger ship, GSEWXMR&VMKLXSR²LIWE]W±ERHXLIWIE it may have been for many, but John I was put in charge of the salvage intrigued me. In those days, boys seemed was spending it learning the intricacies operation for the island’s main hospital, to enjoy hobbies such as train-spotting of his trade. “We looked on jealously VIFYMPHMRKMXERHXV]MRKXS½RHIRSYKL – I didn’t want to do that and instead, JVSQEJEV²LIGLYGOPIW±;LEXTISTPI medics to run it. We were back in I read hundreds of books about ships, tend to forget about that era is that Dominica not long ago, and rather the sea, the navy and so on and by the the Cold War was in full swing, there sweetly, the President laid on the time I was 14, I knew what I wanted my was an apparently perpetual nuclear equivalent of a state banquet for us career to be. There was a cadet force arms race and for the navy at that time, as a gesture of thanks for everything at school, which I joined as a member deterrence was the thing. Our job was that the Royal Navy had done all of the corps band, moving to the navy XSOIITXLITIEGIRSXXLVIEXIRMX² XLSWI]IEVWEKS² section after a year. Jack Smithies, an By the time he was 25, John was When war broke out over the English teacher who led the section, was a young lieutenant, a veteran of naval Falkland Islands in 1982, John was XLIQSWXXVIQIRHSYWMR¾YIRGISREPPSJ adventures around the world, and was again on hand, this time as second us. He looked after everyone’s interests, also on the point of getting married in command of the frigate HMS took us on outward bound courses to to Jenny and starting a family. Well Ambuscade. Despite the place of the places like Snowdonia and generally before his thirtieth birthday he was Falklands War in the nation’s maritime encouraged a level of unsupervised KMZIRGSQQERHSJLMW½VWXWLMTXLI history, John prefers to play down outdoor activity that wouldn’t be minesweeper HMS Shavington, and he MXWWMKRM½GERGIMRLMWS[RGEVIIV allowed today. Four of us ended up in would soon earn himself the MBE for “Looking back, I honestly consider the navy from a three-year period and his role in assisting with a hurricane MXEQMRSVTEVXSJQ]WIVZMGI²LI I was the laggard – the only one who relief operation on the island of insists. “I didn’t expect it and we lived HMHR´X½RMWL[MXLEORMKLXLSSH² Dominica. “The same thing happened through plenty of perilous hours,

The John Badley Foundation • 31 THE JOHN BADLEY FOUNDATION

ERSJ½GIVW´QIWWSVEXEWQEVXJYRGXMSR he in uniform and they with long hair and black tie, and to see the range of people that had emanated from the WEQITPEGI² John took early retirement from the navy in 2003 with few regrets. “The only time that I really missed it was when I saw a ship heading out of Portsmouth Harbour into a southerly KEPI²LIWE]W±3XLIV[MWI-[EWEP[E]W LETT]XLEX-´HPIJXEXXLIVMKLXXMQI² In truth, John had little time for regret for he had quickly plunged into one of the most demanding tasks of his professional life – as Chief Executive of course, but the danger of being struck a lot, the MoD would award a grant of the Mary Rose Trust. by missiles worried me rather less to help with the schooling of your ±-´QEKVIEXFIPMIZIVMRJEXI².SLR than the threats from Mother Nature. children, without which it would have says. “There I was, recently retired from The South Atlantic was a wild place, in FIIRMQTSWWMFPI².SLRVI¾IGXW±3YV the navy and needing a job when I many ways. That war sharpened us up ½VWXX[SGLMPHVIRLouisa (1994-96) saw the advertisement in the Sunday EWEWIVZMGIERHGSR½VQIHMRQ]QMRH and Mark (1996-98), were given the Times for the Chief Executive role at what a professional and well-trained option of where they wanted to go for the Trust. When I went along for the SYX½X[I[IVI%WEREXMSR-EPWSJIPX their sixth form and both were positive interview, I was immediately told that that we seemed to regain a fair bit that Bedales was the place for them. they didn’t want a bloody Admiral for of our self-respect in the immediate That was immensely successful and the role and I had to spend the next EJXIVQEXLSJXLIGSR¾MGX² when it came to Oliver (1996-2001), few minutes convincing them why they For the next decade, John was our youngest, the element of choice might be wrong! Having got the job, generally at sea, commanding an had disappeared and he went through I quickly realised that things weren’t assortment of ships, as well as the &IHEPIWJVSQ&PSGO² that marvellous – the Trust was near 9th Frigate Squadron, before beginning There was already a connection bust and low on morale and I had to a succession of shore-based commands between John and the school. “Avril start by ‘clearing the lower decks’ in MR[LMGLLI¾SYVMWLIH±'SQQERHMRK Hardie (staff 1987-2003) was a friend naval parlance. It was a big leadership a ship is like being a mayor in your of ours, godmother to our youngest challenge and we all had to muck in own village, an experience that I’d and head of the girls’ boarding house, together. Above all, I was determined VIGSQQIRHXSER]SRI²LIWE]W and she’s one of my co-governors to XLEXXLMW[SYPHFIEXVYIXIEQTVSNIGX² “Ashore is very different but it was my XLMWHE]².SLRI\TPEMRW±-GSYPHWII The team’s success is now a matter good fortune to have a range of tasks and grew to love the individuality of of record. Funds were raised, arms as a Rear Admiral that were immensely Bedales; it was and remains a place were twisted and continuous hard varied and interesting, including Flag which has always run away from work was the order of the day. “After 3J½GIV7IE8VEMRMRK'LMIJSJ7XEJJ conformity and never tried to stamp about three or four years of persuasion, to NATO Forces and Senior British its own character on its students. You I began to think that we were getting 3J½GIVMRXLI7SYXLIVR6IKMSRFEWIH GSYPH½RH]SYVWIPJEWETIVWSREX WSQI[LIVIERHXLI½REPWEXMWJEGXMSR MR2ETPIWERH½REPP]'SQQERHERXSJ Bedales and the joy has always been that we all shared, permanent staff and the Joint Services Command and Staff in its variety, both of opportunity and volunteers alike, when the Mary Rose College. As you get older your role in its cast of characters. Most people 1YWIYQ[EW½REPP]STIRIHMR becomes a more strategic one and you don’t readily associate Bedales with was, I think, the greatest of my working can visualise yourself as a piece of the the military but my younger son joined PMJI².SLRWE]W±-XJIPXEWXLSYKL[I SZIVEPPTSPMXMGEPERHQMPMXEV]NMKWE[² the army after Bedales, much to all our LEHGSRJSYRHIHEPPXLIGVMXMGW² By this time, John had begun his long surprise, and it was such an immense Not long after John had initially association with Bedales. “If you were pleasure to see him talking away to his been appointed to head the Mary someone who tended to be overseas Old Bedalian friends in the setting of Rose Trust, Bedales had approached

32 • The John Badley Foundation THE JOHN BADLEY FOUNDATION

him to become a governor of the EQEXXIVJSV&IHEPIW².SLRIQTLEWMWIW are something of which John school. “At that point, the Trust was “My role, with my fellow trustees, is wholeheartedly approves (Bedales will absorbing all my energies and I simply to make sure that the fund grows on EGGSVHMRKP]FIEFIRI½GMEV]SJ.SLR´W couldn’t give Bedales the necessary sound foundations and that we don’t will). “The point is that people should time so I had to decline with extreme WUYERHIVMXWVIWSYVGIW² feel able to make a contribution at a reluctance, although I deeply regretted The 1893 Club – named for Bedales’ PIZIPEX[LMGLXLI]JIIPGSQJSVXEFPI² RSXFIMRKEFPIXSEGGITXXLINSF².SLR foundation year – was recently formed he observes. “In many ways, the actual remembers. “In 2011, when I was asked for all those who choose to support sum involved is less important than again, I was in a much better position the John Badley Foundation through the idea that one is contributing to to help and was delighted to join the a regular gift of £18.93 a month (or WSQIXLMRKXLEXSRIVIEPP]FIPMIZIWMR² Board of Governors. A governor’s per quarter or year). John Lippiett, Although he retired from his role task is really to ensure that the school naturally a member of the club himself, at the Mary Rose Trust in 2015, John complies with the rules and regulations is optimistic about its progress: “It’s a maintains a breakneck pace of activities that go with being a charity, especially KVIEXMHIE²LIIRXLYWIW±8LIHMWGMTPMRI at an age when some might have JVSQXLI½RERGMEPTSMRXSJZMI[ERH of giving regularly so that other people headed for their pipe and slippers. to see that the safety and well-being can enjoy the same opportunities that Alongside his Bedales commitments, of students and staff are always the our sons and daughters have had is he is a renowned lecturer on maritime paramount considerations. But above a wonderful thing. The 1893 Club is history, exploration and old maps, all, our objective is to ensure that growing in prominence and popularity travelling the world to do so, a Patron Bedales strives to provide the very and the hope is that through it, we of the Nautical Training Corps and highest standards of education – shall be able to transform the lives of President of the Ton Class Association, XLIZIV]TYVTSWISJXLIWGLSSP² a growing number of people. At the and a trustee of the Royal Mint Museum Not content with just his role QSQIRX[ILEZIWM\FIRI½GMEVMIWSJ and the Chichester Festival Theatre. as governor, John is also the chair the Foundation at various stages of the He was also appointed a Deputy of the John Badley Foundation, the school; we would like that number to Lieutenant of West Sussex in 2014. extraordinary Bedalian concept that increase to 14, and to grow the fund ±-QYWXFIQEH².SLRPEYKLW±,S[IZIV offers bursary support for talented XSE½KYVIFI]SRH†QMPPMSR² I do love learning new things, I like to youngsters who could not otherwise Legacies, which in recent years keep the old brain active and as my afford a Bedales education. “The have made by far the greatest days become more numbered than decision about which students should impact on Bedales’ ability to improve IZIV-[ERXXS½PPXLIQ[MXLEWQER] be supported by the school is entirely teaching facilities and offer bursaries, interesting things as possible. Jenny and I published our letters to each other during the Falklands War (War and Peas: Intimate Letters from the Falklands War) to coincide with the 25th anniversary of the war and that has led to us giving talks together all over the place, which has been a lot of fun. I must say that I’ve been incredibly lucky throughout my life [MXLFSXLQ][SVOERHQ]JEQMP]² ±;LMPI-[EWEXWGLSSP².SLR concludes, “dear old Jack Smithies told me that working with people would be the most satisfying thing that I would ever do. I’m not sure that I agreed with him at the time; perhaps I didn’t even understand what he meant. I most certainly do now and LI[EWWSVMKLX²

James Fairweather, husband of Kate Fairweather (née Day, 1980-85)

The John Badley Foundation • 33 THE BEDALES GRANTS TRUST FUND

or those who are not familiar with -XMWSZIV½ZI]IEVWRS[WMRGIXLI For this reason, we have appointed Fthe work of the Bedales Grants &+8*VIGIMZIHXLMWFIUYIWXNSMRXP] Lynn Pearcy (1972-77) as an additional Trust Fund (BGTF), it was founded in [MXLXLI)H[EVH&EVRWPI])HYGEXMSREP trustee and she joins the investment [MXLXLIEMQSJTVSZMHMRK½RERGMEP 8VYWX-XMWEQIEWYVISJXLIGSQTPI\MX] GSQQMXXII8LMWGSRXMRYIWXSFIEFP] support for students at Bedales, with SJWYGLQEXXIVWXLEXSRP]RS[EVI GLEMVIHF]Simon Latham (1993-98) TVIJIVIRGIFIMRKKMZIRXSGLMPHVIRSJ [IGPSWIXSEWEPISJTEVXSJXLI ERHLEWQ]WIPJEWMXWSXLIVQIQFIV 3PH&IHEPMERW8LMWLEWFIIRI\XIRHIH JEVQPERHERHIRXIVMRKMRXSEFMRHMRK GPSWIP]SZIVWIIRF]SYV'LEMV SZIVXLI]IEVWXSGSZIVGLMPHVIR agreement with a property developer %PXLSYKLQYGLSJSYVEWWIXWLEZI who have OB relatives, even if their SRXLISXLIVTPSX-GEREWWYVI FIIRLIPHMRGEWLPEXIP]XLIWYFWXERXMEP parents are not OBs. Currently we are VIEHIVWXLEX[ILEZIRSXFIIR WYQWMRZIWXIHF]6EXLFSRIWSR supporting just over 20 students and dragging our feet, merely working SYVFILEPJLEZIWLS[RMQTVIWWMZI the great majority of them have strong LEVHXSQE\MQMWIFIRI½XWXSXLI8VYWX growth again and stand at a little over 3&GSRRIGXMSRW 8LIWIWLSYPHIZIRXYEPP]FIMRI\GIWW †QMPPMSR[MXLSYXXEOMRKEGGSYRX (YVMRKXLMW½VWX]IEV[MXLCathy SJ†QMPPMSRXSIEGLFIRI½GMEV]-XMW SJXLII\TIGXIHMRGSQIJVSQXLI Baxandall (née Dwyer, 1971-76) at [SVXLFIMRKTEXMIRX 0MPPI]&IUYIWX XLILIPQXLI8VYWXLEWGSRXMRYIHXS Also during the past year, Peter Hall As always, we have awarded TVSWTIV[IPPMRPIWWWXEFPI½RERGMEP (1975-79) has retired from his fund FYVWEVMIWXSXLIZEPYISJ SJEWWIXW GPMQEXIW*SPPS[MRKXLIPMUYMHEXMSRSJ QEREKIQIRXGEVIIVEX,YRXIV,EPPERH EGGSVHMRKXSSYVTSPMGMIWWYTTSVXMRK SYVQSVIWTIGYPEXMZIMRZIWXQIRXW HIGMHIHXLEXLIRSPSRKIV[MWLIWXS around 20 students. Despite this outlay, EGXMZMXMIWLEZIJSGYWWIHQSVISRXLI FITEVXSJXLI&+8*MRZIWXQIRXXIEQ [ILEZIWXMPPEGLMIZIHETTVIGMEFPI VIEPMWEXMSRSJEWWIXWMRXLIFIUYIWX ,ILEWHSRIJERXEWXMG[SVOJSVXLI GETMXEPKVS[XL from Jennifer Lilley (1937-42) and BGTF over the past ten years and 3YVXIEQSJXVYWXIIWGSRXMRYIWXS SRXLIVIMRJSVGMRKSJSYVFSEVHSJ we are delighted that he wants to MRGPYHICamilla Church (1989-92), XVYWXIIW[MXLRI[QIQFIVW[MXLXLI GSRXMRYISRXLIFSEVHSJXVYWXIIWEW SYVVIWMHIRXPIKEPI\TIVX RIGIWWEV]UYEPM½GEXMSRW ERSVHMREV]QIQFIV,IVIQEMRWEW -RTEVXMGYPEVStephen Davies MRXIVIWXIHMRERHGSQQMXXIHXS]SYRK Dennis Archer (1989-94) has joined the group to Bedalians as ever. (staff 1974-2008) lead the disposal of the properties inherited from Jennifer Lilley. Given that 8LI8VYWXIRGSYVEKIWETTPMGEXMSRWJVSQWXYHIRXW[LSLEZIWMKRM½GERX XLIWIGSQTVMWIETEVGIPSJJEVQPERH Old Bedalian ancestry. in Devon and a development site in It offers means-tested support to students at Bedales with preference 'EQFIVPI]WTIGMEPI\TIVXMWIMWHI½RMXIP] given to those who have parental or other family connections to the school. VIUYMVIH7XITLIRLEWGSRWMHIVEFPI Application is made through Janie Jarman, the Registrar at Bedales, I\TIVMIRGIERHLMWQEREKIQIRXSJXLIWI [email protected]. MWWYIWMWKVIEXP]ETTVIGMEXIH

34 • The Bedales Grants Trust Fund

OB PROFILES

ZIVXLIPEWXJI[]IEVW.EQIW*EMV[IEXLIVLEWFIIRMRXIVZMI[MRK3&WJSVYWXS½RHSYXEFSYXXLIMVXMQIEX&IHEPIW OERH[LIVIPMJILEWXEOIRXLIQWMRGI8SKMZI]SYEXEWXIV[ILEZIGSQTMPIHEWIPIGXMSRSJI\XVEGXWJVSQLMWQSWX VIGIRXMRXIVZMI[W8S½RHSYXQSVIEFSYXXLIJSPPS[MRK3&WXLIMVQIQSVMIWERHEGLMIZIQIRXW]SYGERVIEHXLIJYPP TVS½PIWSRXLI&IHEPIW[IFWMXI

Matthew Batstone Bedales during the 1970s and 80s (1968-82) was enjoying one of its many peak periods of academic excellence. Co-founder and Director Matthew, delighted to escape the of the New College of tyranny of sport, was a willing recipient of such high-powered intellectual Humanities stimulation. “I was tall and rather scrawny, entirely lacking in physical presence at that time, so sport was a late-developing interest of mine apart from the family curse of supporting 4SVXWQSYXL*SSXFEPP'PYF²LIEHQMXW decided to send me back to school in “Dad’s cricketing genes completely England but they didn’t want me to go missed me and instead, I was one to a traditional boarding establishment. of the kids who helped to build the &IHEPIW½XXIHQ]WIRWMFMPMXMIWEXXLI Sotherington Barn. He did cast me in time and was in line with my family’s a minor role in Ayckbourn’s Confusions ETTVIGMEXMSRSJXLIEVXW²7IFEWXMER´W but that was on the basis of my mother was a ceramicist of high repute How easy can it be to pursue your VIPMEFMPMX]VEXLIVXLERQ]XEPIRX² and his great-great-grandfather was education at a place where your father “A lot of my inspiration therefore the pre-Raphaelite painter William is busy establishing a legend as an GEQIJVSQXLMRKWPMOI'MZMGW²1EXXLI[ Holman Hunt. English teacher of close to genius, not to continues. “People such as Max Beloff, Approaching his new school in a mention an inspirational director of plays Peter Brooke and Erin Pizzey would positive and open-minded frame of and an enthusiast for all things pertaining come and talk to us at events which mind, Sebastian did not immediately to cricket? Not especially, is the answer, were always hugely well-attended take to life at Dunhurst. “I found the according to Matthew Batstone, son and would deliver messages that still IEVP]]IEVWTVIXX]XSYKL²LIEHQMXW of John Batstone (staff 1963-93) and resonate with me. “Living away from home at such a recipient of occasional brickbats from Read more: www.bedales.org.uk/ young age didn’t suit me and I had those who were not fully paid-up alumni/matthew-batstone trouble integrating socially so it was members of the Batstone fan club. only really when I arrived in Block 3 at ±2SMX[EWR´XEP[E]WTPEMRWEMPMRK² &IHEPIWXLEX-WXEVXIHXSIRNS]Q]WIPJ² Matthew agrees a touch ruefully. “Dad Sebastian Bergne (1975-84) Already something of a dab hand was a great, inspirational teacher and in the art and craft department, a presence that you couldn’t ignore Industrial Designer Sebastian’s early refuge was found in but he also liked bright students who For most children of diplomatic families, the workshops and barns at Bedales. applied themselves and were willing to the time arrives somewhat earlier “I’d enjoyed making things as long as engage intellectually with the subjects in life than they might hope when I can remember, taking things apart, that he loved. He had absolutely no PSGEPWGLSSPWMRJEV¾YRKPSGEXMSRWEVI trying to put them back together and patience with anyone inclined to be lazy deemed inadequate for their long-term building models at a time when my and there was occasionally a bit of grief education. In Sebastian Bergne’s case, TIIVW[IVIYWYEPP]VIEHMRK²LII\TPEMRW from those who had fallen out with him. the moment arrived at the age of eight “I got involved in pottery at the start, Oddly enough, Dad was also adamant with his father at the British Embassy spent a lot of time in the barn, sewing, that none of his three sons should ever in Cairo. “I’d been at primary school weaving and basket making and later follow him into teaching, at least partly when we were in Abu Dhabi but there found the Bedales workshop to be because it was a notoriously badly paid was nothing appropriate for me in an inspirational place. Teachers such TVSJIWWMSRTEVXMGYPEVP]FEGOXLIR² )K]TX²7IFEWXMERVIGEPPW±1]TEVIRXW as Martin Box (staff 1970-2008),

36ˆ3&4VS½PIW OB PROFILES

(EZMH&YXGLIV WXEJJ and, in cello in the school orchestra, threw rubbed off on me as I began to love the art department, George Hatton herself whole-heartedly into activities making things myself. I used to sew (staff 1977-2012), were incredibly such as baking bread, worked on the endless patchwork squares and I also had LIPTJYPERHWYTTSVXMZI² farm and above all, spent a lot of her the inspiration of a godmother, Margaret Read more: www.bedales.org.uk/ time in the art room. “George Hatton &MKKW[LS[EWXLI½VWX[SQERXSFI alumni/sebastian-bergne [EWEQEWWMZIMR¾YIRGISRQISJ President of the National Association GSYVWI²,ERRELVITSVXW±-RIZIVJSYRH SJ+SPHWQMXLWERH[EWXLI½VWX[SQER him a tough teacher – he was just to pass the F.G.A. gemmology exam Hannah Gourlay (1999-2004) very encouraging, allowed you to enjoy with distinction. I remember her grand what were you were doing and never Georgian house in Farnham very well, Founder of TellTails tried to push you down one particular full of mineral specimens in ornate path. The creative side at Bedales, art, cabinets. Art was a big part of life but textiles and so on, was what I enjoyed so was practicality and there was always the most and the school encouraged the expectation that you would work thinking outside the box. I left with LEVHEX[LEXIZIV]SYHMH² a desire to set up my own creative An apparent natural for Bedales, FYWMRIWWEXWSQITSMRX² Joanna had been put on the waiting list Read more: www.bedales.org.uk/ at the school while actually securing alumni/hannah-gourlay a place at Frensham Heights. “My mother, who had been to RADA and was a free-thinking vegetarian with From her earliest years, Hannah Joanna Hardy (1974-78) a penchant for yoga, was particularly Gourlay was constantly inventing and keen on that type of education for me creating. It was soon apparent that Fine Jewellery Specialist and when a place at Bedales became her school in Godalming, an all-girls Joanna Hardy’s earliest memories are free, I went down for the three-day institution with a fairly unbending inextricably linked with making things. induction with a mixture of excitement attitude to discipline, was not going to “My father was an entrepreneur, whose ERHXVITMHEXMSR²WLIVI¾IGXW±-´HFIIR be the right environment in which to business involved, amongst many head girl at my little school in Liphook nurture the artistic skills that she so things, petrol stations, slot machines but I’d gone on to fail my 11+ and my clearly possessed. “My parents went and jukeboxes, but he also found great REXYVEPGSR½HIRGILEHXEOIREFMXSJE looking for a creatively focused school satisfaction in making things. He could knock. I also had something of a stutter for me and they didn’t have to go too ½\ER]XLMRKERHEWE]SYRKKMVP-[SYPH – reading the lesson at my prep school JEVXS½RHMX²,ERRELVI¾IGXW±&IHEPIW be so impressed with his DIY skills. had been a real dread of mine – and [EWETVIXX]SFZMSYWTPEGIXSWIRHQI² Every holiday I would work in one of his so there were a lot of nerves when I Hannah was immediately struck by businesses including being a petrol pump went to Bedales. As it turned out, the school. “So different to what I was attendant where I became fascinated I loved the induction, got in and had YWIHXSEXQ]SPHWGLSSP²WLIVIGEPPW [MXLGEVW²WLIVIGEPPW±8LIWEXMWJEGXMSR speech therapy at school which helped “Everyone looked so cool and uber he gained from tinkering in his workshop the stutter to vanish by the time I got GSR½HIRXH]IHLEMV¾S[IVWMRXLIMV XS&PSGO² hair, fairy wings. I felt like such a young Read more: www.bedales.org.uk/ kid when I arrived, wearing dungarees. alumni/joanna-hardy Within a week I remember changing the way I wore my dungarees with one buckle rather than two and a bow in my Andy Kemp (1970-80) hair. I suppose that I was quite a shy child Manager at EPIQ Ecology but Bedales really was responsible for MRWXMPPMRKGSR½HIRGIMRQIERHFVMRKMRK & Petroleum me out of my shell, which, as I look The son of a father who worked for back was much more important than Shell in Africa, Andy Kemp was following XLIEGEHIQMGWMHISJXLMRKWXSQI² a well-trodden path when he arrived Quickly settling into the routine of as a boarder at Dunhurst at the age of her new school, Hannah played the eight. “I think the choice of Bedales may

3&4VS½PIWˆ37 OB PROFILES

1974-2008) and his colleagues in the shy, I was astonished and quite maths department were extremely intimidated by how fully formed my good and then there was Don Spivey peers seemed to be. Everyone gave (staff 1969-90)JSVGLIQMWXV]²LI the impression of being so strong, so recalls. “I seem to remember that GSR½HIRXWSWYVISJXLIQWIPZIW)ZIR there was a splinter taped to the wall the clothes that people wore were in one of the common rooms as a an active statement about them as memento of the time that Don’s chair individuals; I, on the other hand, had had bitten the dust during one of his a shocking collection of stuff, which I\TIVMQIRXW² added to my feeling of shyness and so Read more: www.bedales.org.uk/ I took refuge in things such as basket- alumni/andy-kemp weaving, looking after the chickens – ERHQYWMGSJGSYVWI² Clare’s mother was a talented 'PEVI1G'EPHMR  amateur musician and music was have been made for me on the basis Classical Singer and Founder embedded in the fabric of the family of location as much as anything else, home. “To some extent, I think that I Andy suggests with his tongue slightly of McCaldin Arts XSSOMXJSVKVERXIH²'PEVIQYWIW±-X in his cheek. “The family’s UK base was From her earliest years, music was almost took on the form of background MR(SVWIXWSMX[EWEQEXXIVSJ½RHMRK a vital element of Clare McCaldin’s colour, as opposed to a passion of somewhere suitable within reasonable life. Her father, a professor of music, choice, and it was a fair bit later in HMWXERGISJLSQIERHEMVTSVX² [EWSRISJLIVKVIEXMR¾YIRGIW life that I had the Road to Damascus A disastrous initial week at his new and supporters, but his position at moment that showed me how deeply educational home was not, happily, a Lancaster University meant that Clare’s I cared for it. That said, Jonathan herald of worse things in store for young early school days at a comprehensive ;MPPGSGOW WXEJJ was a great Andy. “I was spectacularly notorious school in Morecambe were far from inspiration at Bedales and I was also for crying incessantly throughout my ideal for a sensitive, academic child. lucky enough to have a wonderful ½VWXJI[HE]WEX(YRLYVWX²LIPEYKLW Bedales appeared to provide an cello teacher in Helen Verney “but I got over that and quickly became excellent alternative for the budding (former staff). The encouragement to one of the last to want to go home singer and cellist, who duly landed a experiment as widely as possible was when holidays came around. I’ve got to music scholarship and joined the school always there in areas such as folk and say that my memories of Bedales as a at the beginning of Block 2. jazz, which I enjoyed, but classical music whole are happy ones – it felt like my ±;MXLXLIFIRI½XSJLMRHWMKLXMX[EW was what I knew best and that’s what LSQIJSVXIR]IEVW² SHHXMQMRKERH-JSYRHMXHMJ½GYPXXS -XIRHIHXSJSGYWSR² By his own admission, Andy was break into the various friendship circles Read more: www.bedales.org.uk/ something of a jack-of-all-trades at that had already been established in EPYQRMGPEVIQGGEPHMR school. “It’s certainly true that a number QMHHPIWGLSSP²'PEVIVI¾IGXW±%WE of people who performed really well TISTPITPIEWMRK½VWXGLMPHWSQI[LEX LEHEWTIGM½GTEWWMSRXLEXXLI]JSPPS[IH %RKMI1G0EGLPER FYX-[EWR´XEQSRKXLIMVRYQFIV²LI VI¾IGXW±&IHEPIW[EWEFMKWSGMIX]MR (née Illingworth, 1987-92) which you could dabble at a lot of Bishop, Thanatologist things without necessarily being great at and Partner at Red Plait them. I wasn’t arty but I did some art, a Interpretation LLP fair bit of design, where (EZMH&YXGLIV and Martin Box were great characters, Arriving at Dunhurst at the age of eight of course, and was generally never was like manna from heaven for Angie WLSVXSJWSQIXLMRKXSHS² McLachlan. As the youngest boarder at A then rare Bedalian S Level maths the Collegiate School in Bristol, she had student, Andy pays generous tribute felt isolated and out of her depth; at to the teaching that he received at Dunhurst, she was in her element from the school. “(IRRMW%VGLIV WXEJJ LIV½VWXHE]

38ˆ3&4VS½PIW OB PROFILES

me. It was a very old-fashioned, strict Photo credit: The University of Winchester institution with a heavy emphasis on XLIVIPMKMSYWWMHISJPMJI² For an alternative, Joe and his parents ½VWXPSSOIHEX0ERGMRK'SPPIKIXLIalma mater of Joe’s father. “That didn’t seem a lot different from Prebendal and then [IPSSOIHEX&IHEPIW².SIVIQIQFIVW “I couldn’t believe what I was seeing, fell in love with the place and couldn’t imagine what I would do if I didn’t get in there. It was such a welcome change from everything that I’d been used to JSVXLITVIZMSYWJI[]IEVW² He needn’t have worried. Beginning “Mum had got a job as a matron become an avid student of martial arts; in 1987, Joe naturally gravitated at Bedales, which was how I was it was something that I had discovered towards the school’s musical scene, able to move to Dunhurst, and I that I was good at and I eventually so reinforcing an obsession that had absolutely loved my new school at FIGEQISRISJXLI½VWXFPEGOFIPXW been with him since his earliest days. SRGI²%RKMIVIGEPPW±8LITL]WMGEP to come from Bedales. Until I was 21, “Nan had a pianola in her house, my setting, the orchards, the pets, the I pursued it, even coming back stepfather was a cabaret singer and teachers, who were so friendly and after I had left the school to take the I’d loved the hymns and the concerts approachable – all of them made such KVEHMRKWIWWMSRWEX&IHEPIW² that I’d heard and seen in Chichester, a positive impression on me. I enjoyed Read more: www.bedales.org.uk/ so I was already steeped in a variety of the lessons, the drama and the art – EPYQRMERKMIQGPEGLPER musical styles by the time I arrived at there was a new art block that was &IHEPIW²LII\TPEMRW±4PE]MRKHMJJIVIRX being built at the time – I loved being musical instruments was part of life in the workshop and building things Joe O’Connor (1987-92) for me. I’d started on the trumpet, out of wood and life was so exciting. which eventually gave way in a natural Yes, there were some tougher aspects; Music Producer and progression to the euphonium, and there was a social pecking order, in Founder of JMusic Ltd also studied the piano and the cello which those who had come all the FYXMX[EWEX&IHEPIWXLEX-½VWXVIEPP] way up the school were at the top, HMWGSZIVIHQYWMGEPXLIEXVI² and it was really quite competitive, Joe’s time at Bedales spanned the with sports competitions between the eras of both .SREXLER;MPPGSGOW houses and so on, but these were the and 2MGO+PIIH WXEJJ . wonderful days before health and safety ±.SREXLER[EWELYKI½KYVIEX&IHEPIW regulations. You could climb trees, do who left the school a couple of years all kinds of hair-raising things with very after I got there and made an incredibly few restrictions and think things out for XSYKLEGXXSJSPPS[².SIVI¾IGXW yourself in a way that children aren’t “There was a lot of concern about EP[E]WEPPS[IHXSXLIWIHE]W² Joe O’Connor is as judicious as he can who might succeed him but when the At Middle School, Angie was part possibly be in appraising his debt to potential recruits were put through of an experimental couple of years, Chichester Cathedral Choir School, the their paces it was obvious that Nick which saw her lessons taking place at preparatory school that he attended stood out a mile. I hit it off with him Bedales while she continued to live at in the early 1980s that is also known WXVEMKLXE[E] LIEPQSWXTIVWSRM½IH Dunhurst. “The tracking backwards and as Prebendal. “Music was always the the Bedales tradition of informality with forwards was a bit of a pain but there love of my life and Prebendal always an underlying layer of discipline and [IVIGSQTIRWEXMSRW²WLIWE]W±-[IPP forced you to realise that there respect and I still meet up with him remember the thrill of the Bedales [EWRSWYFWXMXYXIJSVTVEGXMGI²LI JSVEGSJJIIJVSQXMQIXSXMQI² PMFVEV]ERHLS[-JIPX[LIR-½VWX acknowledges. Joe hesitates and then Read more: www.bedales.org.uk/ borrowed a book from it. I had also continues: “But it wasn’t the place for EPYQRMNSISGSRRSV

3&4VS½PIWˆ39 BEDALES EVENTS 2018 ;MXLLIEH[MXLLERH[MXLLIEVXPIX´WEPPGIPIFVEXI³FII´MRK

ur new season was curated with Roger Penrose Ekersley Lecture, Othe 125th anniversary celebrations 1E] very much in mind. One key thing to celebrate is that most important Bedalian freedom: the freedom to ask questions. This is a freedom we may, when it is so woven into the fabric of X[IRX]½VWXGIRXYV]&IHEPIWXEOIJSV KVERXIHFYXMXMWJVIIHSQ[I½KLXJSV whenever it is threatened. John Badley, founder and ‘Chief’ (a term variously affectionately used with love and fear, VI¾IGXMRKLMWKIRIVSYW]IXJSVQMHEFPI reputation) felt the traditional educational systems of the time had removed that freedom. His vision was head girl here and so Roger If you’d prefer to talk to someone was tolerant and humane. His vision 4IRVSWIMWMRWSQIWQEPPFYXWMKRM½GERX when booking your tickets, the number initiated educational change and we way, returning to his roots. is 0333 666 3366. VIETXLIFIRI½XWLIVIXSHE] Margaret Leathes would not have To receive the events brochure If Bedales remains (as was a popular been head girl without Amy Garrett [LIRMXMW½VWXWIRXSYXIQEMPYWSR metaphor) an oak giving rise to acorns Badley, committee member of the [email protected] to provide your such as Gyles Brandreth (1961-66) 4IXIVW½IPH7SGMIX]JSV;SQER7YJJVEKI full address and let us know if there (joining us for a special Parents’ Day and Equal Citizenship and wife of the are particular types of event that performance) and 1EVMOE,EGOQER Chief. Maybe her clearest impact here interest you most. Do state that (2000-10) (that semi-anarchic, is in the co-educational nature of the you’re an OB and that it’s the events shamelessly free, rising pop star) then it WGLSSPJSVWLIGSR½VQIHLIVLYWFERH brochure that you want somewhere EPWSWSQILS[ WGMIRXM½GEPP]MREGGYVEXIP]  in his own belief that education at in the body or subject line of the email sets out runners in abundance too. Bedales should be open to girls as well and you’ll receive the next edition as 6SKIV4IRVSWI WGMIRXM½GEGGYVEG] EWFS]W,IVMR¾YIRGIMWVIQIQFIVIH soon as it becomes available. We look TIVWSRM½IH GSRXMRYIWXLIVMGLLMWXSV] this season with A Necessary Woman, forward to welcoming you back to of stellar speakers with our annual an imagining of the night before the Bedales soon. Eckersley Lecture, named after Thomas census, 1911. )GOIVWPI]  and his brother Join us to celebrate 125 years of the Phil Tattersall-King Peter (1902-11). Roger Penrose’s ±MVVIKYPEVP]FSPH²*SVXLIJYPPPMWXSJIZIRXW Director, Bedales Events Programme mother, Margaret Leathes (1913-19) visit our website: bedalesevents.co.uk. @BedalesEvents

1EVMOE,EGOQER%TVMP %2IGIWWEV];SQER1E] +]PIW&VERHVIXL.YRI

40 • Bedales Events 2018 FROM DEEPEST DORSET TO HAMPSHIRE A Life Saving Change

from the subject teacher. The morning to India. The founders bought the timetable was divided into half-hour building for £3,000 in 1940, and the periods and, once a week the books ½VWXGLMPHVIR[IVI[EVXMQI3TIVEXMSR we kept our study records in were Pied Piper evacuees from the cities of checked. If we had spent too much time central England. The founders were in a room we were advised to rethink very left-wing. One of them had been our plans for the coming week. The involved in the 1919 workers strike in system suited some children well, either Berlin, and was chased out of Germany those who were motivated to study MREJXIVXLI6IMGLWXEK½VIERH on their own or those with learning Hitler’s decree nullifying many civil HMJ½GYPXMIWWYGLEWH]WPI\ME[LSRIIH liberties. Quite a number of the parents I\XVELIPT-GERRSXWE]-½XXIHIMXLIV in the 40s and 50s were members of category and I think I was generally the British Communist Party, and the way behind my peers in many subjects ethos of the school was anti-capitalist. when I got to Bedales. Fortunately I Quite a few of the pupils had well managed to make up much ground. known creative parents. People like But my time at MWS was by no Larry Adler the harmonica player, John means entirely wasted. I am sure that Osborne the playwright, Christian joined Block 4 in the autumn of the way we were taught during the Darnton the composer and Michael I 1961, after three years at what was craft lessons in the afternoons, and the Bentine the comedian. To the founders, somewhat euphemistically called a freedom we had to make our own the school was everything and they ‘progressive’ school. It might more entertainment at weekends inculcated made it a success educationally and accurately have been described as in me a streak of independence and ½RERGMEPP]F][SVOMRKEPQSWXEPPLSYVW non-traditional or alternative. Hidden an ability to use time productively. In of the day. Sadly the staff that followed away in the far west of Dorset, Monkton many ways it is in recognition of these did not have the same commitment, Wyld School had some 60 pupils, attributes that I have written the history and as state schools provided more roughly half boys and half girls, with ages of the school – to put on record the specialist teaching for children with ranging from eight to 18. With such an fascinating story of a school that in PIEVRMRKHMJ½GYPXMIWXLIETTIEPSJ1;7 age range it was simply not possible 40 years taught more than 700 pupils. faded. Eventually, in 1982, it was closed. for us to be taught in conventional The school was founded in an A copy of Monkton Wyld School: The classrooms. Instead we studied under old parsonage, which had been built History of a Progressive School in Dorset the so called ‘Dalton system’. We along with a new church in 1848 by a  is in the Bedales Library. studied on our own in subject matter wealthy widow to persuade her prelate rooms, with occasional personal help son-in-law, not to take her daughter Charles Bevan (1961-66)

From Deepest Dorset to Hampshire • 41 ON THE BUSES

Full list of Matthew’s published works:

Routemaster Requiem, with Geoff Rixon, Ian Allan Publishing 2006; Routemaster Retrospective, with Geoff Rixon, Ian Allan Publishing 2007; Routemaster Omnibus, with Geoff Rixon, Ian Allan Publishing 2008 (bind-up of previous two, plus update); The London Titan, Ian Allan Publishing 2008; The London Metrobus, Ian Allan Publishing 2009; London Transport 1970-1984, Ian Allan Publishing 2013; London Transport’s Last Buses: Leyland Olympians L 1-263, Pen and Sword 2016; London’s Bendy Buses (The Bus We Hated), Pen and Sword 2016; The London Enviro400, Pen and Sword 2016; The London DMS, Pen and Sword 2017; London Buses 1970-1980 (with John Laker), Pen and Sword 2017 (this is the one just out!); The London LS, Pen and Sword, due March 2018.

hen I met Ruth Whiting (staff to have a car. But during that era, the permanent, where books are and a W1963-2000) at our Block’s whole London Transport organisation subscription to Adobe Creative Cloud, reunion four years ago I apologised was split up and sold piecemeal to the on which I design everything I write, is to her, because I was the very worst private sector, and it’s that convoluted only 50 quid a month. So, God forbid history pupil she must ever have seen, part of history I’ve been writing about -½RHQ]WIPJMRXLITSWMXMSRSJSJJIVMRK having only sat the A Level because it in the last decade, with twelve books advice and inspiration, but I say: write was one of the three subjects I was published and four more contracted. everything, now. Write it all down, least bad at. I also told her that, crazy This game for me has never been from diaries to reviews to op-eds, as it sounds now, I am a historian by about standing on a street corner with vox pops and whatever takes your vocation. I did scrape the passing E grade, a notebook, as is the old stereotype; fancy. Document your life and your incidentally, because I answered a it’s history in action, only through a interests for the present and for the question on the paper that hadn’t ½PXIV]SY´HRIZIVI\TIGX8LVSYKLMX future. Don’t worry about who’ll see actually been taught but was on the -½RHQ]WIPJI\TSWIHXS½IPHWEWZEVMIH it or care about it. Someone will; look syllabus nonetheless and had piqued as photography, design, cartography, EXQI1E]FIXLIVIQMKLXSRP]FI½ZI my interest at some entirely random architecture, labour relations, international men and a dog who read my books, moment. It paid off, and I’ve sort of been logistics and industry, the state (both FYXXLI]´VIQ]JEZSYVMXI½ZIQIRERH using my own initiative ever since. British and foreign) versus the private dog in the world. As a fan told me 8VYIXLI½IPH-OIITKIXXMRKEWOIH sector, funding (taxation versus venture to mutual mirth, thanks to his having back to write about is as eclectic capital) and even fashion (watch the lapels bought one of my books, his kitchen as it gets; it doesn’t matter. In the and trouser ends on the passers-by table didn’t wobble any more… period before and during my time who get into photographs!). Somewhere amid all this, I wrote at Bedales, London Transport buses Where the publishing of it all is my own account of our own era [IVIXLIW]QFSPSJXLIGETMXEPYRM½IH concerned, there’s never been a here at school; 300,000 words of it, recognisable and reasonably reliable. better time for people like us to take hammered down as soon as I left and They got me (and many of you, no control of the means of production. before it passed out of my mind. doubt) from A to B at a price that There are already remarkable tools like One day I’ll publish that story too; is still cheap by comparison today, smartphones and the media on which perhaps posthumously… teaching me how to plan, budget and to push whatever you want; Facebook, time journeys when I was too young Instagram and so on. But those aren’t Matthew Wharmby (1984-89)

42 • On the Buses MCCALDIN ARTS Photo credit: Claire Shovelton for Tête à Tête for Shovelton Claire credit: Photo hen I was at Bedales I had Clare as Vivienne Wno idea what I wanted to do [MXLQ]WIPJ-¾MVXIH[MXLXLIMHIESJ singing while at university but took a different route after graduation and only came to professional singing in my late 20s. I now sing a lot with the Royal Opera, with the BBC Singers and other ensembles, as well as performing widely as a concert soloist. After having done 15 years of this sort of work, from Verdi opera to Harry Potter soundtracks, and ‘squeaky gate’ modern music to Renaissance polyphony, I also began to lead collaborations with PMZMRKGSQTSWIVWJSVXLI½VWXXMQI I needed a convenient label to unite the groups of colleagues I would be making and marketing their own work written for me by Stephen McNeff and leading in these projects. I decided as part of their professional activity. inspired by the story of Jane Williams. to call this McCaldin Arts. Much of a performer’s life is about Jane was Percy Bysshe Shelley’s last great 2S[EJXIV½ZI]IEVWSJ1G'EPHMR serving the intentions of other people; crush, but is largely forgotten, being Arts’ activity, I have a range of shows the (often dead) composer and writer overshadowed by Shelley’s widow, Mary. under my belt and I am increasingly who created the piece, or the living The stories of women who have being invited to speak and write about conductor or director who I am largely been mis-represented or somehow creative entrepreneurship. It’s a subject expected to obey. As a solo recitalist de-voiced has been a consistent one in I feel strongly about, since we have I am freer in my choices. By being my work. Even in projects that I consider excellent music conservatoires in this actively involved in the creation of a to be principally about something else, country but our industry can’t support new piece from the outset, I hopefully the status of women has emerged as all the musicians we train. The idea of a LEZIXLIQSWXGVIEXMZIMR¾YIRGISJ a secondary theme. ‘portfolio career’ is not in itself a new all. The decision to start writing and After A Voice of One Delight came one for professional musicians, but the commissioning work seems now to two other works about women who need to be actively entrepreneurial have been the inevitable and necessary LEZIFIIRQMWYRHIVWXSSH8LI½VWX is challenging to many. I am pleased next step for me in my professional VivienneVIXVMIZIW87)PMSX´W½VWX[MJI to contribute to the conversation by development. The singing business Vivienne Haigh-Wood, from the asylum talking to younger colleagues about wasn’t offering everything I wanted in where Eliot and her family left her in terms of roles, so the solution was to 1938. Now, currently in development, WXEVX½PPMRKMRXLIKETWJSVQ]WIPJ is Mary’s Hand, which challenges the How did I get started? I was looking VIGIMZIHZMI[SJ±&PSSH]²5YIIR1EV]- for a way to do a follow-up performance Perhaps unsurprisingly, the issues raised of a work that had already been written by this latest show feel particularly for me. Getting a premiere is relatively up-to-date: female power and the easy – it’s the second performance that female body; the role of the monarchy; can be hard to pin down. Sometimes a English attitudes to foreigners. change of presentation can renew a Ideas for shows come from all over work’s appeal. Stage it. Change the the place and occasionally a casual instrumentation. Make it the centrepiece suggestion reveals a story. My father’s of a recording project. Find a new way life-long interest in the composer to spin its subject matter in the light of Joseph Haydn seeded the idea behind current trends or conversations. Haydn’s London Ladies. This narrated 8LEX½VWXWLS[[EWA Voice of One ‘entertainment’ is somewhere between Delight and on that occasion I opted to a recital and a lecture, a combination stage it. The original concert work was I have been experimenting with to move

McCaldin Arts • 43 MCCALDIN ARTS

Photo credit: Cheyney Kent Cheyney credit: Photo compositional ways a piano can also be a reasonable substitute for a larger ensemble. However not all venues already have, or can afford to hire in, a good piano. It’s pretty painful for a professional accompanist to perform on an electronic keyboard or an instrument that hasn’t been cared-for and I know I am torturing my pianist colleague by imposing this. Mary’s Hand avoids a piano entirely. Although the piece is presented out Clare’s most recent CD, themed around the ideas of strict historical time, the piano SJQEHRIWWERHMRGPYHMRKXLI½VWXGSQQIVGMEP still sounded too modern to our Clare performing Over My Shoulder recording of Vivienne ears, especially as our music quotes away from the traditional recital format. relationship between the narrative catholic plainsong melodies. With Haydn’s London Ladies knits together and the music. Not only do I enjoy oboe, trumpet and cello we not only the stories of various women who the historical research into character have a more appropriate sound world befriended Haydn during his two visits to and storyline, but also the process of for church and crown; we release London in the 1790s. Haydn has always structuring a successful piece so that the musicians to move with me in been considered a musical superstar but the audience’s attention is carried the space, and free the show to live among these ladies only Emma Hamilton easily on the narrative. in liturgical and historical venues that is still recognised. However the other Both Haydn’s London Ladies and Over contextualise the subject. 0EHMIW[IVIEPWSWMKRM½GERXSRXLI My Shoulder are un-staged, make use I’m particularly excited about 2018 London social scene, either on account of existing musical material and are because there’s going to be a lot of my of their husbands or their musical therefore relatively quick to assemble. own work going on. I will be reviving talents. As I researched those I already By contrast, the new staged works I have Vivienne; made in 2013, it is McCaldin knew about, a jobbing singer called produced through McCaldin Arts take Arts’ most successful piece. If all goes Harriet Abrams emerged from the considerably longer to make. This is not well, I will also be premiering Mary’s shadows and provided an important only because the material is newly-minted, Hand in 2018 and giving performances thread of story, as well as some rare but also because the making and editing of Haydn’s London Ladies and Over My musical items from her own pen. process involves more people. Shoulder. Three other projects are in In a similarly casual way, a friend These stage works are deliberately earlier stages of development and may messaged me with photos of two somewhere on the continuum between just have to take a back seat with all this gravestones in a churchyard in West a song-cycle and an opera. This leaves going on, although what usually happens London, which led to my second the door open to performing them when I get busy is that even the most entertainment, called Over My Shoulder. un-staged as well, increasing the preliminary ideas suddenly start to take Research revealed the careers and opportunities for that elusive second on fresh energy. Juggling all this with my strangely symmetrical life-stories of performance. It is important to design work at the Royal Opera and elsewhere Elisabeth Schumann and Jessie Matthews. XLIWIWXEKIHWLS[WXSFIEW¾I\MFPI is a challenge, and typical of the way in Both women were superstars in their as possible. Apart from the obvious which many musicians work these days. youth but are now almost unknown to correlation between scale and cost As the saying goes, if you want to get anyone under 60. I was able to trace (in development and performance) something done, ask a busy person. and meet Schumann’s grand-children, a show that doesn’t rely on a set and You can read more about any of one of whom supplied the musical rarity lighting can aspire to all kinds of spaces these projects at: mccaldinarts.com. in the programme – a song written by and venues, and hopefully have a For a full list of my performances, check conductor Otto Klemperer, with whom longer shelf-life. the ‘Forthcoming’ tab on my personal Schumann had a scandalous affair. The choice of instruments is another website: claremccaldin.com. I scripted Haydn’s London Ladies FMKJEGXSVMREGLMIZMRKXLMW¾I\MFMPMX]EW and Over My Shoulder myself and well as playing an important creative Clare McCaldin (1979-85) much of the pleasure in making them role. A singer and piano is a cheap claremccaldin.com LEWFIIRXLIVIWIEVGLXSVI½RIXLI combination in personnel terms; in mccaldinarts.com

44 • McCaldin Arts 20 YEARS OF CECILY’S FUND AT BEDALES

ecily was the third of our four Cdaughters to come to Bedales. She loved Bedales and Bedales loved her. I suspect all her contemporaries will remember her. When she left in 1996 she had a place at Cambridge but took a gap year working in Zambia. She was volunteering with a local NGO which was helping the community in Kitwe, Zambia’s second city, to care for the thousands of orphans created by the AIDS pandemic. Then on the 2 June 1997 she was killed in a car crash. She was 19. For her funeral in Oxfordshire we WEMH±+EVHIRSV[MPH¾S[IVWSRP]SV HSREXMSRWXS%-(7SVTLERWMR>EQFME² We were stunned to receive £6,500, including some from people who did not know us or Cecily, but had just seen the announcement in the press. We sent the money out to the Zambian NGO she had been working with. Then in early 1998 my wife and I went out to Zambia to seek closure in school and 20,000 children enabled contracting HIV. Those who get to the but also to see what they had done to complete their school education end of secondary education despite often with the money. We discovered that by an organisation which is still small appalling home situations are, by they had used it to put all the children and friendly but now thoroughly HI½RMXMSRTVIXX]WTIGMEP8LSWI[LSWTIRH on their books into primary school professional and well regarded in the a year as our ‘Peer Health Educators’ for one year. There and then we world of international development. become extraordinarily articulate and decided to make it our mission that Our main emphasis was, and still is, WIPJGSR½HIRX]SYRKTISTPI8LI]VIEPP] such children should continue to be to provide the absolute minimum needed are leadership material. able to go to school. Cecily was very to ensure that destitute children can AIDS in sub-Saharan Africa is not conscious that the education she had go to school – mainly fees but also, quite the public health catastrophe that received at Bedales was a privilege; she if necessary, pencils, school books, it was when we started and we hear a had wanted to start giving back; we uniforms, and in some cases, shoes. lot less about it in the developed world felt that continuing that work was the The need is as great as ever, but but it is still a massive social problem. best way to commemorate her. So we primary school fees have now been In Zambia the HIV adult prevalence established Cecily’s Fund. abolished. So now we concentrate on rate may be dropping slowly but is still Almost every autumn since then enabling children (particularly girls) to a mind boggling 12.7% and people are I have been coming back to Bedales stay in secondary where there are still still dying of AIDS. Moreover, because it to tell the Cecily’s Fund story to fees. We are currently supporting just is sexually transmitted, those who die succeeding generations of Bedalians over 3,000 children. are the parents. and Bedalian parents at the St Cecilia’s We help prepare them for economic Children who are orphans still Day concert. life after school and we work to constitute about 10% of the total As the years have gone by, so the strengthen community support for their population. Only Zimbabwe has a higher story I have told has become more and education. We also have programmes percentage. Because it may be years more positive. The story still starts with to help them to succeed in school before a parent who has contracted a tragedy, but two months ago when and we train up to 50 of our best HIV develops full blown AIDS the we marked the Fund’s 20th birthday secondary school leavers each year risk of a child becoming an orphan we had a lot to celebrate. Well over and deploy them back into the schools increases as that child goes through 80,000 years of support for students to teach other children how to avoid school. That is why in Zambia 24% of

20 Years of Cecily’s Fund at Bedales • 45 20 YEARS OF CECILY’S FUND AT BEDALES

children between 15 and 17 years of those hardest hit by HIV/AIDS. School age have lost one or both parents. is the ladder up which they can climb In Africa the extended family is the only out of the destitution to which they are social security system. Orphans often otherwise condemned. They know it have little or no such support. and are very grateful. Last year my wife and I took a We know that we have many group of supporters out to Zambia years of work ahead of us. Education to see for themselves what we do. is a marathon, not a sprint. I hope They were blown away by the whole that Bedalians, both old and new, experience. As one of them put it: VIQIQFIVMRKXLIFIRI½XWSJXLIMVS[R “Cecily’s Fund has made a huge education can continue to help us give difference to so many young people these children hope. and it was inspirational to see what Our website (www.cecilysfund.org) MWFIMRKEGLMIZIH² KMZIWQSVIHIXEMPW3YVPMXXPISJ½GIMR It is vital that these girls and boys Oxfordshire will be delighted to supply should be able to continue school. material if, for example, you want to School gives them emotional support, put us forward as ‘charity of the year’ skills to earn a living, information about to your employer, school, business etc. LS[XSWXE]LIEPXL]ERHXLIGSR½HIRGI to act on that information. They are Basil Eastwood, father of Alice (1985-90), the poorest of the poor, in one of the Verity (1986-91), Cecily (1991-96) world’s poorest countries and one of and Philippa (1992-95)

father died of HIV and AIDS. I was in In 2010 I completed my grade 12, grade six. It was very painful because and, as I was waiting for my results, he was the one whom the family were I was recruited as a peer educator looking to for survival. for 2011. It was nice to be a peer In 2006 I passed the exam into educator because we were learning grade eight (ie middle school where fees about real life situations and also are charged). I started going to school teaching others on real life situations, FYXMX[EWZIV]HMJ½GYPXJSVQ]QSXLIV WTIGM½GEPP]SR,-:ERHTIIVTVIWWYVI to pay the fees for me. We tried all we among youths. GSYPHXS½RHQSRI]F]WIPPMRKFVSSQW In 2011 the KVEHII\EQ In 2007 I was chased out of the results came out. They were good school because my mother failed to pay and I was accepted at Mufulira my school fees and I stayed at home College of Education and I was for two weeks without going to school. given 100% college sponsorship by But then Madam Chipowe, my grade Cecily’s Fund. teacher came to my place and asked In 2013 my mother also died of Mwandwe’s Story my mother why I was not going to HIV and AIDS. school. My Mamy explained everything In 2014 I completed my course y full names are Mwandwe to her, and Madam Chipowe told me to and in 2015 I was employed by MJackson Kalonga. I was born on go back to school and included me the government. 1E]-EQXLI½VWXFSVRMR on Cecily’s Fund sponsorship. Without the sponsorship from EJEQMP]SJ½ZIXLVIIKMVPWERHX[S Furthermore, the coming in of Cecily’s Fund I would have been boys. I started school in 2000 at Cecily’s Fund sponsorship was very a street kid, but now I’m looking Kamatipa Primary School in Kitwe WMKRM½GERXFIGEYWI-RIZIVXLSYKLX-[MPP after my brother and my sisters. district of the Copperbelt Province. go back to school. I was put on 100% THANKS. Everything was well with me and sponsorship and at the same time I was the family until in 2004 when my receiving school books and uniforms. Mwandwe Jackson Kalonga

46 • 20 Years of Cecily’s Fund at Bedales 2017 IN THE ARCHIVES

R[LIR-½VWXWXEVXIHXSLIPT 0MFVEV]SJ½GI8LIVIEVHSSVXSXLISJ½GI I(IRRMW%VGLIV WXEJJ has been bricked up, which should allow catalogue the Archive, I used to lay us a little bit more shelf space. We are things out on the Lupton Hall stage hoping that many of Mr and Mrs Badley’s in order to sort them, and was always personal books will eventually be kept saddened by the fact that it was no in bespoke bookcases in the new seminar longer the heart of the school as it room, thereby freeing up more shelf was when I was a pupil. I have been WTEGIMRXLI0MFVEV]SJ½GI even more conscious of this during the Building works don’t stop enquirers nine years that I have been working contacting us. A researcher from Francis as Librarian. I was therefore delighted Bacon’s estate asked about the time when the refurbishment project was that he rented The Lodge during WW2 proposed, and enjoyed digging out old and was delighted when I was able to photographs for the architects. I might send her scans of the correspondence have been less co-operative if I had between him, the head and the bursar. realised at that stage that we would There is a lovely note from Bacon to lose some of the space we used to Mr and Mrs Meier, inviting them to tea store the Archive, but I must say that ¯SLXSLEZIFIIRE¾]SRXLI[EPP the Hall is now looking wonderful. We charged him £53 p.a. rent – perhaps Most of our holdings had to be we should have asked for a couple of moved during the refurbishment. For paintings instead. those of you who haven’t visited the Another enquirer rang to ask if Library in many years, I should explain she had, in fact, seen a production of that the Archive was housed in a room Bridget Boland’s play Cockpit in the FILMRHXLI0MFVEV]SJ½GI8LIVSSQ late 1950s here, as the Royal Lyceum was created by walling in the space Theatre in Edinburgh claimed that it where, at least when I was at school, had not been produced in the UK we used to keep music stands and WMRGI-[EWEFPIXSGSR½VQLIV anything else that might be needed in recollection and sent her (and the the Lupton Hall. When Dennis took on Lyceum) a scan of the programme. XLITSWXSJ%PYQRM3J½GIVXLMWVSSQ Remembrance Sunday has just became his domain, and it could be passed, and our World War One accessed through a small storage area project continues. Ruth Whiting (staff FILMRHXLI0MFVEV]SJ½GIERHXLIR 1963-2000) is still researching the lives across the passage that serves as the of each Bedalian killed during the war, ½VII\MX ERHRS[HMWEFPIHEGGIWW JSV and on the centenary of their deaths XLI0YTXSR,EPP8LISPH³%VGLMZISJ½GI´ the information she has discovered is is to be a new seminar room. displayed in the Library and published of her former pupils – Jeffrey Cornish At the time of writing, some of our on the website (www.bedales.org.uk/ (OB 1972-77). archive materials have been rehoused in home/history-bedales/ww1). The web Our digitisation project continues, a storeroom off the dining hall but others of connections between the early but there are many years yet of EVIWXMPPFIMRKWXSVIHMRERIQTX]WXEJJ¾EX Bedalian families is endlessly fascinating. The Chronicle and The Bedales Record [LMPI[I[EMXJSVXLI½REPVI½XSJXLI External enquirers also continue to to digitise, and we are entirely reliant contact us to ask about WW1 deaths, on donations. Please do have a browse often because they have found Ruth’s of those that have been done so far, TVS½PISJXLIMVVIPEXMSR6YXLYWIW and consider a small donation towards sources such as Ancestry to help her the preservation of the magazines in her research and was particularly of your era. See the Digital Archives: impressed by one set of records bedalesschools.daisy.websds.net. that were impeccably referenced. On contacting the author she was Jane Kirby (née Williams, 1974-79) delighted to learn that it was one Bedales Librarian and Archivist

2017 in the Archives • 47 STAFF PROFILES

Keith Budge (Headmaster 2001-18) Scottish and Welsh forebears, and always sit on the fence initially during VYKF]QEXGLIWFIX[IIRXLSWIWMHIW² Keith explains. “The Scottish part of the family, largely of farming stock, was a bit concerned by all this reading that I was apparently doing but the truth was I had been inspired by a brilliant, charismatic English teacher called Brian 7PSYKL[LS[EWXLI½VWXTIVWSRXS mark my work properly and make me really understand the possibilities offered by the subject. So there was the English and the rugby, which I played for the school, but, perhaps curiously, the thing that I found most rewarding was writing and directing an irreverent pantomime, from which the staff had to be kept away because of its VEXLIVVMWUYqIRHMRK² Although by his own admission RSXERIWTIGMEPP]VI¾IGXMZIEHSPIWGIRX Keith’s thoughts were imperceptibly leading him towards a future career in education. “At that point, I was just doing whatever was in front of me at o understand the headmaster /IMXLVI¾IGXW±8SKMZI]SYERI\EQTPI XLIXMQI²LIWE]W±-KSXMRXS9RMZIVWMX] Tthat Keith Budge has become, he would allow roller-skating to take College Oxford to read English and MXMWTVSFEFP]½VWXRIGIWWEV]XSXEOI place indoors at certain times of the ½PPIHMRXLIXMQIFIJSVIKSMRKYTXLIVI the reader back to Rossall School in day, always provided that the one-way by travelling around Africa and the US Lancashire, Keith’s alma mater and the system that he instituted was observed! and basically doing stuff on my own place where so much of his thinking 1]½VWXLIEHQEWXIVSJXLIQEMRWGLSSP with the full backing of my parents, who about education was shaped. Rossall was Roger Ellis, a notably liberal man always were very good at letting me do always had a reputation for toughness, who became quite a mentor to me. To Q]S[RXLMRK² JSVFIMRKEQSRKXLI½VWXWGLSSPWXS some extent, we were still being trained At Oxford, academia was just a part ½IPHE'SQFMRIH'EHIX*SVGIERH at Rossall to run an empire over which of Keith’s list of achievements. Among for producing formidable rugby teams. the sun had long since set and if you the most notable were his three rugby However, there was another side to were OK at sport and OK academically, Blues, which would eventually lead a place where practical astronomy you could thrive there. I was OK at to an invitation to play for London was offered and emphasised as a both, although I should emphasise that Scottish, where, as a lock, he would subject and later, the International there were three ways of achieving pack down in one of the strongest &EGGEPEYVIEXIJSYRHSRISJMXW½VWX at school – sport, work and crime; sides in Britain during the early 1980s homes in England. I certainly felt drawn to classmates who alongside luminaries of the game such A liberal spirit among the teachers WTIGMEPMWIHMRXLIPEWXSJXLSWI² as Mike Biggar and Alastair McHarg. of Rossall was far from unknown, Despite being somewhat out of Meanwhile, his contemporaries were then, not least in the person of Keith’s sympathy with Roger Ellis’s successor, assuming that he was clearly future own father, who was an inspirational John Sharp, Keith rose to the heights teacher material. “I did make various head of the preparatory school at of head boy and, against the grain half-hearted applications to various Rossall for a number of years before of his family of historians, set his merchant banks and the BBC but it his untimely death. “Dad was a great sights on achieving a place at Oxford became increasingly obvious to me that liberal, who didn’t believe in preventing 9RMZIVWMX]XSVIEH)RKPMWL±-´QHI½RMXIP] teaching was where I could make the GLMPHVIRJVSQIRNS]MRKXLIQWIPZIW² a member of the Celtic fringe, with KVIEXIWXMQTEGX²/IMXLSFWIVZIW

48ˆ7XEJJ4VS½PIW STAFF PROFILES

Keith’s career nearly failed to Marlborough’s liberal experiment was A year’s teaching exchange in make it out of the starting blocks, hanging on rather uneasily; reform was California during his Marlborough however. “I was hugely unimpressed in the air throughout the independent sojourn was another important by the time I spent working for my schools system but Marlborough, it building block in Keith’s career: “It was 4+') TSWXKVEHYEXIGIVXM½GEXISJ seemed to me, was going only halfway probably a bit cheeky of me to ask, IHYGEXMSR ²LIVIZIEPW±8LI3\JSVH towards embracing the wind of change. but I felt that it was something that English department in those days was A school ultimately needs to be one I needed to do. The Robert Louis overseen by Chris Woodhead, later thing or the other and Marlborough, Stevenson School in Pebble Beach the Chief Inspector of Schools, and understandably, given its traditional was a non-uniform school at which I the politically correct aspects of it clientele, didn’t quite have the courage was seen as the eccentric resident Brit so thoroughly cheesed me off that I of its convictions. It went fully co-ed but but I learned so much there, not least wanted nothing whatever to do with this tended to mask later leadership about fundraising and different roles XLITVSJIWWMSRSRGI-´H½RMWLIHXLI XLEX[IRXE[V]² [MXLMRWIRMSVQEREKIQIRX² course. As luck would have it, a history During his 11 years at Marlborough, Not long after his return, Keith felt don that I knew called Leslie Mitchell /IMXLKSXLMW½VWXI\TIVMIRGISJ he was ready to take on the challenge was also a governor at Eastbourne educational administration as the of running a school in his own right. College and he told me that there was housemaster of Cotton House. There was one stipulation: “I wanted a vacancy in the English department “Named after a legendary former to be the head of a school in the there. What I found totally rekindled head, Bishop Cotton, who apparently north of England or Scotland because Q]IRXLYWMEWQJSVXIEGLMRK² drowned in the Hooghly River in I wanted our children to have the “At the start of the 1980s, -RHME²/IMXLKVMRW±;I[IVINYWXLEZMRK experience of living in a different part of Eastbourne was only co-ed in the sixth our third child at the time so it was XLIGSYRXV]²LIWE]W±-LEHERIEVQMWW form but it was a wonderfully unstuffy incredibly busy but being in charge with Sedbergh, which might have been EXQSWTLIVIMR[LMGLXSXIEGL²/IMXL of Cotton was like running your own just as well, but the post came up continues. “The English department was small school. Cotton needed serious at Loretto School in Edinburgh and a particularly strong one – I could see re-development as a boarding house possibly in a slight nod to my Scottish that it was possible to have fun, throw and we decanted the entire house LIVMXEKI-HIGMHIHXSXEOIMX² in trips to Stratford and places like that into an unused building while that It would be a sobering experience and still be rigorous and I particularly re-development took place. As I say, for the tyro headmaster, who enjoyed the challenge of teaching it was very busy, but great fun and my soon became aware of potential the kids who found the subject a bit S[RTIVWSREP½IJHSQJSVE[LMPI² disagreements with the Board of tougher. Eastbourne had a few other things going for it as well – fellow Oxford Blue, Euan Clarke and I shared the rugby coaching for the 1st XV and I was allowed to take the weekends to carry on playing for London Scottish. It was a great place for a new teacher XSGYXLMWXIIXL² Having got married in 1983 to the delightfully nicknamed Moony, the vacancy for an English teacher at Marlborough College that appeared the following year seemed to Keith to represent propitious timing. “My old mentor from Rossall, Roger Ellis was still in situ as headmaster at Marlborough, and although he was coming to the end of his tenure, I was very enthusiastic about the idea of NSMRMRKLMQXLIVI²/IMXLVIGEPPW±-X[EW an interesting time to be going because

7XEJJ4VS½PIWˆ49 STAFF PROFILES

community with a clear sense of its own identity. “Cultural change in a community like Bedales is a slow thing and you can easily kill the golden goose of atmosphere and ethos through XSSQYGLVEHMGEPGLERKI²/IMXL acknowledges. “My instinct, helped by some very good advice from key quarters, was to demonstrate direction of travel, generate excitement and expectations and show that being on the bus was better than lurking in the shadows or trying to stand in its way. Most got the message – some moved SJJJVYMXJYPP]ERHXSQYXYEPWEXMWJEGXMSR² An initial priority for Keith was to ascertain views from across the school on a full spectrum of topics, for which task the market research company Ratcliffe Hall conducted a survey of all Governors. “Loretto had been co-ed the traditional boarding school route. parents before he took up the post. in the sixth form since the early ‘80s I was always a believer that as the head “They told me that they’d never come but the Board had no females at all on of a school, personal example matters EGVSWWWYGLHMZIVWMX]SJZMI[WER][LIVI² it and in fact comprised nothing but hugely – you have to be part of a place, Keith recalls, “and that as it would be SPHFS]W²/IMXLVIPEXIW±8LIHIGMWMSR PMZIMXIRKEKI[MXLXLITISTPI]SY½RH impossible to accommodate all of them, was then made to go fully co-ed and there, be candid and excite people I shouldn’t try to. In some ways this XLI½VWX=IEVKMVPWEVVMZIH[MXLQIMR about its potential. I still felt that I knew rather suited me – as a headteacher 1995 but this did little to change the what I was good at and also that I could you have to make decisions that are school’s entrenched culture. The heart MHIRXMJ]XEPIRXWMRSXLIVTISTPI² sometimes unpopular and I now felt of some people was clearly not in a (YVMRKLMW½REPXIVQEX0SVIXXS that some bold steps had to be taken. properly mixed school, which meant Keith received a call from Bedales I had a private talk with each member that the girls were being regarded about its impending headteacher of staff and saw that while the school had as fee-fodder in certain quarters. vacancy while he was on the ninth tee so much to recommend it, there were Recruitment was tough – we had to at Portmarnock on the Dornoch Firth. some areas in which the reputation was look overseas, which generally went “I knew a bit about the place, both a bit shaky. Just because certain aspects down badly with the old guard – from its general reputation and from of school life had worked in the 1970s and although there were some very 4EXVMGO2SFIW´ ,IEHQEWXIV was no reason not to change them happy times at Loretto, eventually I son, Guy, who had followed me as a where necessary in the very different realised that for the good of everyone, XIEGLIVEX1EVPFSVSYKL²/IMXLI\TPEMRW environment of the 2000s. I do recall I needed to move. The slightly odd “It sounded interesting to me from the XLEXQ]½VWX,IEHQEWXIV´W5YIWXMSR thing was that before Loretto, I was word go. Here was a school clearly Time was held in front of the school occasionally looked on at various prepared to live out its convictions at a inspectors in February 2002, which was schools as something of a meat-head time when the writing was on the wall quite a bold thing to do – I think that I who happened to teach a bit of English; for conventional boarding school mores. QYWXUYMXIIRNS]XLI[LMJJSJGSVHMXI² at Loretto, I was seen by some as an Bedales kids stood out a mile away Some traditions were quickly etiolated aesthete…I wouldn’t say and I thought that leading the school dispensed with. “One was Martin’s Game, that I have ever placed myself in either GSYPHFIEQEVZIPPSYWGLEPPIRKI² which was essentially a bacchanalia of GEXIKSV]F]XLI[E]² Having taken a year out after dressing up, lip-synching with guitars ,MW½ZI]IEVWEX0SVIXXSLEHXEYKLX leaving Loretto, Keith became the and impressing everyone with how Keith a number of salutary lessons. ninth headteacher of Bedales in outrageous each performer’s innuendo “It also helped me and Moony to make September 2001 and began to apply GSYPHFI²/IMXLVIGEPPW±-GSYPHR´X up our minds that we had now done himself to the task of winning over a decide whether to stop it but seeing

50ˆ7XEJJ4VS½PIW STAFF PROFILES

it once was enough for me; I got rid and the increasing awareness of its VEXLIVXLERXSSPMXXPI²LIZIRXYVIW of it and suggested that the students contribution to leadership and overall “Some students who have come to do something genuinely creative – well-being are now widely accepted, Bedales have been through some and so the Rock Concert started. I think. I reorganised the sport about pretty tough experiences elsewhere There were one or two fairly stormy three years ago so that its focus is to and one of my main tasks here has assemblies in which I pointed out that develop skills across the 3-18 year been to judge whether they are open respect has to be earned and is a group and, all being well, we should see to the wonderful, redemptive capacity two-way street, while freedom brings some youngsters coming through and that the school possesses. I would responsibilities in its wake. There’s no demonstrating those skills as this bears like to think that if ever I erred in my doubt that there was a lot of drinking fruit, just as we do in music. Rugby, judgement, it was on the positive side around the school at the beginning though, isn’t the right sport for Bedales. ¯XVYWXMRKXSSQYGL² and it had to be tackled, if not entirely Numbers are a big factor; losing at “Bedales does still weave its magic by the students’ self-restraint, then by rugby is also often humiliating and on people and my observation is that deploying breathalysers, which is what physically hazardous – mismatches can the 17 or 18 year-old leaver of today [IWYFWIUYIRXP]HMH² be disastrous – and getting the level is a little more attuned to the world’s On the academic front, meanwhile, of opposition right is very much easier expectations. I think that more students Keith was setting in train the process [MXLWSGGIVERHLSGOI]² work a bit harder – although there by which Bedales would eventually It is never easy to decide when to may still be one or two too many introduce the Bedales Assessed Courses step away from a place that has been who expect to pull things off at the (BACs) – more stretching and imaginative a part of your life for nearly seventeen last minute and eschew some of the alternatives to GCSEs, which he sees years but Keith has no doubts that his less glamorous sides of hard academic as having been a catalyst for learning decision to retire from Bedales in the work. We have increased expectations in the school and the clearest emblem summer of 2018 is the correct one. of student behaviour and accountability of its commitment to developing “In every way, it’s the right thing for me without, I hope, diminishing their inquisitive thinkers with a love of ERHJSVXLIWGLSSP²LIWE]W±ERHMX´WXLI independence of spirit or their curiosity. learning. “Bearing in mind their impact ideal time for someone else to come in Times change but despite that, I suspect on the school, the BACs are probably and put their own mark on the place, that the Bedales leaver of 2017 or the single measure of which I’m most NYWXEW-LEZIFIIRPYGO]IRSYKLXSHS² 2018 still has masses in common with TVSYHHYVMRKQ]XMQIEX&IHEPIW²/IMXL So how would Keith like to be XLIPIEZIVSJSV² muses, although he has also enjoyed remembered by his colleagues and his continuing work as a hands-on students? “I hope that people think of James Fairweather, husband of English teacher of Block 1 students me as someone who trusted too much, Kate Fairweather (née Day, 1980-85) at Dunhurst and Block 3 Bedalians. “Our reputation across maths and the sciences, as well as in our traditional powerhouse arts subjects, took a leap forward, thanks to a group of really inspirational teachers and we had several years when our Oxbridge offer VEXILSZIVIHEVSYRHXLI QEVO² As societies, clubs, music and drama GSRXMRYIHXS¾SYVMWLEX&IHEPIWYRHIV Keith’s stewardship, so too did sport take a more prominent role in the school’s life, although his own great passion of rugby remained on the outside. “I’d like to think that sport now has its fair place at the table of other co-curricular things like music and drama, rather than being the poor GSYWMREWMX[EW[LIR-WXEVXIH²LI says. “Its role in developing teamwork

7XEJJ4VS½PIWˆ51 STAFF PROFILES

Wendy Hudson (née Sanger, staff 1995-present) MRGPYHMRKSYVS[RXIEQ²WLIWE]W “We needed a leader to head up the “ never realised what a beautiful place exams and admin team and Carol IBedales was until I arrived for my job Ward (staff 2011-13)[EWXLI½VWX MRXIVZMI[²VI¾IGXW;IRH],YHWSREW manager we had before Liz Leeming she casts her mind back over a period took over in 2014. I always like to think of service to the school that has now that the admin team is one of the best extended well beyond 20 years. “I was MRXLIWGLSSP-XHI½RMXIP]VI¾IGXWXLI born in Epsom and brought up in Bedales ethos of being a team player, Cornwall but even when I arrived in SVKERMWIH¾I\MFPIERHIEW]KSMRK² Hampshire, it was to work with E Merck As the school has continued to Pharmaceuticals in Four Marks and I grow, so Wendy has become more didn’t have much cause to head down aware of the pace of change around in the general direction of Bedales so her. “Lives have got so much busier and -LEHRSMHIESJ[LEXXSI\TIGX² everyone has so much more on their Wendy had spent some six TPEXIXSHE]²WLISFWIVZIW±8LISRI years working on the licensing of down side about that is that it’s almost pharmaceutical products before Merck impossible to know the names of every HIGMHIHXSGPSWIMXWSJ½GIMR*SYV student or staff member with whom Marks and focus on its headquarters you’re likely to come into contact, which in West Drayton. Suddenly, it was and students really suited me and there I certainly did during my early days MQTIVEXMZIXLEX;IRH]WLSYPH½RH were so many different characters here. Technology has transformed our herself alternative employment. around that I was a little bit in awe of lives but that’s a double-edged sword “There was an ad in the local paper WSQISJXLIQEX½VWX² as well; it makes lives so much easier XLEXGEYKLXQ]I]I²;IRH]I\TPEMRW As the role of the bursar started in lots of ways but the immediacy of “Bedales was looking for someone to to change over the years, so did the modern communications is endless – provide maternity leave cover in the requirements of his secretary. “It became you can always be reached at any time HIZIPSTQIRXSJ½GI[MXLETEVXMGYPEV a bit more about HR skills, which was of the day. Change is mostly a good focus on fundraising for the new RSXQ]EVIESJI\TIVXMWI²;IRH] thing, though. When people do things theatre that was about to be built. says. “Things were changing across the differently, you have to step back, forget I went along for the interview, talked school in a gradual sort of way and your own opinion and look at the bigger to John Fleming (former staff), who I started to see a lot of the different picture that they’re trying to achieve. For was development director at the time, angles of Bedales. I left the bursar’s all of us, it’s going to be so interesting to and &VYGI1SSVI WXEJJ , SJ½GIXS[SVOEXVIGITXMSRERH[LIR see the effect of a new head on both the bursar, and started what seemed email and the internet were introduced, Bedales and Dunannie in 2018. We to me to be an exciting new adventure I was the person with the responsibility can’t know exactly what the future will XLEXQMKLXPEWXJSVWM\QSRXLW² for the single email address that was LSPHERHXLEX´WUYMXIERI\GMXMRKXLMRK² This was 1995, those far-off days used by the whole school. Reception Over the past few years, Wendy’s before the advent of email and internet, was great; we moved into the new life at the school has maintained its and Wendy’s various administrative building and there was always someone remarkable variety. Together with skills were immediately put to good dropping by – students, staff, parents, (IRRMW%VGLIV WXEJJ , she use on the telephone as Bedales’ deliveries and so on – which was helped to produce and disseminate the application for funding from the new perfect for me. I’m always happiest OB newsletter and for some time, she National Lottery went in. After just [LIR-´QEVSYRHSXLIVTISTPI² PMZIHSRWMXIEX7XIITLYVWXEWXLI½VWX three months in the development ;IRH]´WIRZMEFP]¾I\MFPIREXYVI non-teaching house tutor in Bedales SJ½GI&VYGI1SSVIMRZMXIH;IRH] continued to stand Bedales in good LMWXSV]±-EFWSPYXIP]PSZIHXLEXVSPI² to apply for the vacant position as his stead as her list of responsibilities she says. “There was a job in which I secretary, a role that was soon hers and continued to expand. She now added did know the name of every student, would continue to be so for the next the role of exam administrator to her which was something that I always ten years. “I loved the fact that I was portfolio: “That had always previously TEVXMGYPEVP]ZEPYIH²;IRH]MWUYMIXP] RS[VMKLXEXXLILIEVXSJXLIWGLSSP² been led by the teaching staff, but pleased, too, with her own reputation she says. “Lots of contact with the staff everything was growing at the school, within the school as someone who

52ˆ7XEJJ4VS½PIW STAFF PROFILES

stands for no-nonsense. “I know that some people regard me as a slightly scary character at times and it’s true XLEX-GERFIEFMXTIHERXMGEXXMQIW² she chuckles. “I respect the students greatly but I do expect the same in return and questions need to be asked in the right way or they’re likely to get E¾MTTERXERW[IV² Wendy is part of the Bedales furniture now and is as well placed as most to attempt to explain how the school’s magic works. “Bedales is a singular place and it doesn’t work for IZIV]SRI²WLIFIKMRW±2SXIZIV]FSH] stays as long as me! When people do ‘get’ the place, though, they tend to remain here for many years. I think it’s all about the heart and soul of the place, a fabulous environment in which to work where everyone looks after each other. It’s still the contact massive range of characters that live know where I will settle eventually with people that gives me my greatest ERH[SVOLIVI² but Cornwall, where I grew up, is still satisfaction here. I may not be the Looking too far ahead into the future a very special place to me. That was life and soul of every gathering but I is not Wendy’s style. “I can’t say that I’ve the carefree time of no responsibility do like to be involved and to know given the future or other ambitions a and it’s still the place to which I like to what’s going on. That has always been KVIEXHIEPSJXLSYKLX²WLIQYWIW±-HMH return when I’m in need of peace, the case for me at Bedales and I do apply for one or two other jobs during UYMIXERHEFMXSJGSQJSVX² appreciate it. The great beauty of the my time here but they didn’t happen school, I believe, is the way in which and in retrospect, I’m very glad about James Fairweather, husband of it brings out the diversity of the that. This place just works for me. I don’t Kate Fairweather (née Day, 1980-85)

7XEJJ4VS½PIWˆ53 NEWS IN BRIEF

Kemi Williams (1982-84) has started …Lisa Jackson (1992-97) who had her new job as Deputy Head of the part of Mina in the series. Her the Department for International brother Mark Jackson (1989-94) is (IZIPSTQIRXSJ½GIMR-WPEQEFEHSRI 7IRMSV0IGXYVIVMR*MRI%VX'VMXMGEP of the largest in the world. She has a 8LISV]ERH'YVEXSVMEP4VEGXMGIEX staff of 114 and oversees spending of Northumbria University. £370 million per annum. 1IER[LMPIWMWXIVKatie Jackson (aka Tom Wolseley’s (1982-89)I\LMFMXMSR Cat Savage, 1987-92) has taken up a Sarah Dodds (née Stewart, 1968-73) Vertical HorizonsMRGPYHIHERI\XIRWMZI JYPPXMQIXIEGLMRKERHVIWIEVGLVSPIEX ERHLIVFVSXLIVTim Stewart (1970-75) video and summarised two years of 9'0EW,SRSVEV]4VSJIWWSVSJ2EZEP LEZIWXEVXIHEFYWMRIWWGEPPIHSkymeadows WXYH]MRKXLIMQTEGXSJ8LI7LEVHSR %VGLMXIGXYVI7LIMWEPWSE*IPPS[SJXLI Limited8LI]LEZIGVIEXIHLERHQEHI its surroundings. 6S]EP-RWXMXYXMSRSJ2EZEP%VGLMXIGXW [IEXLIVTVSSJ¾SVEPEVGL[E][EPOWERH FEGOHVSTWJSVLMVIXEVKIXMRK[IHHMRKW Piers Baker-Bates (1989-94) is Visiting and events… 6IWIEVGL%WWSGMEXIMR%VX,MWXSV]EX XLI3TIR9RMZIVWMX]ERHQSWXVIGIRXP] ©MRXLMWXVYP]&IHEPMERIRXIVTVMWI[MXL author of Sebastiano del Piombo and FVSXLIVMathew Stewart (1973-80) the World of Spanish Rome. as their independent marketing advisor. Fiona Morris (1970-75) is the Roly Botha (2010-15) has enjoyed administrative assistant. Jesse Morris KVIEXWYGGIWWEWXLIPIEHGLEVEGXIV (2008-11) uses his engineering skills to Shane in Strangers in Between at LIPT[MXLTVSHYGXHIZIPSTQIRXERH ZEVMSYWZIRYIWEVSYRH0SRHSR½RMWLMRK Sam Morris (2005-10)SZIVWIIWWSGMEP YTMRXLI;IWX)RHQSWXVIGIRXP] media marketing.

(YVMRKXLITEWX]IEVAlexandra Harwood (1977-84)LEWGSQTSWIH XLIWGSVIJSVThe EscapeE½PQHYI Carmela Corbett (2002-07) made her JSVVIPIEWIMRERH[VMXXIRJSYV London professional theatre debut as GSRGIVXTMIGIWJSVXLIGLEQFIVKVSYT Sheila Birling in An Inspector Calls at the i MusicantiJSVXLIMVGSRGIVX 4PE]LSYWI8LIEXVI WIEWSR7LIMWGYVVIRXP]WGSVMRKEJIEXYVI ½PQThe Guernsey Literary and Potato Peel Pie SocietyJSVVIPIEWIMR%TVMP Lucy North (1974-79)XVERWPEXIH JVSQXLI.ETERIWISVMKMREPRecord of a Night Too Brief by Hiromi Kawakami. Karen Wallis (née Mills, 1958-62) 8LMWZSPYQIMRGPYHIWXLVIIWLSVX LEWFIIRER%VXMWXMR6IWMHIRGISR WXSVMIW[LMGLXSKIXLIV[SRXLI XLI2IWWSJ&VSHKEVI\GEZEXMSRW %OYXEKE[E4VM^IMR4YFPMWLIH SR3VORI]WMRGIERH[MPPFI F]4YWLOMR4VIWW VIXYVRMRKEKEMRMR,IVJSGYWMW SRLYQEREGXMZMX]¯FSXLXLI[SVOSJ EVGLEISPSKMWXWMRXLITVIWIRXERHXLI Lydia Leonard (1995-99)¯±SRISJXLI Pennie Denton’s (née Player, 1951-57) XVEGIWSJXLI2ISPMXLMGTEWX QSWXMRXIVIWXMRKEGXSVWGYVVIRXP]SR new house in Swanage was one of WXEKI²¯VIGIMZIHKVIEXEGGPEMQJSVLIV XLSWIWLSVXPMWXIHF]E6-&%NYV]JSV TIVJSVQERGIMROslo at the Lyttleton. the House of the YearGSQTIXMXMSR Mary Ann Sieghart (1975-77) has been 7LILEWEPWSFIIRETTIEVMRKMR&&' She didn’t win but the house was ETTSMRXIHE:MWMXMRK*IPPS[SJ%PP7SYPW GSQIH]Quacks alongside… JIEXYVIHSR8: 'SPPIKI3\JSVHJSVXLIRI\XEGEHIQMG ]IEV7LI[MPPFIVIWIEVGLMRKEFSSO

54 • News in Brief NEWS IN BRIEF

on why women are often not taken as Isobel David (2004-06) is part of seriously as men, why subconscious bias Fight in the Dog, a company which means we accord women less authority creates and produces theatre and and what can be done about it. comedy. She also works for a West End company producing and commissioning ‘commercial’ theatre – “a slightly more Hugo Burge (1985-90) has been trying VIPMEFPIWSYVGISJMRGSQI² XSSVKERMWIXLITVSHYGXMSRSJE½PQ about the work of Lawrence Neil, the maker of those library chairs you spent Arthur Snell (1989-94), ‘a former so much of your youth slouching in. GSYRXIVXIVVSVMWQSJ½GIVEXXLI*SVIMKR 3J½GI´[EWMRXIVZMI[IHFVMI¾]SR .MPP4IEVG]  has received Radio 4 Today programme about the Leah Mason (2004-09) released her the freedom of the City of London. Manchester bombing. debut single Gold Angel under her This gives her, amongst other things, new moniker ‘Minke’. The track was the freedom to drive a sheep across produced by Rory Andrew (2002-05). Juliet Auburn (née Whitaker, 1977-82) London Bridge. Here you see her has been running a fox sanctuary in exercising her rights liberally. her back garden for some time. She Karole Vail (1974-76) was appointed is actively seeking better premises to as director of the Peggy Guggenheim Zinnie Harris (née Shaw, 1985-90) expand her operation. Collection in Venice, and the director had no fewer than three plays in the of the Solomon R. Guggenheim 2017 Edinburgh Festival, including her Foundation for Italy. new play Meet Me At Dawn, a modern take on Orpheus and Eurydice. Olivia Shirville (née Harrisson, 1995-98) has moved out of London and back to Alexandrina Hemsley (2000-05) is 4IXIVW½IPH3RXLIWEQIHE]WLI[EW part of the Project O team, which has offered a new job as Data Protection had work commissioned by Sadlers Solicitor for HSBC, so is now enjoying a Wells and performed at the Lillian commute to Canary Wharf. Baylis Theatre.

Guy Wilmot Roxanna Panufnik’s (1982-86) new (1993-98) is opera Silver Birch was premiered marketing shade at Garsington Opera in late July. It grown, organic, included a contribution from her fairtrade and dance-music producer brother, bird-friendly coffee, Jem Panufnik (1981-88). including Bird & Wild, the RSPBs Helen Rawnson (née Sanders, 1993-98) SJ½GMEPGSJJII,IMW Eve Allin’s (2011-16) play Charge was was declared ‘Teacher of the Year’ also running Marley performed at Warwick University in for Salisbury following voting by Coffee in Europe and has launched his the spring. delighted parents in her primary school, own coffee brand, Decadent Decaf. Winterbourne Earls. 4EXVMGO)VHEP  has built .EGO1EVXMR  has returned himself a house in rural Perthshire. Ed Ellison (2003-08) has been working from New Zealand to start up a new As Chairman of the Scottish Schools at KPMG in the corporate intelligence business, Tom Parker’s Creamery, Snowsports Association, he will be team since 2014, specialising in political named after his great-grandfather, using leading the Scottish Schools Alpine VMWOERH½RERGMEPGVMQI,ILEWXEYKLX milk from his family’s farm. Could go Team to the World Schools Winter a course there on open source well with Guy Wilmot’s coffee. Games at Grenoble in February 2018. intelligence research methods.

News in Brief • 55 NEWS IN BRIEF

John Bassett (1946-50) delivered a Andrew King (1976-81) and partner lecture, with movie illustrations, to about Nana Takahashi form the pop duo 300 of the University of the Third Age Bonbon. They have released a new students about the initial history and six album Pop Overdrive¯±EWIP½ITSTEVX year run of Beyond the Fringe. QYWMGQEWXIVTMIGI²

Philippa Rowland (1979-81) was Paradox Theatre Co. is a new company invited to the Sommet de Conscience in co-founded by %Q]&PEOIPSGO  . Fez and attended '34 in Marrakesh, After three years performing, writing where a strong Interfaith Statement and directing at Exeter University, Amy was delivered from 304 eminent faith took their latest play Firewater to the Sasha Bruml (2008-13) won the leaders from 58 countries calling for Edinburgh Fringe. people’s choice MullenLowe YourNOVA urgent action on climate change. Award for his bike saddle design, Life 0YG]ZER4VEEK  is living Cycle, at Central Saint Martins. He is ,EQMWL1EGTLIVWSR  was in a beautiful part of the Apennine currently researching the potential for part of the team working on a project, mountains in central Italy, where she commercial production. Tangential Dreams, at the Burning Man works as a Person-Centred Counsellor festival in Nevada. They won the popular and Psychotherapist with individuals Former Bedales Rock Show superstar vote in the Architizer competition. through her private practice. 1EVMOE,EGOQER  released her second album, I’m Not Your Man, Martin Cahn (1964-67) and his Polish in June. wife were interviewed on Channel 4 about the impact of the comprehensive Kamila Thompson (1995-97) is still medical insurance rule on EU nationals a musician. Her band, The Rails, had a and the issue of the Lords vote to second album, Other People out in guarantee them the right to remain. September. She reports that their last one had great reviews, won a few Alison Berman (née Press, 1958-63) awards and sold about eight copies. has had a busy year with exhibitions of her sculptures at Radley, Haywards Heath Nunu Rokotnitz (1987-92) is now and Quenington, Gloucestershire. working at Worcester College, Oxford. She has recently published a learned Edward Bird (1973-80)LEWSJ½GMEPP] article in the Journal of Interdisciplinary retired from the Met and is enjoying Studies at Pennsylvania State University. being a bit more selective about what jobs he takes on. What he enjoys most *VERGIWGE4LIEWERX  has is life-guarding, often in a canoe at open been working in Dhaka, Phnom Penh water swimming events. and Lusaka, mostly on projects to do with health, especially concerned with Elizabeth Bird (1976-83) has started water, sanitation and hygiene. a new job as School Nurse at the Oratory School and brother 1MGLEIP Kate Emmerson (1977-84) moved (1970-77) continues to enjoy being to Edinburgh in 2014 to head up Director of the British Council, the Arts Therapies Service at NHS Russia whilst bagging Corbets in his Lothian, where she found there was spare time. Sister Helen (1975-82) quite limited understanding of the Arts enjoys being head of the geography Therapies in contrast to London. department at Exeter School.

56 • News in Brief NEWS IN BRIEF

Both Anna Dennis (1994-96) and Tabitha Goldstaub (1999-2004) is 0YG]4EVLEQ  were heard on leading the way in the promotion and Radio 3 before 08.00 on International XLITYFPMGYRHIVWXERHMRKSJ%VXM½GMEP Women’s Day in March. This was Anna’s Intelligence (AI). Along with serial third Radio 3 slot in as many weeks. start-up entrepreneur Charlie Muirhead (1988-93), she is the founder of CognitionX. She explains how AI has the Daniel Alexander (1976-81) continues potential to detect cancer earlier than to work on a number of highly humans, trade stocks, increase energy technical legal cases, including before IJ½GMIRG]TVIHMGXLYQERVMKLXWXVMEPW the Supreme Court. As chair of the and make fairer decisions in courts. Intellectual Property Bar Association, he is doing policy work on the many consequences of Brexit for this area of Clan Living is a recently formed company 6MGLEVH+VELEQ  has law. Good to know that at least one founded by Henri Hamm (2007-12). written and illustrated a new children’s aspect of Brexit is in safe hands. He delivers high end, luxury student book, The Cranky Caterpillar, which accommodation schemes across the UK. was published by Thames & Hudson Virginia Arnold (1990-92) continues in September. her work in Geneva with WHO and Luke Poore (1983-90) is now head Bloomberg Philanthropies on digital of the Equine Medicine and Surgery Jo Seth-Smith (1996-99) has completed health and healthy cities. She would Departments at the University of Pretoria, a three year contract as Head of love to hear from Bedalians who are South Africa. Although his caseload is Education with Theatre in Malawi. She is active in the digital health space. predominantly equine, he can be seen taking a career break for a bit to spend here operating on a rhinoceros. time with her young son and then intends to start consultancy work in XLILIEPXLIHYGEXMSRERHKIRHIV½IPHW

Sister Niki Seth-Smith (1999-2002) is EJVIIPERGINSYVREPMWXIHMXSVERH½GXMSR writer. She is lead editor of OurBeeb, and Commissioning Editor for 50.50. She has lived in Athens for the past Juliet Corley (1980-87) is a Marine couple of years and has been UK Biologist who works with a small NGO editor for openDemocracy. 8MQ'VSGOIV  is Chief in Papua New Guinea which has been 7GMIRXM½G3J½GIVEX17*8IGLRSPSKMIW training generations of local schoolchildren 2MGO.IPPI]  , Emeritus who make advanced electric motors to manage their coral reefs sustainably. Professor in Physics at Lincoln College, and electronic power conversion Oxford, is working with colleagues in devices for the Green Energy market, 2MGLSPEW1E\[IPP   Emeritus the engineering department on an currently focussing on electric utility Professor of Philosophy of Science at UCL, innovative, versatile, low-cost solar vehicles and the emerging energy has published three books this year. These cooker for the developing world. storage market. are all part of his ongoing campaign to revolutionise the study of science. Ian Fairley (1995-2000) is a postdoctoral Clare Smith (1970-77) was Artist in researcher at Swansea University Residence at the Wealden Literary Festival Designer Snowden Flood (1975-80) studying the impact of marine energy at Boldshaves Garden, Woodchurch, curated an exhibition in London in extraction on the coastal environment. Kent. She will shortly be presenting an May which included her own work He was interviewed by the BBC about academic paper at Coventry University along with the animal sculptures of the development of tidal lagoons – in EFSYXE½PQZMHIS[LMGLWLIQEHIEFSYX Dido Crosby (1973-80). particular the one planned for Swansea. her experiences with the garden.

News in Brief • 57 NEWS IN BRIEF

Ivan Baines (1973-80) continues as Jason Crampton (staff 1987-89) is now a member of the board and Chief Professor of Information Security at Royal 3TIVEXMRK3J½GIVSJXLI1E\4PERGO Holloway College, London. He has a Institute in Dresden. He also recently WXVSRKWMHIPMRIEWEGSQTMPIVSJ½IRHMWL participated in founding and setting up crosswords, under the pseudonym of the Sainsbury Wellcome Centre for Serpent, for The Independent. Neural Circuits and Behaviour in London. Rupert Muldoon (1996-2001) has 7MQSR%PHVMGL  has been designed a new garden for Maggie’s re-appointed by Parliament to be cancer charity at their centre in Oldham. the Environmental Assessor for HS2 He was interviewed in the garden on Frieda Hughes (1973-78) had an Phase 2 (following the same work for Gardeners’ World during the summer. exhibition of her paintings in Chichester Phase 1). His responsibilities include Cathedral, running through the Summer. overseeing the public consultation In addition she was promoting her book process on behalf of Parliament. of illustrated poetry, Alternative Values. The book is published by Bloodaxe Mark Kidel’s (1960-65)PEXIWX½PQ Books, for whom 'LVMWXMRI1EG+VIKSV Becoming Cary Grant, is a feature-length (1980-82) has long worked. documentary that explores the actor’s midlife crisis and use of (therapeutic) .EG];EPP RqI(EZMIW had LSD in the late 1950s. It was screened an exhibition, The Continuous Thread, of MR0SRHSRJSVXLI½VWXXMQIMR woven tapestries and original prints at December, following many international The Slade Centre, Gillingham, Dorset. festival showings. She is also one of the featured artists in Dorset Visual Arts’ new publication Making Dorset. Dan Ellis (1976-83) took a sabbatical from Columbia University to work at Google and never returned. He’s Maddy Jones (1994-96) was principal been a Staff Research Scientist there organiser of the Vintage Escape Festival, for a little over two years. He leads a taking place at Eastnor Castle Deer team using Deep Learning to recognise Park near Ledbury, Herefordshire in July. environmental sounds. His broader goal is to make computers able to David Walsh (1971-75) had an understand natural sound scenes in exhibition of landscapes at Shepherd the same way that people do. Market, Mayfair in April. Tanya Ashken (1951-57) had an Hayley Harland (2005-08) appeared exhibition of her sculpture in June in in Alice’s Adventures Undergound at Dunedin, New Zealand. The Vaults in Waterloo. She is also one of the Southbank Centre’s licensed Isobel Cohen (1995-97) is Associate street performers and you will often Director of Fundraising for Cambridge ½RHLIVFYWOMRKYRHIVRIEXLXLI The Chichester International Film Conservation Initiative. CCI is a London Eye. Festival in August included a collaboration between Cambridge retrospective screening of nine past academics conducting research into Aliya Raphael (2011-13) has opened ½PQWF]1MGO'WEO]  , conservation and biodiversity and a her own business, an all-night eatery, highlighting his most recent production large number of NGOs working in an Snack City, on the Greek Island of Ios. The Jazz Ambassadors. ETTPMIHGSRXI\XMRXLIWEQI½IPHW

58 • News in Brief NEWS IN BRIEF

Charlotte Riddick (2009-14) ran a Arts Cross White Collective, LA credit: Photo marathon in Rio de Janeiro in June to raise funds for a community project, Crawley Coaching, whose aim is to teach tennis skills to children from the favelas.

Flo Robson (2005-10) is working as )HMXSVJSV8LI*IQEPI0IEHERSRTVS½X organisation designed to make women’s stories more visible and offer alternative Graham Banks (staff 1980-2013) raised and accessible role models, with the aim several thousand pounds by rowing of inspiring future generations. from Lympstone to Exeter Quay, a distance of about eight miles. This was in aid of the Sam Banks Memorial Ashley Viljoen (2011-16) ran a half Fund which provides bursaries for marathon in November to raise money photographic students at the world for her grandmother’s charity, e’Pap renowned Pathshala South Asian Media Feeding, which provides breakfast for Klaus Moller (1976-78) has been busy Institute in Dhaka, Bangladesh. children in poverty in many different with many projects revolving around his parts of the Garden Route, South Africa. gallery business and his charitable work in Cuba, not to mention importing Giles Prowse (2002-05) has relocated Australian wine into the United States. to Brisbane, Australia to work as an Jo Long (2000-03) has carried out environmental engineer on waste research looking at quality of life in infrastructure projects. He has been women undergoing different types Juliette Bigley (1991-96) exhibited her working on the proposed energy-from- of ovarian cancer surgery across jewellery at Collect Open, along with waste plant in Sydney which, if built, ten hospitals. This year she has Mella Shaw (1991-96). Collect Open is [MPPFIXLI½VWXSJMXWX]TIMR%YWXVEPME begun a project which examines part of the Craft Council’s international accommodation and rehabilitation in fair for contemporary objects and is women exiting prison. the showcase for concept-driven and Anthea Stone (née Stephenson 1964-70) installation work. retired from her social work job last November and has now joined the Emma Hartley (1967-72) had a Cannock Mill Cohousing community in successful solo exhibition at the Oxo Alana Hurd (1995-2000) has established Colchester. There she will have her own Gallery, South Bank, London and was ERSRTVS½XSRPMRIGSQQYRMX]GEPPIH home but, with 22 other households, selected for the ING Discerning Eye Plucky Us, which acts like a dating will share a Common House for activities Exhibition at the Mall Galleries. agency (without the dating) for amazing and some meals as well. ideas and people. It already has a truly global membership. Steuart Padwick (1973-78) was A new edition of Duncan Ryn Gough’s offered a late slot in the 100% Design (1970-75) book Back Roads of Spain exhibition in the Autumn and gave Tupac (née Roger) Felber (1987-90) has been published by Hombre. This himself only a couple of weeks to is Director, Scriptwriter and Producer follows his Sketches of Spain, previously produce ten chairs and a dining table. of Tides, which was shown as part of published by Matador. His Ha Ha chairs and Ha Ha table are the London Film Festival. a playful 2D take on the turned legged Victorian balloon back chair. Jack Closs (2000-05) passed his Gyles Brandreth (1961-66) performed viva examination at City of London in a ‘stripped down’ production of University with no amendments – Hamlet at Chichester Festival Theatre a rare achievement. He is now fully Café Bar. The entire cast consisted of UYEPM½IHEWEHSGXSVSJ4W]GLSPSK] Gyles and his wife and son.

News in Brief • 59 NEWS IN BRIEF

Quentin Henderson (Dunhurst 1960-65) has lived and worked on Nevis, West Indies, for over 30 years and would always like to meet any OB who visits this tiny Caribbean island, which thankfully suffered minimal damage from hurricanes Irma and Maria. Email: [email protected]

Hugh Potter (1978-85) now manages the Environment Agency’s programme to clean up the 1500km of English Arabella Dorman (1991-93)LEWEKEMRLEH[SVOI\LMFMXIHMR7X.EQIW´W'LYVGL rivers that are polluted by abandoned Piccadilly. 7YWTIRHIH is an installation artwork created out of hundreds of items of metal mines. clothing that have been discarded by refugees arriving on the beaches of Lesbos, LEZMRKVIGIRXP]¾IH[EVTIVWIGYXMSRERHTSZIVX]

Lucy Rogers (1976-83) spoke about 7MWXIVAnnabelle (2002-06) is XLIWYFNIGXSJKIRXVM½GEXMSRSR6EHMS developing a career in ‘costume 3’s Free Thinking programme. This was performance’, a very original blend of in connection with her exhibition, fashion and theatre. Visit ellebanna.com 3R+IRXVM½GEXMSR, at the House of to learn all about it. -PPYWXVEXMSR6YRRMRKYRXMP1EVGL

Simon Perks’ (1972-75) company Rosie Craggs’ (née Greenwood, Unicorn Publishing has recently 1995-2000) architectural practice is ,EQTWLMVI8LVSYKL;VMXIVW´)]IW, published 0SRKJSVH'EWXPI8LI8VIEWYVIW XLVMZMRKMR0SRHSREJXIV½ZI]IEVW7LI edited by Alastair Langlands (staff ERHXLI'SPPIGXSVW written by Amelia recently had a project featured in The 1973-2001) and decorated by 7QMXLHEYKLXIVSJEmma Smith (née 7YRHE]8MQIW Homes section, regarding Matthew Rice (1975-80), was Routh, 1972-79). whether to move house or extend. published by Eland in October. It is a record of the county from the Following rave reviews for his [VMXMRKWSJ.ERI%YWXIR)H[EVH TIVJSVQERGIMRXLI6S]EP7LEOIWTIEVI Gibbon, Thomas Hardy and others. Company’s ;SPJ,EPP, Pierro Niel-Mee (2010-12)VIXYVRIHXS7XVEXJSVHXS Guy Warrington (1974-81) is now star as Clodius (in Part 1) and Agrippa the British High Commissioner in MR4EVX SJXLI67'´W-QTIVMYQ, the *VIIXS[R7MIVVE0ISRIHIEPMRK[MXL Cicero plays, for a three month run mudslides, elections and torrential from 18 November; his performances rain. Also laying down plans in case Leila Francis Coleman’s (2001-03) were much enjoyed by Keith and of another ebola outbreak. Exeter-based business AquaPhysical Moony Budge. won the overall prize at the BQ National Entrepreneur Festival, in Hannah Gourlay Johnny Flynn (1996-2001) stars in November. The company deals in water (1999-2004) took VIGIRXP]VIPIEWIH½PQ0SZIMW8LMGOIV FEWIH½XRIWWGSYVWIWERHIUYMTQIRX her business TellTails XLER;EXIV, as ‘a working class guy from on to(VEKSR´W(IR Port Talbot’ leading ‘a good cast doing and won £70,000 of Alfred Widmann-Flanagan (1999-2004) an honest job’. Perhaps his education backing. TellTails sells is studying for a Master’s degree in ½XXIHLMQ[IPPJSVTPE]MRKMRE³JVEYKLX wearable animal tails )GSRSQMGWJSV8VERWMXMSREX7GLYQEGLIV relationship drama’? for humans. Yes, really! College, Devon. 'SQTMPIHF] Dennis Archer

60 • News in Brief OBITUARIES

Kay Bennett (née Boddington, staff 1944-91)

ay Bennett, or Kay Boddington Stoner laughed (respectfully of course) Kas she was then, was appointed that prior to making the sandwiches she to the Bedales PE staff in 1944. In ZMWMXIHEPPXLIKVSGIVWMR4IXIVW½IPHXS the years that followed she earned check the price of margarine, she was also herself a very special place in both rumoured to use teabags twice. However the school and Steep village. She died it should be added that in the things that peacefully in November, two months mattered she was the kindest and most short of her 98th birthday. generous of friends, and it was over her Kay’s family came from Cheshire cricket sandwiches that she met Benn. and her father’s business involved Generations of girls will remember the Stoner Cricket Club in succession shipping china clay from the coastal Kay as a games teacher. She was still to Benn and The Chief. ports to the Staffordshire Potteries. His playing stoolball in the village well into On Steep Common there is a ¾IIXSJGEREPFEVKIWMRGPYHIH½ZIGEPPIH her seventies and playing it pretty well beautiful circular oak seat around EJXIVLMW½ZIHEYKLXIVW%RRI&E]1EV] too. Boys are more likely to recall Kay and a large beech tree. This was Kay and Jane. Kay was very proud to Benn as house parents at Lithcot where commissioned by Kay and made by have had a barge named after her and they provided a staging post before Alison Crowther, who was a teacher very proud that her father invented progressing to the rigours of the Senior in the Bedales Workshop and became an ingenious system for turning barges School. Lithcot was the ideal place, with internationally known in the years around, known as the Anderton Lift, a family atmosphere enhanced by dogs, that followed. Discreetly hidden on which is still operating today. ducks, a pet lamb and later babies. the seat is a carved Bedales rose Like many others brought up After her retirement Kay threw symbolic, perhaps, of Kay’s special between the wars, Kay was not given herself into Steep life with gusto, chairing relationship with the school and a to unnecessary extravagance, she the Alms House Trustees, serving as ½XXMRKQIQSVMEPXSEQYGLPSZIH XLSYKLXMXEFWYVHP]TVS¾MKEXIXSFY] a governor for Steep Primary School, friend of many. a new pair of shoes until her old editing the Parish Magazine, as well as ones had worn out. The cricketers of becoming a much loved president of Rollo Wicksteed (1948-54)

The two obituaries which follow, of Thomas Cassirer and Ralph Wedgwood, are placed together because of the extraordinary coincidences they reveal and the light they shine on aspects of Bedales history. Thomas and Ralph joined the school on the same day and, according to the school’s records, left on the same day. Both had to escape to North America due to the threat of Nazi invasion of England, but for very different reasons. Both became professors at American universities. Their long retirements were spent in Washington State and they died at around the same age within a few weeks of each other. As far as we know, they had no contact after leaving school and were completely unaware of these connections.

Thomas Cassirer (1936-40) detail by Dennis Shirley in the book The Politics of Progressive Education. His family, homas Selmar Cassirer, 94, of along with many students and faculty, TPullman, Washington, professor left, but out of loyalty to the ideals of emeritus of French and Italian at the the school, he decided to stay. However, University of Massachusetts Amherst, the following year, as the policies of the died on 11 June 2017. Nazis became more extreme, he joined Born on 28 April 1923, in Rome, his parents in England. Italy, he lived with his family in Rome, He attended Bedales School in Berlin, and at the Odenwaldschule, a England until 1939 when war broke out non-traditional German boarding school with Germany. Because of his German established by his uncle and aunt, until the nationality, British authorities detained age of 12. In 1935 the National Socialists him as an enemy alien on the Isle of took over the school, as described in Man. He was then deported across the

Obituaries • 61 OBITUARIES

Atlantic to an internment camp in and subsequently taught at Brown co-founded the Five College African Quebec. After the British reconsidered 9RMZIVWMX]ERH7QMXL'SPPIKI,I[EW¾YIRX Studies Program, an interdisciplinary their policy of indiscriminately interning in English, German, French and Italian. center for the study of Africa. Germans, including those of Jewish He joined the UMass Amherst In 1996, he was co-translator of a new heritage and others seeking refuge from department of French and Italian in edition of On the Cultural Achievements persecution by the German government, 1965, served several years as department of Negroes, an 1808 work by Henri he was released in 1942 and he enrolled chair, and retired in 1990. Gregoire that was an inspiration to at McGill University, graduating with Although classically trained in French abolitionists in the US and England. honors in French and Latin in 1945. language and literature, early on in his He was the widower of Sidonie ,I[EWHIITP]MR¾YIRGIHF]LMWIEVP] teaching career he became interested Charlotte Lederer. He is survived by life experiences and was committed to in non-European French culture. a daughter, Frances Cassirer of promoting social justice, diversity, and Francophone literature and civilisation Lewiston, Idaho. gender equality. outside Europe, especially in Africa and In 1953, he completed his PhD at Yale the Caribbean, were an important part Reproduced with permission from UMass University in French with a minor in Italian of his professional life. In the 1980s he Amherst News and Media Relations

Ralph Wedgwood (1936-40) r Ralph Josiah Patrick Wedgwood became clear that his family would D– a prominent research physician likely be arrested by the Nazi born in England – died of cardiac regime in the event of an invasion MRWYJ½GMIRG]MR7IEXXPI;EWLMRKXSR of England – a matter later on 23 July at the age of 93. He was corroborated by the publication of evacuated as a boy from England to the Nazis’ Sonderfahndungsliste the United States during the Second ±WTIGMEP[ERXIHPMWX²  World War because of the Nazis’ As an emigré to the United States, threatened retaliation against his Ralph attended Harvard College and and Infectious Diseases, passed away politically-active anti-fascist family. Harvard Medical School, with academic in 2009. A fourth son, James, died in He later became a medical authority appointments at New York’s Bellevue a motorcycle accident in 1973. on paediatrics, immunology and Hospital and the Harvard Medical Ralph was a visiting scholar at rheumatology at the University of School. He completed his military St John’s College in Cambridge, England, Washington Medical School. service in the US Army as a research chair of the National Paediatric His grandfather, Josiah Clement physiologist and station surgeon at Society Joint Council, a distinguished Wedgwood, was a personal friend of the Climatic Research Laboratory service member of the Association of Zionist leader Chaim Weizmann, and in Lawrence, Massachusetts. American Medical Colleges, honorary served as a Liberal member in the He rose to prominence in the medical president of the St John’s College House of Commons. He vocally warned ½IPHWSJTEIHMEXVMGWMQQYRSPSK]ERH Medical Society, visiting scholar at of the danger of Hitler’s rise to power rheumatology, serving as chairman and the Rockefeller Study Centre in – denouncing Neville Chamberlain’s professor of the Paediatrics Department Bellagio, Italy, chair of the St Jude policy of appeasement and opening at the University of Washington in 'LMPHVIR´W6IWIEVGL,SWTMXEPWGMIRXM½G his home to refugee Jewish children Seattle for several decades. He also held advisory board, and a member of evacuated from Europe to England. academic appointments at Western the Association of Medical School His father, Josiah Wedgwood (1911-16), Reserve University in Cleveland, Ohio. Paediatric Department Chairmen. QEMRXEMRIHXLIJEQMP]½RIGLMRE½VQ He is survived by his wife, Virginia He took special pleasure working even during the wartime period, and Lloyd Hunt Wedgwood; by two sons John with his family on the gradual served as the director of the factories and Jeffrey and by four grandchildren, construction and improvement of in Barlaston, England. He was married who contributed with great heart and a summer house on Shaw Island, to Ralph’s mother and fellow OB, love to his care. Another son, Josiah looking west over the bay, reaching Dorothy Winser (1904-12). Francis, who served as the head of the MRXSXLI4EGM½G Ralph attended Bedales School, MQQYRSHI½GMIRG]ERHMQQYRSTEXLSPSK] but was sent to America when it section of the National Institute of Allergy Ruth Wedgwood (daughter in law)

62 • Obituaries OBITUARIES

Gervase de Peyer (1939-43)

he clarinettist Gervase de Peyer, memory, which he did almost invariably. T[LSHMIHEKIH½VWXQEHILMW Berthold Goldschmidt, Arnold Cooke, mark with a BBC broadcast of the William Mathias and Edwin Roxburgh Mozart concerto at the age of 16, also wrote for him. while still a schoolboy. He went on to Born in London, Gervase was the become the outstanding player of his son of two singers: his mother, Edith KIRIVEXMSRHIZIPSTMRKE[EVQ¾I\MFPI (née Bartlett), gave up her career after sound that made extensive use of her children were born; his father, Esme, vibrato, particularly in the lower register, taught singing and sometimes performed and inspired many new compositions. at Covent Garden, and Gervase came He appeared with chamber close to following the same career. orchestras – the London Mozart Players After King Alfred School, Hampstead, at conducting. Simpson offered him a from 1949, the Goldsbrough Orchestra ERH&IHEPIWMR4IXIVW½IPH,EQTWLMVI concert with the LSO Wind Ensemble, and the London Chamber Orchestra Gervase won a scholarship to the for which Gervase was somewhat – and symphony orchestras – the Royal College of Music in 1944 as a YRTVITEVIHWE]MRKLI±JIPXEVIEPMHMSX² Royal Philharmonic and Philharmonia. pianist, and took his ARCM exams in Nevertheless he persevered: a recording Then he became principal clarinet LMW½VWX]IEV,MWXMQIEXXLIGSPPIKI of Richard Strauss’s Suite and Sonatina of the London Symphony Orchestra was interrupted by national service with the LSO Wind Ensemble and (1955-72), which also brought solo (1946-48) and playing in a Royal Marine more conducting in London followed. opportunities. He made his US debut band and broadcasting on the forces In America he conducted his own with the Mozart concerto on an LSO network revived his enthusiasm for the Melos Sinfonia of Washington, which tour with Georg Solti conducting, and clarinet. He returned to the RCM and he founded in 1992, and the Concerto recorded it with the orchestra twice. continued studying the instrument with Soloists of Philadelphia. Chamber music was an important Frederick Thurston, at whose suggestion Although largely absent from the ½IPHXSLMQ-RLIFIGEQIE he went on to study in Paris with Louis British musical scene once resident in member of the newly founded Melos Cahuzac, from whom he learned a great the US, he toured both the UK and Ensemble, and continued to play with deal about performance artistry and mainland Europe with the Australian them for the next 24 years, making communication. Not wishing to imitate pianist Gwenneth Pryor, giving recitals many recordings, including the quintets the tone quality of either great player, he to packed audiences well into his 70s. by Mozart, Brahms and Arthur Bliss, began to develop an individual sound. He also released a series of seven CDs the last with the composer present. Meeting the pianist, Charles SJWMKRM½GERXTMIGIWJVSQXLIGPEVMRIX The Mozart he also recorded with the Wadsworth, while playing at the Spoleto repertoire, including some popular and Amadeus Quartet. Festival of Two Worlds in Italy led to jazz works, in collaboration with his son, Several works were written for Gervase becoming the clarinettist of the Mervyn, and his 80th birthday concert him as a soloist: from his lifelong friend Lincoln Center Chamber Music Society in at the Wigmore Hall was a sell-out. Joseph Horovitz came a Concertante 2I[=SVO  %X½VWXLIXVMIHXS In 1950 he married Sylvia Southcombe, for Clarinet and Strings (1948) and a combine living in the US with maintaining a cellist, and in addition to Mervyn Sonatina for Clarinet and Piano (1981); his position as principal with the LSO. they had two daughters, Lorrayn and from Alun Hoddinott came a concerto However, his frequent absences meant Janine. They divorced in 1971, and  SJ[LMGL+IVZEWIKEZIXLI½VWX that he had to relinquish that position later that year Gervase married the performance with the Hallé under after four years in favour of Jack Brymer. mezzo-soprano Susan Daniel. They Sir John Barbirolli, and a sonata (1967). Gervase gave performances of the divorced in 1979, and the following +IVZEWIKEZIXLI½VWXTIVJSVQERGI concertos by Aaron Copland and year he married Katia Perret Aubry, of Thea Musgrave’s concerto (1968) Paul Hindemith with each composer a dancer and movement therapist, and with the BBC Symphony Orchestra conducting, and did the same for the so became stepfather to her daughter, under Colin Davis. This work called on US premiere of the concerto by Jean Valerie. Katia survives him, along with the soloist to move around within the Françaix. When playing at the BBC his children and three grandchildren. orchestra to link up with the various with various orchestras and ensembles sections, something made possible by he got to know Robert Simpson and June Emerson, reproduced with +IVZEWI´W¾EMVJSVTIVJSVQMRKJVSQ told him he would like to try his hand permission from The Guardian

Obituaries • 63 OBITUARIES

X[EWMRXLEX-½VWX[IRXXS clarinettist at that time and I remember Gervase did get to the concert, still IBedales. Gervase was in his last year thinking he had a very beautiful tone. looking pretty green, but nevertheless and was larger than life for me. Firstly Many years later, in the 1960s, I joined his performance was as good as ever. he was a superb gymnast and could the London Symphony Orchestra (LSO) A real professional musician. do amazing things on the gymnasium and sat next to Gervase for many This professionalism came out ³LSVWI´[MXLLERHWXERHWERH¾MTW years, tremendously appreciating his when on tour in India with the LSO. which were very impressive to an EVXMWXV]8LIQEREKIQIRXTVS½XIHJVSQ The Dances of Galánta were on 11 year old. My elder brother, David, the orchestra’s soloists which included the programme, in which there is a who was also at the school, was Barry Tuckwell and Roger Lord in the mammoth extended solo for clarinet. the same age and in the same class wind section and Gervase was featured On one of many performances he as Gervase. They both played the in many concerts. There was a former started this solo with a frightful squeak, clarinet but my brother soon gave up &EXXPISJ&VMXEMRTMPSXMRXLI½VWXZMSPMRW which he then featured in such a way the competition and settled for the Peter Gibbs. Gervase was to play a that, I am sure, most of the Indian sciences. Later, when I was in my last Mozart concerto at the Swansea Music audience thought it was what Kodály year, Gervase came back to school *IWXMZEPERH4IXIVSJJIVIHXS¾]LMQXS intended. Over the years I have played with his musician friends, Colin Davis Wales in his plane, rather than driving. so many concerts and chamber and Timmy Crump (Peter Graeme What Gervase did not expect happened concerts with Gervase, which have (1925-38)). It was a memorable shortly before landing. Peter put the always been a pleasure, partly due occasion for me as I was asked to plane into some loops and spins so that to his very strong personality which play the bassoon in a concert with his poor passenger was so sick that he came through in his performances, a programme including a Mozart could hardly get out of the place. Having making them unique. Divertimento and Poulenc’s Trio for spent the entire afternoon in his hotel Oboe, Bassoon and Piano. Colin was a bed and missing the seating rehearsal, Roger Birnstingl (1943-50)

Michael J C Gordon FRS (1960-66)

rofessor Michael Gordon was a Mike Gordon was part of the team PTMSRIIVMRXLI½IPHSJMRXIVEGXMZI that built Edinburgh LCF. This was theorem proving, with a focus on an interactive theorem prover: a LEVH[EVIZIVM½GEXMSR8LMW½IPHMW program for undertaking formal proofs concerned with certifying system in a logical calculus (the Logic for designs by proving their correctness Computable Functions). And it was mathematically. Mike Gordon shaped this XLI½VWXSJMXWOMRH%PXLSYKLXLI0'* ½IPHJVSQXLIFIKMRRMRKHIQSRWXVEXMRK calculus soon fell out of favour, the XLIJIEWMFMPMX]SJLEVH[EVIZIVM½GEXMSR architecture of Edinburgh LCF is now on real-world computer designs. His almost universally adopted by today’s students extended the work to such interactive provers. This early project also There he turned his attention to HMZIVWIEVIEWEWXLIZIVM½GEXMSRSJ introduced the ML family of functional LEVH[EVIMRXVSHYGMRK½VWX0'*C071 ¾SEXMRKTSMRXEPKSVMXLQWXLIZIVM½GEXMSR programming languages. (Logic for Sequential Machines) and of probabilistic algorithms and the Mike met his wife Avra during his then HOL (Higher Order Logic). ZIVM½IHXVERWPEXMSRSJWSYVGIGSHIXS ½VWXTSWXHSGMRE]IEVWTIRX One of his key contributions was to (necessarily correct) machine language with John McCarthy at the Stanford demonstrate the effectiveness of higher code. In recognition of his achievements, %VXM½GMEP-RXIPPMKIRGI0EF[LIVI order logic as a general formalism for he was elected to the Royal Society Avra was a Research Assistant. They ZIVM½GEXMSRVITPEGMRKIEVPMIVWTIGMEPMWIH in 1994, and he continued to make were colleagues at Edinburgh and JSVQEPMWQW%XXLIXMQI½VWXSVHIV valuable contributions until the end Cambridge until Avra retired in 1991 logic was preferred both by logicians of his career. to raise the family. themselves and by the AI community; In the 1970s, as a postdoctoral Mike Gordon was appointed to Mike demonstrated that higher order researcher at Edinburgh University, a Lectureship at Cambridge in 1981. logic could be implemented effectively

64 • Obituaries OBITUARIES

and used to specify hardware designs The impact of his work, along with attentive and supportive listener, of from the gate level right up to the that of the students and colleagues, is unfailing kindness and generosity. He is processor level, as well as abstract worldwide. Techniques that originated survived by his wife, Avra Cohn, and by LEVH[EVIWTIGM½GEXMSRW%WXIEH] in his group at Cambridge are used by their two children Katriel and Reuben stream of PhD students extended major chip vendors and have deeply Cohn-Gordon. the applicability and power of the MR¾YIRGIHXLIIRXMVI½IPHSJMRXIVEGXMZI HOL system to unimagined levels. theorem proving. Copyright Department of Computer Cambridge promoted Mike to Reader Mike Gordon’s colleagues and Science and Technology, University of in 1988 and Professor in 1996. students will remember him as an Cambridge. Reproduced by permission

George Murray (1936-42)

remember an encounter with troop of Daimler armoured cars right I George on the polo ground. We across Normandy. Regimental History were racing from opposite ends tells of how George’s car was shot and to capture the ball. I saw him look burnt and George got in the way of up and assess the situation, put in some shrapnel. It was also recorded his spurs and come for me like the XLEX±1YVVE]PSWXEPPLMWOMX²,MWXVSSTW Royal Scot train engine with a full fought on to Bremen, I think, where head of steam. I felt most inadequate. he found himself in command of a Likening him to the Royal Scot is not surrendered German dock yard. fully proper as George has recently The Murrays had interests in South discovered that his Murray ancestors Africa, with apple farming in Elgin and came from Ireland. Anyway it gives sheep in the Karoo. His father gave me courage to remember him. him the choice of whether he would Ninety-two years ago George’s like to farm at Painswick, or at Marania mother, Elizabeth ‘Margaret’ and Kisima in Kenya – he chose corridor has become a renowned Murray (née Molteno, 1908-12) Kenya. He had no formal agricultural WYGGIWW8LI½VWXIPITLERXXLEXGEQI went into labour while on a ship training but with his and wife Irralie’s XLVSYKLXLIYRHIVTEWW[EW½XXIH off Simonstown near Cape Town. dedication and hard, hard work they with a tracking collar, was named George was born in Simonstown created a gold medal winning farm. George and has proved to be a and then they rejoined the ship. I was talking to Sir Evelyn Baring, very good elephant that does not He had an older sister, Iona, and a former Governor of Kenya, and said break fences. younger brother, Patrick. They lived in that Marania and Kisima must be George was a master pilot and Painswick Lodge in Gloucestershire some of the best farms in the country. QEHIQER]RSXEFPI¾MKLXW,IYWIH in a lovely old Cotswold house. He said: “No, they are some of the XS¾]XS&SPSWWEX/IR]EPERHF] George recounts having his appendix FIWXJEVQWMRXLI[SVPH²-XGSYPHEPWS the lake edge and set up camp and out on the kitchen table, also how be true that the North Kenya Polo IRNS]WSQIQSVRMRK¾MKLXWSJHYGO cold his bedroom was. There was ground, principally created by George WLSSXMRK,IERH-VVEPMIEPWS¾I[ no double glazing in those days, so ERHLMWXIEQMWSRISJXLI½RIWXMR their Cessna 182 to Ireland and back. the snow came in past the gaps the world. George married Irralie in 1952. around the windows. George was the Squire of this They have two children, Gordon and George went to Bedales, then (MWXVMGX,IORI[XLI½VWXREQIWSJ Rowena, seven grandchildren and back to Painswick Farm where he every child and I suspect he knew four great grandchildren. George helped on the farm. He had to light the names of their dogs too. He was [EWFSXLE½RIKIRXPIQERERHEPWS XLI½VIEXEQFIJSVIQMPOMRKXLI a great supporter and pillar of the a compassionate gentle man. cows. He never wanted to milk a church. He paid school and university We will remember him. cow again! At 19 he was called up fees for many lucky young Africans. to serve in the army. He was in the Marania and Kisima donated Adapted from a eulogy given by friend Household Cavalry and took his land for the ‘Elephant Corridor’. This Tony Dyer

Obituaries • 65 OBITUARIES

Robin Murray (1953-59)

obin Murray, who has died aged R76, advocated and implemented new forms of social and economic organisation by applying humanist principles to practical experience. In Britain and internationally he sought to tease out of today’s structures clues for a more equitable tomorrow. He saw beyond Fordism – industrialised mass production and mass 8LIMR¾YIRGISJXLMWETTVSEGL global assembly of Liberation Nuts, and consumption – and neoliberalism, with went far beyond London and outlived MRHI½ERGISJXLIGSQTER]´WTIVMPSYW its emphasis on the private sector and the GLC, led by Ken Livingstone and ½RERGMEPGSRHMXMSR6SFMR´WZSMGIFSSQIH free trade. As chief economic adviser to abolished by Margaret Thatcher’s out to 3,000 farmers: “We are about the Greater London council (1981-86), government in 1986. Ever enthusiastic TISTPIERHGSQQYRMX]² Robin led a team working for an about local democracy, Robin advised Liberation Nuts lives on, the Twin inclusive, democratic economy. Their a consortium of local authorities that group of companies now acts as a London Industrial Strategy involved produced the South East Economic trading and marketing arm for more trade unionists and user groups in Development Strategy, which contributed than 300,000 small farmers, and fair economic planning, invested in child to the 1997 Labour government setting trade sales in the UK in 2016 totalled care and adult education, developed up Regional Development Agencies. £1.65bn. It all began with Twin importing cultural and creative industries, gave Drawing on his GLC experience, cigars from Cuba and rocking chairs a boost to co-operatives and other Robin wrote for Marxism Today on from Nicaragua. social enterprises, and helped set up Benetton Britain (1985) and Life After From 1994 Robin worked for two the London Food Commission, whose Henry (Ford) (1988) – explaining the years with the province of Ontario. work included the study of additives post-Fordist transformation of the He brought Canadian expertise in and the effects of food poverty. production process to the wider left. sustainability back to England, founding Learning from the small-scale Aware of the widening gap between the London Pride Waste Action enterprises of Emilia-Romagna, the the market’s winners and losers, Robin Programme, which started pilot region of Italy with Bologna at its argued that the new technological and schemes showing how cost-effective centre, his team encouraged networks organisational forms of production could and popular recycling can be with new of decentralised production units with facilitate democratic self-management methods and technologies. Across ERIQTLEWMWSR¾I\MFPIWTIGMEPMWEXMSR and collaborative creativity, and help England recycling rates soared. particularly in the furniture industry. the transition to democratic socialism. His book Creating Wealth from Waste This was the enabling state in action. Guided by Bertolt Brecht’s maxim that (1999) was followed by the Greenpeace ±XVYXLMWMRXLIGSRGVIXI²LISVKERMWIH report Zero Waste (2002), in which he a series of initiatives “in the interests argued that product design for repeated SJPEFSYVVEXLIVXLERSJGETMXEP² use was as important as recycling. His Self-realisation for the marginalised and achievements in redirecting UK waste exploited, for women, for the young, policy led The Guardian to identify him was at the heart of his mission. in 2008 as one of the “50 people who In 1985, with Michael Barratt Brown, GSYPHWEZIXLITPERIX² Robin founded the Third World With the deputy mayor of London Information Network (Twin), a trading he worked to establish the London organisation designed to ensure Climate Change Agency in 2005, and economic equity for producers in a two years later a green homes advice global market, and of which he was service. For the Young Foundation a director for 20 years. Out of Twin he co-authored The Open Book of came the trailblazing fair trade brands Social Innovation (2010), a worldwide Cafédirect and Divine Chocolate. In survey and investigation into ways 2008, in Kerala, southwest India, at a new technology could reduce carbon

66 • Obituaries OBITUARIES

footprints, sustain health and alleviate and moved his family from Hampstead, governments and civil associations in poverty – work premised on the belief north London, to a hill farm in Jamaica, Ethiopia, Honduras, and most that only globally equitable approaches Cumberland, where his sons worked in recently the Syriza government in would avoid the catastrophic impacts the school holidays. At Bedales School, Greece. In 1980 he helped establish a of climate change. Hampshire, he met Frances Herdman, new educational system for the then His teaching at Schumacher College later an artist; together they went to socialist government in the Seychelles. in Dartington, south Devon, deepened Oxford, where Robin studied history To all his activities he brought optimism, his connection to ecology through at Balliol College, and married in 1965. warmth, curiosity and good humour. economics, combining his knowledge After postgraduate studies at the He is survived by wife *VERGIW RqI and love of farming and his faith in a College of Europe in Bruges, and at the Herdman 1953-59), his daughters, Marika sustainable future. More recently he London School of Economics (LSE), (1985-87) and Bethany (1986-89), focused on work with co-operatives, Robin taught at the London Business grandson, .SWITL GYVVIRX , and believing that they were the appropriate School. For the May Day Manifesto brothers, Alexander (1945-52) and institutional form for a human-centred (1968), edited by Raymond Williams, Hubert (1958-64). X[IRX]½VWXGIRXYV]IGSRSQ] he drafted an alternative economic Born in Westmorland (now part of strategy that became a central issue on Robert Hutchison, reproduced with Cumbria), Robin was the son of Stephen the left in Britain in the 1970s. permission from The Guardian. Photographs: Murray and his wife Margaret (née Gillett), From 1972 to 1993 Robin worked Robin Murray speaking at the Fair Trade who had a strong Quaker background at the Institute for Development %PPMERGI/IVEPEWIIHJIWXMZEPGVIHMX and in the 1930s were communists. In Studies at Sussex University, and Frances Murray (OB); portrait photograph 1951, his father dropped his legal career subsequently at the LSE. He advised credit: Bethany Murray (OB)

Adrianne Reveley (née Moore, 1961-66)

nusually for a Bedalian, Adrianne’s From Dublin, she moved to Uroots were in a Derbyshire America to train in psychiatry, before coal-mining village, from where her returning to begin her long career at father rose to become a leading the Maudsley Hospital. pathologist. Her future medical Adrianne became a world-renowned career had family foundations. researcher into schizophrenia. She was ,I[EWWYJ½GMIRXP]WYGGIWWJYPXSFI Lead Consultant within the National able to send his daughter to Bedales Psychosis Unit at the Maudsley, MREKIH3ZIVXLIRI\X½ZI where she offered a second opinion years, she enjoyed herself to such service for diagnostics, management an extent that she formed a lifelong ERHXVIEXQIRXHMJ½GYPXMIWJSVXLSWI attachment to the school. Whatever with severe mental illness, including else she did there, it is worth noting the psychoses (eg, major depression, Fate struck in 1993, when two XLEXMX[EW[LIVIWLI½VWX¾IIXMRKP] bipolar illness and schizophrenia). loves of her life coincided. On her met Terence O’Sullivan, whom she was She also ran a rehabilitation unit for way to the Houses of Parliament to marry some 30 years later, when patients with these disorders, and a to address a meeting about Rethink he visited as part of a Winchester specialist women’s service. Mental Illness, a charity to which College athletics team. Living in London again, one day she she was devoted, she bumped into After Bedales, she studied medicine met a man walking a dog with its leg in Terence again. This time they stuck at Trinity College, Dublin, which was in plaster, with whom she paused to chat. for the rest of her life. many ways returning home, because Surely she realised from some distance She was a Trustee of Rethink. her family had moved to Ireland when that this was the inescapable Terence Adrianne was committed to she was very young. Here again she again. However, at this point, she was destigmatising mental illness and chanced to meet the inadvertently married to Michael Reveley and raising worked tirelessly for this, often persistent Mr O’Sullivan, who, not her family of two boys, Colin and Tom, advising on TV programmes such surprisingly, had Irish connections. both destined to become Bedalians. as EastEnders on storylines with a

Obituaries • 67 OBITUARIES

mental health component. Her list A few years ago, she masterminded Josephine of publications, mostly letters and and inspired a video showing short EVXMGPIWMRPIEVRIHWGMIRXM½GNSYVREPW interviews with various members Averill Simons runs to several pages. of her Block, talking about their lives (née Wheatcroft, Throughout the nineties, she and what Bedales had done for them. 1945-48) became an increasingly regular visitor If you would like to be reminded of XS&IHEPIW½VWXP]EWETEVIRXXS Adrianne, you can still see it at: youtube. Colin Reveley (1989-94) and Tom com/watch?v=1rFbQ5N6DLQ Reveley (1994-99). She was devoted Adrianne, who had resolutely to the school as she was to all the JSYKLXERH±SYXKYRRIH²Q]IPSQE other loves of her life – her work, for over a year, died in her sleep her family, her charity. In subsequent on 4 May 2017 in King’s College years, she became a staunch supporter Hospital with Terence, Colin and of the Bedales Association, regular Tom at her bedside. enthusiast at reunions and ultimately a member of the Badley Society, Dennis Archer (staff 1974-2008), the school’s legacy society. from notes provided by her family

drianne joined Bedales, fresh Adrianne was a wonderfully enigmatic Afrom Ireland, in September character with whom I made friends 1961 in Block 3. We were slightly during our early years together. It is true in awe of this spirited girl who, she to say that friendships made in one’s informed us, was betrothed to her formative years do endure. Our paths childhood boyfriend who lived next did not cross academically, but everyone door. He used to write to her every in our block enjoyed her company, her day! Though they never married they sense of humour and fun. remained close friends. On leaving Bedales, we kept in touch. orn into the famous Nottingham She was initially very shy and I -[EWEFVMHIWQEMHEXLIV½VWX[IHHMRK Brose-growing family, Jose went think that life at Steephurst came as and enjoyed several visits to her lovely to Bedales from the age of 13 years a bit of a shock to this only child of home in Ireland. She introduced me to old with her three brothers and slightly indulgent parents. There is no Connemara and The West and took me one sister. doubt that she was quite the untidiest to the Abbey Theatre in Dublin. When she left Bedales, she boarder ever. .S]GI'EMKIV7QMXL After Adrianne returned from the EXXIRHIH½RMWLMRKWGLSSPMR (staff 1948-70) did her best here! Ever USA, where she studied psychiatry, we Switzerland and joined the family keen and enthusiastic, Adrianne made would meet for occasional ‘catch-ups’. business, showing record-winning the most of everything that Bedales I did my best to follow her meteoric VSWIWEX¾S[IVWLS[WEVSYRH LEHXSSJJIV,EZMRKE½VWXGPEWWFVEMR career and keep up with her family and the world, notably the Chelsea she not surprisingly excelled in all her share OB news. Flower Show. subjects and gained top grades, to Her untimely death came as a Many aspects of her colourful enable her to return to Ireland to study great shock to all her fellow Bedalians. PMJI[IVIKVIEXP]MR¾YIRGIHF]LIV medicine at Trinity College, Dublin. -XMW½XXMRKXLEXQER]SJYWIRNS]IHE Bedalian foundations. Following She had many attributes. She could memorable 50-year reunion at school her marriage to a Jewish doctor, draw and sing beautifully and make in September 2016. We were not to Henry Roy Simons in 1958, they her own lovely clothes. She starred in know that the dreaded myeloma would IQMKVEXIHXSXLI7SYXL4EGM½G many school drama productions, under defeat her only nine months later. We Islands, initially Fiji and then the the direction of the indomitable Rachel have since recalled how well and lovely New Hebrides. She was the Cary Field. I recall her beautiful soft she looked on that day and this is how perfect colonial wife, coordinating southern Irish accent when reading we will remember her. frequent dinner parties, capable of O’Casey’s Juno and the Paycock out ZSPEYZIRXWWSYJ¾qWERHGVrQIW loud in play reading. Louki Scott (née Healing, 1960-66)

68 • Obituaries OBITUARIES

caramels. She was an immaculate food, gave Christmas presents such 34 years. She perfected the art of housewife, obsessed with eradicating as bags of rice wrapped in last year’s zimmer frame shopping for 16 loaves XLI½PXL]¾MIW7LIXSSOXLITPYRKI paper and never used the central of stale bread and three kilos of into the unknown by travelling to the heating or bought a washing machine. over-ripe bananas a day and refused 7SYXL4EGM½GF]FSEX[LIVIWLIKEZI An ardent atheist, Jose resisted Jewish to relinquish her drop handlebar birth to Ana in a banana plantation attempts at integration yet made racing bike to her grandson because and then Jonathan during a hurricane delicious chicken liver pâté and borscht WLI[SYPH±WSSRRIIHMX²7LIJIPP and tidal wave. Then, keen to WSYTERHWEMH±SLQ]+SH²EPSX over a lot and often looked as if she experience the surfy, sunny Australian Jose was the Green Party voter, a had been in a boxing match covered culture, she and Roy said “Bula Vinaka strong proponent of bringing back an in bruises and black eyes, but :SGE0IM0IM²XSXLIXVSTMGWWIXXPIH exchange economy and victoriously stalwartly continued, never admitting in the Italian quarter of Perth, and led an anti-dog fouling campaign in she needed help and claiming that Daniel was born on the top storey the days before enforced pooper she was perfectly alright. On one of a sky scraper at the end of a long scooping byelaws. occasion during a consultation mimosa-lined drive. Josephine was The family moved to England in regarding a scan, she rejected the in charge of the family for seven 1968 and bought their family home specialist’s interpretation on the basis laid-back Australian years, arranging in Thame, Oxfordshire in 1971, where that ‘he didn’t know what he was picnics in the bush, snorkeling around they resided for nearly 40 happy talking about’, and decided to just Penguin Island and watching outdoor years. Here, Jose volunteered and get on with it and stop complaining cinema from the back of the Holden. campaigned for various ecological local instead. After many battles between Josephine was the hippy mama too. projects and became the secretary LIV½IVGIMRHITIRHIRGIERH She played acoustic guitar, sang Joan for the allotments committee, MRGVIEWMRKJVEMPX]WLIWTIRXLIV½REP Baez and The Seekers songs to bagging many a good haul of delicious happy years in residential care in her children instead of subjecting veggies from the old boys. All her )EWX=SVOWLMVIIRNS]MRK¾SVEJEYRE XLIQXSXLI±HIXIWXEFPIXIPIZMWMSR² children followed in her footsteps art, music and the simple things 7LI[SZIGSPPEKIW[SVI¾MT¾STW by attending Bedales with their in life – the sea air, foraged foods and loved her neighbours and Wheatcroft cousins. and garden produce. strangers. She grew pomegranates Everything changed for Jose when She is fondly remembered by her and lemons and kept a white WLI[EWNYWXERHXLI½VWXSJQER] three children, four grandchildren cockatiel in the garden. strokes stopped her prematurely in and four great grandchildren. Jose was the frugal waste-not- her hyper-active tracks. She lost her want-not matriarch, who made bearings and henceforth glided lightly Ana Simons (1975-77) and menus entirely from out-of-date over the surface of reality for another Daniel Simons (1976-81) (children)

Francis (Bill) Thornycroft (1940-43) about 10 who could not go to school because he had no shoes, and I was rancis Thornycroft was born in 1926 comfort was to be had from the family’s supposed to play with him while shoes Fnear Worthing, and was the last of beloved nanny, Mary Lambley, known [IVIJSYRHJSVLMQ² XLI½ZIGLMPHVIRSJ(SVSXL]ERHOliver as Noopy, who called him Fruzzles and By the time he was a teenager, 8LSVR]GVSJX  . His father who, according to my mother – his at least two of his elder siblings had was from the Thornycroft engineering sister Olivia (1935-39) – spoiled him joined the Communist Party, and family and was a senior engineer at the rotten. His grandmother too: when he Francis would later join them. By then Admiralty. His mother was a political was very young, she used to take him he was calling himself Bill because he activist, having been a member of the XS±YRWYMXEFPI½PQW²YRFIORS[RXSLMW thought the name Francis was too Labour Party from its earliest days. His mother! She, however, instilled in him a posh. His elder brother Chris (1927-33) parents were both rather dauntingly WXVSRKHIWMVIXS½KLXXLIYRJEMVRIWWSJ fought against the Fascists in the competent and fearless – they did things: “Mother made sure we knew we Spanish Civil War and his mother and scary things like mountaineering, and were lucky and drew my attention to his sisters Kate (1925-31) and 4VMWGMPPE expected little boy Francis to do the the queue at the Labour Exchange. (1930-34) were very much involved in same, which he didn’t want to. However, She also brought home a boy of LIPTMRKVIJYKIIW¯½VWXJVSQ7TEMRERH

Obituaries • 69 OBITUARIES

boyfriend Fred Greengrass, a gentle he was rather good at explaining things, and quietly spoken Londoner. Uncle and his slow and laconic speaking style Bill and Uncle Fred used to visit us combined delightfully an ever-present and sometimes came on holiday with sense of the absurd. He knew his stuff, us to Cornwall or Pembrokeshire. They did things properly, and was keen to came in a wonderfully exotic-looking pass on his enthusiasms. Citroen with running boards – called Bill never ceased to be a political Maigret because the TV detective activist. In the seventies he had Maigret had one the same. Bill told been arrested on the notorious us later that he never thought he had picket line at the Grunwick Film been much of an uncle to us because Processing Laboratories, defending he didn’t celebrate our birthdays and the employment rights of the largely he hated Christmas, and when they Asian, female workforce, and told us visited us it was Fred, not Bill, who that the night he spent in the cells was would give us half a crown to buy a very frightening experience. Bill, the then from the rest of Europe as the sweets with. But we never noticed any little boy who thought he wasn’t as Second World War developed. In 1940 of that – they came as a pair and they macho as his mountaineering father when Bill was 14, the family moved to were warm and fun and we all loved wanted him to be, was willing to put 4IXIVW½IPHMR,EQTWLMVIERH&MPPPIJX their visits. At this time, Bill worked himself through that, for the rights of Worthing High School for Boys and as an electrician, and a bequest from others. We, his family, begged him to went to Bedales. His school reports his grandmother enabled him to buy hide his gay badges when using public describe him as courteous, good at a house, and of course he chose to transport late at night, for fear of being practical tasks, at History, German, buy one in a working class area, West beaten up by drunken yobs, but he Art and English literature, but poor at Norwood. But it was the only house wouldn’t. In his eighties Bill was still maths and science, and generally slow in Broxholm Road with a full length tirelessly helping to organise, and even to develop. He was also described as garden with rear vehicular access, and participating in, marches and demos MRWYJ½GMIRXP]±QERP]²&MPPLEHWYJJIVIH he was the only person we knew who in support of gay rights and the from long periods of ill health, was not happened to have an antique dustcart Stop the War campaign, stumbling sporty, was physically uncoordinated in his back garden. To us children, of up people’s front steps to deliver – and he had known from age eight course, this was perfectly normal. PIE¾IXWXETMRKMPPIKEPTSWXIVWXSPEQT that he was gay. He left Bedales at age Bill stayed at Broxholm Road for posts, and gathering signatures on 17 in 1943 to go to London, where he the rest of his life and eventually the petitions, in the full knowledge that joined the Home Guard, manning an second great love of his life, Dennis the government would take no notice. Anti-Aircraft battery while he studied Odd, moved in with him. The house He even organised a mock funeral at Chelsea College of Aeronautical and became a real source of refuge – with for a tree in a local street, to object Automobile Engineering. In 1946, he a sympathetic ear, a bed and a lot of to Lambeth Borough Council’s joined his elder brother Chris working practical help – to a whole succession decision to cut it down. for D Napier and Son, a London of people in various kinds of need. Of Bill’s many nephews and nieces, EIVSREYXMGEPIRKMRIIVMRK½VQMR%GXSR Bill’s apple pie was a frequent treat for three were present at his funeral, but The following year, Chris was sacked visitors, and the handmade pastry was others live in Germany and the USA for being a communist, and the same always delicious, although slightly grey so could not come. One of them, fate befell Bill three years later. Other because his hands were blackened by when we told her about Bill’s death, jobs followed, at Elliot Brothers, and at working on old buses. Bill got a huge wrote this: “For my whole childhood Westinghouse, but he was sacked again, amount of pleasure from restoring and Bill embodied another way of seeing from both, for being a communist. driving his beloved old buses, and was things, a guiding star to stand up for This was the McCarthy era. a highly committed volunteer at the what one truly believed in, and to stand -RXLI½JXMIWLIXVEZIPPIHXLIGSYRXV] Amberley Industrial Museum. He also up for others. We have been lucky to selling magazines for the Communist volunteered at the Mechanical Music have him, and I hope he understood Party, and also worked for the Communist Museum in Brentford, and enjoyed how much we loved and respected tour company Progressive Tours, where demonstrating the exhibits to the LMQIZIRJVSQWSJEVE[E]² he made some lifelong friendships. He visitors. I imagine he must have been then ran a greengrocer’s shop with his rather popular with museum visitors, as Anna Cordon (niece)

70 • Obituaries OBITUARIES

Professor Dame Margaret Turner-Warwick

Unusually, we publish an obituary for Margaret even though she was not an Old Bedalian and never a member of the school staff. Margaret is not predominantly remembered at Bedales in her capacity as an outstanding, international specialist physician. She is remembered for the critical contribution that she made to the size and the philosophy of Bedales, which she made as chairman of the Board of Governors during Tim Slack’s (Headmaster 1962-74) headship. This immense work was exerted at a time when she could ill afford it, owing to growing international, postgraduate teaching commitments. She was married to an OB, had two Bedalian daughters and three Bedalian grandchildren. Several of her fellow governors held her in such high esteem that they have asked that we publish the obituary below. Richard Turner-Warwick (1938-42) and Dennis Archer (staff 1974-2008).

hen Margaret Turner-Warwick, was also responsible for several early Institute, University of London, she Wwho has died aged 92, entered clinical trials, most notably with inhaled was, with Sheila Sherlock at the Royal XLI½IPHSJVIWTMVEXSV]QIHMGMRIMRXLI corticosteroids, that have formed Free hospital, one of only two female 1950s, it was a time of great change. the mainstay of modern treatment. professors of medicine in London. She Effective treatment for tuberculosis had Her recognition of the importance served as dean of the institute (1984-87), recently been introduced, and the adverse of immunological mechanisms in lung which is now part of the faculty of effects of cigarette smoking on the lung disease led to the publication of many medicine of Imperial College London, were beginning to be appreciated. research papers and of her book and in 1991 was made a Dame. The focus of academic research Immunology of the Lung (1978). Margaret’s understanding of patients’ had been limited to understanding and Margaret combined a formidable concerns was informed by her own measuring lung function, but with her WGMIRXM½GMRXIPPIGX[MXLXLILYQERMX]SJ XMQIEWETEXMIRX(YVMRKLIV½REP]IEV colleagues Jack Pepys and Deborah an exceptional physician, and played a at Oxford in 1946, before the advent Doniach, Margaret expanded it to fundamental role in the development of effective antibiotic treatment, include the immunology of the lung, of modern respiratory medicine. she was diagnosed with pulmonary ERHTEVXMGYPEVP]SJXLI½FVSWMRKPYRK Born in London, she was the daughter tuberculosis and treated for a year in diseases. She showed that they were of William Harvey Moore, QC, and his a TB sanatorium. The year she spent associated with autoimmune diseases, wife, Maud (née Baden-Powell). She there brought her into close contact rheumatoid arthritis, systemic sclerosis decided on a career in medicine from with fellow patients, whose hopes and and the severe form of lupus known as an early age, and in 1943 went from fears she came to understand. systemic lupus erythematosus, and she St Paul’s Girls’ School, west London, on Her growing reputation as a physician demonstrated the presence of relevant an open scholarship to Lady Margaret led to patients with uncommon and, auto-antibodies in the blood. Hall, Oxford, one of a quota of 7% of on occasion, unrecognised respiratory Anticipating modern “personalised female medical students admitted to diseases being referred to her from QIHMGMRI²WLIHMWXMRKYMWLIHFIX[IIR the university in her year. throughout the UK. Physicians from HMJJIVIRXTEXXIVRWSJ½FVSWMRKPYRK After completing her clinical training around the world visited Brompton disease, to identify the minority of and early posts at University College hospital to learn from her clinical patients who would respond well to and Brompton hospitals in London, in insights and experience and she steroids and the majority who would 1961 she was appointed a consultant was invited to lecture widely in the not, and for whom modern biological physician at Elizabeth Garrett Anderson UK and abroad, particularly in the treatments are now being introduced. hospital, and six years later to a part-time US and Australia. Similarly, in her other major area consultant post at Brompton and London She recognised that the future of interest, asthma, she recognised Chest hospitals and a senior lectureship sustainability of respiratory medicine, different clinical patterns, based on at the Institute of Diseases of the Chest. which she described as a “Cinderella HMJJIVIRGIWMRXLITEXXIVRWSJTIEO¾S[ When, in 1972, she became Professor WYFNIGX²[LIRWLIWXEVXIHHITIRHIH records – rates of forceful exhalation of Medicine (thoracic medicine) at what on attracting academic clinicians into – requiring different treatments. She had now become the Cardiothoracic the speciality who would develop

Obituaries • 71 OBITUARIES

the sub-specialities to which she had reforms, she pointed out to the health, the arts as a tool for social GSRXVMFYXIHWYGLEWEWXLQE½FVSWMRK government her concerns about the change and improving the quality of life lung disease, cancer and occupational implications for research and education for carers and older people. lung disease. From the mid-70s she and for continuity of clinical care. She Asked about how she had coped recruited a number of talented persuaded her colleagues in other with a professional world dominated clinicians to the Brompton hospital and royal colleges that to be effective they by men, Margaret said that being in a scientists to the institute, insisting that had to present their views as a single small minority at Oxford had taught communication between clinicians and voice: in 1996 the existing conference her to take no notice. She nonetheless WGMIRXMWXWWLSYPH¾S[MRFSXLHMVIGXMSRW organisation was renamed the became a role model for the many ¯JVSQ±FIHXSFIRGL²EW[IPPEWJVSQ Academy of Medical Royal Colleges. women who entered medicine in the ±FIRGLXSFIH² After leaving the RCP Margaret subsequent generation. She believed strongly in partnership served as chairman of the Royal Devon She is survived by Richard, her and collaboration, in academic work, and Exeter Hospital Trust (1992-95). daughters, four granddaughters and two between universities and hospitals, She continued to play an active role grandsons, and four great-grandchildren. between academics and clinicians in the life of Lady Margaret Hall and and between clinicians and hospital as a trustee of the Rayne Foundation, Anthony Newman Taylor, reproduced managers. During her period as focusing on young people’s mental with permission from The Guardian professor she ensured a close and synergetic working relationship between the institute and the EVKEVIX[EW½VWXMRXVSHYGIHXS Steephurst and Steepcot by building Brompton hospital, succeeding in MBedales by her future husband, The New Wing. Boys Flat was persuading a reluctant University of 6MGLEVH8YVRIV;EV[MGO  . extended into the middle ‘classroom’ London to appoint a joint chair, to As an Old Bedalian with his three ¾SSVSJXLIQEMRFPSGO8LIWXEJJ VI¾IGXXLIMVWLEVIHQMWWMSR younger siblings, he maintained contact room, art room and admin were Margaret was notable for her great with school throughout his training housed in the temporary prefabricated generosity, intellectually and personally. in medicine. He became a governor units on the site of the new Orchard She gave many of her junior clinical over a period of 14 years, latterly Building. These were expected to staff ideas which formed the basis at the time of ,IGXSV.EGOW WXEJJ last for about ten years… in reality of publications, which provided a 1946-62), and he was involved they were still in use 35 years later foundation for their future careers. in the appointment of 8MQ7PEGO when Margaret’s grandchildren She lent her home on the Dorset (Headmaster 1962-74). Margaret joined Bedales! coast to colleagues and their families. later became chairman of the board. Margaret was delighted to be able Margaret combined her career with Together with the bursar, .EGO;EPIWF] to support (EZMH&YXGLIV´W WXEJJ a very happy family life. In 1950 she (staff 1948-72), Margaret and Tim 1964-92) vision for the teaching of married Richard Turner-Warwick, generated a plan to expand Bedales Art and Design. The workshop was a surgeon who specialised in the WYJ½GMIRXP] JVSQTYTMPW  extended and equipped as the Art reconstruction and functional restoration XSQEOIMXFSXL½RERGMEPP]ERH and Pottery rooms were constructed. of the urinary tract, and they had educationally viable. The broadened Her love of music and her two daughters, Lynne and Gillian. She subject options and the increased respect for the role of imagination took particular pride in Lynne and sixth form were the main educational and creativity in all-round education, her granddaughter Tabitha following goals. At the same time they were made her an ideal champion of the her into medicine. A keen artist, she intent upon retaining the personal IXLSWSJWGLSSP1EVKEVIX´WWIP¾IWW painted watercolours, often of the qualities of Bedales that respected energetic determination to see Dorset coast, for her Christmas cards. and enhanced individual strengths. worthwhile dreams realised, enabled ,IVTIVMSHEWXLI½VWXJIQEPI Despite being a young, full-time JYVXLIVKIRIVEXMSRWXSFIRI½XJVSQ president of the Royal College of consultant at the Brompton Hospital, the Badley legacy; whilst adapting, Physicians (RCP), from 1989 to 1992, and mother of two Bedalians, within reason, to the pressure of coincided with the introduction by Margaret was much involved and the times. Kenneth Clarke as health secretary successful in fundraising and practical of the internal market into the NHS. planning with the architect Greville Gillian Bathe (née Turner-Warwick, Margaret was typically constructive. Rhodes (1926-33). They linked 1965-71) (daughter) While not opposing the proposed

72 • Obituaries BIRTHS, ENGAGEMENTS, MARRIAGES & DEATHS

Births Emelie Fisher and Alexander Rice Lindsey Dow on 21 November 2016. %PMGI&EPPERXMRI(]OIW and Jerry Birch, 0IMPE*VERGMW'SPIQER and Tom Whelan Bedales 1970-75 a daughter, Ronnie Rave, on 5 September Camilla Grey and Tom Petty Leo Singto Gauvain on 17 December 2017. 2017 Bedales 2008-12 :MGXSVME,SQW] and Martin Kissinger .EQIW&YXGLIV and Danielle Shen, a son, David Gill on 23 August 2017. Bedales Henry, on 26 December 2017 Charlie Hughes and Rachel Clarke staff 1960-62 .EGO and Torie Closs, a daughter, Cara Rose, David Klein and Josie Cox 1MGLEIP.SLR'EPH[IPP+SVHSR on on 19 September 2017 2MOOM0EGO and Bruce Davidson 22 August 2017. Bedales 1960-66 Emma Denning and Dan Betts, a son, 1MRX]2MGLSPWSR and Will Nott Rupert Norris Hulme in February 2017. Alfred, on 26 January 2017 Bedales 1981-88 *VERGIWGE4LIEWERX and Stewart Clayton Benji and Frances Donaldson, a daughter, Katharine Constable (née Ingham) on Rosanna Elsie Mei, on 6 January 2017 30 April 2017. Bedales 1944-48 Marriages Iain and Sarah Fairley, a daughter, 6SHIVMGO&VYGI%PI\ERHIV1SSVI on Imogen Kathleen, on 9 January 2017 Camilla Bergesen and Harry Harland on 11 December 2017. Bedales staff 1991-2002 Roger (Tupaq) and Emma Felber, 22 October 2016 Kathleen (Betty) Williams (née Kidner) EHEYKLXIV'SVE(IP½RESR1EVGL Tilly Boys and Tim Howarth on on 28 March 2016. Bedales 1925-29 Kate (née Millar)ERH8LSQEW+VMJ½XLW 17 June 2017 .IER1S]E RqI1EG%VXLYV on a daughter, Betsy, in July 2017 .EQIW&YXGLIV and Danielle Shen on 16 November 2016. Bedales 1934-38 Daniel and Tory Harris, a daughter, 14 December 2016 *Adrienne Reveley (née Moore) on Georgina Leila Rose, on 30 September 2017 Tom Greenwood and Farhana Hoque 4 May 2017. Bedales 1961-66 Jess (née Harris) and Ian Ashbridge, a son, in 2016 *George Lenox Molteno Murray on George Alfred Alan, on 15 August 2017 Hayley Harland and Alex Wolfe on 8 February 2017. Bedales 1936-42 Anais Haynes and Marc-Olivier Bruce, 1 July 2017 *Robin Murray on 29 May 2017. Bedales a son, Ozias on 3 December 2015 Oliver Holmes and Pip Usher on 1953-59 Lu Flux and Alex Chinneck, a son, 29 July 2017 Bert Perry on 23 April 2017. Bedales Chaplin Knight, on 14 April 2017 David Kenington and Cleo Oliver on staff 1974-84 7GLIV^ERHS0YGYW&S\ and Claire Cartner, 3 February 2014 -ER6MGLEVH4SLS[WO] on 7 August 2017. a son, Lucia, on 23 May 2017 Olivia Montgomerie and Adam Kent on Bedales 1989-94 +EFVMIPPI3VGYXX, a daughter, Seraphine 2 December 2017 Bev Ralph on 20 November 2017. in September 2017 Luke Prowse and Hayley Parr on Dunhurst staff 1999-2017 'PEVI RqI6MGLEVHW and Rhydian 8 August 2017 :MGXSV,SVWPI]6SFMRWSR in August 2014. Sandbrook, a daughter, Alys Emily, on Tamara Shaker and .EGO'SYPXIV on Bedales 1936-42 18 August 2017 28 July 2017 :IVSRMGE.ERI%HHMWSR'SLIR RqI7EPQSR 'EVSPMRI RqI7PEGO and Ruaidhri :MGXSVME7YXLIVPERH and Suren Moodliar on 11 December 2017. Bedales 1952-54 MacDonald, twins, Xanthe and Teddy, on in August 2017 Ann Katherine Brown (née Stanley) on 21 December 2016 Guy Wilmot and Antonina Paes on 16 July 2017. Bedales 1974-79 Ellie (née Strutt) and David Ezrine, 9 September 2017 Marion Jane Eileen Stieger-White a daughter, Arabella Grace Tigerlily, on (née Stieger) on 4 October 2017. 21 December 2017 Deaths Bedales 1943-48 Iain and Jenny Wood, a daughter, Jean Alwyn Attwell, (née Stoker) on Sophia Lyra, and a son, Harry James Murray #John Batstone on 23 December 2017. on 8 February 2017 Bedales staff 1967-93 17 March 2012. Bedales 1935-37 *VERGMW)H[EVH &MPP 8LSVR]GVSJX Bob Yeo and Sandra Collins, a son, June Jeffreys (née Bennett) in 2017. Fionnan David, on 30 December 2016 Bedales 1939-44 in April 2017. Bedales 1940-43 Brian Tomlinson on 9 November 2017. Elle (née Keenan) and Ed Yeo, *Kay Bennett (née Boddington) on a daughter, Martha Elizabeth Grace, on 6 November 2017. Bedales staff 1944-91 Bedales 1942-47 22 November 2017 Elizabeth Hollingsworth (née Brooke) *Professor Dame 1EVKEVIX8YVRIV;EV[MGO, in October 2017. Bedales 1934-41 former Chair of Governors, on 21 August 2017 Engagements Lynne Brown (née Cainsey) on 4 May 2017. Bedales 1946-52 6EPTL.SWMEL4EXVMGO;IHK[SSH on 0YG]&EVKIV and Charlie Lech 23 July 2017. Bedales 1936-40 *Thomas Selmar Cassirer on 2MGO&IVKIWIR and Natalia Strigoun 11 June 2017. Bedales 1936-40 .SWITLMRI7MQSRW RqI;LIEXGVSJX on 30 April 2017. Bedales 1945-48 Hugo Briars and %PMGI,SPQIW *Gervase Alan de Peyer on * has an obituary in this Newsletter Ollie Briars and Mary Hanbury 3 February 2017. Bedales 1939-43 # will have one in the next edition

Births, Engagements, Marriages & Deaths • 73 UNIVERSITY DESTINATIONS 2017

Class of 2017 Name Destination Course Izzy Adams Loughborough University Foundation Diploma in Art and Design Eloise Anderson McGill University Liberal Arts Luke Arrowsmith University of Manchester Middle Eastern Studies Saul Barrett Royal Academy of Dramatic Art RADA foundation Joe Barty-King Rhode Island School of Design Liberal Arts Molly Beardall Oxford Brookes University Foundation Diploma in Art and Design 2MGLSPEW&YGOLEQ University of Essex Biochemistry with a placement year Morgan Burbridge University of the Arts London Film and Television Inigo Campbell-Lange McGill University Liberal Arts 0YGE'EVYWS Royal Academy of Music Drums Oliver Catton University of Bristol Medicine MBChB Quito Clothier University of Bristol Music Fleur Connor Glasgow School of Art Fine Art – Painting/Printmaking Hope Cramsie Royal College of Music Guitar 0SPE'VMGLXSR7XI[EVX Parsons School of Design Fashion Design Caleb Curtis Royal Academy of Music Cello Godelieve de Bree Haverford College Liberal Arts 7GSXX)QIVWSR Istituto Marangoni London Foundation Year in Fashion Edward Foulger Royal Holloway, University of London Computer Science Jemima Goodfellow University of the Creative Arts Farnham Foundation Diploma in Art and Design .EGO+VELEQ Ravensbourne Foundation Diploma in Art and Design Anting Guo University of Leeds Mechatronics and Robotics Daisy Hannam Oxford Brookes University Foundation Diploma in Art and Design Martha Harlan University of Oxford Philosophy and Theology Megan Harley University of Bristol French and Spanish 0SYMW.EGSFW University of Bristol Physics Andrew Jameson University of East Anglia English and American Literature Sophie Jenkins Kingston University Foundation Diploma in Art and Design Alexander Ludwig Loughborough University Product Design Engineering -WEFIPPE1EGOE] University of Bristol Religion and Theology 0YPY1G'SRZMPPI Leiden University College The Hague Liberal Arts and Sciences with Global Challenges Alia Mehta Kingston University Fashion Benjamin Meredith-Hardy Manchester Metropolitan University Three Dimensional Design Kit Mosely King’s College London Liberal Arts Julia Newlands University of Bath Biochemistry Tara Noble University of Westminster Commercial Music Performance 1MGLEIP4EXIVWSR University of Bath Integrated Mechanical and Electrical Engineering 4STT]4MIVGI City & Guilds, London Fashion Elizabeth Raynsford Bournemouth University Archaeology Ivan Reilly Anglia Ruskin University Computer Science

74 • University Destinations 2017 UNIVERSITY DESTINATIONS 2017

Class of 2017 Name Destination Course Tom Reynolds University of Manchester Politics and Modern History %RXSRME6MGLEVHW Trinity Laban Conservatoire of Music and Dance Voice George Robson Oxford Brookes University Foundation Diploma in Art and Design Felix Shaw ECAM Lyon Engineering Anastasia Sheldon Northern School of Contemporary Dance Contemporary Dance Ollie Shinder University of the Arts London Foundation Diploma in Art and Design Fergus Steele London South Bank University Film Studies Olga Sukhikh Ravensbourne Fashion Buying and Brand Management Rosanna Verdon-Roe Royal Welsh College of Music and Drama Design for Performance Rose Voorhees University of Bristol History of Art and French Theo Walsh University of Liverpool Philosophy and Business Studies Bertie Warner University of the Arts London Foundation Diploma in Art and Design Eleanor Wraight De Montfort University Dance Georgina Yeomans Cardiff University Journalism and Communications Zeyno Yurddas University of Bristol Economics and Politics Class of 2016 Name Destination Course Rori Abell University of Dundee Medicine Agatha Barker SOAS, University of London Social Anthropology Hebe Bartlett East 15 Acting School Acting & Contemporary Theatre Sophia Berger University of Bristol Spanish and Portuguese 2MGS&VEHPI] Spéos École de Photographie, Paris Photojournalism and Creative Documentary Christopher Bury University of Manchester Intl. Disaster Management and Humanitarian Response George Butler Royal Northern College of Music Voice Emily Cliffe University of the West of England, Bristol Drama & Acting 0YGEW'PSWW Trinity College Dublin English Clare Denning SOAS, University of London Japanese Georgia Dixon Falmouth University Music .EGO(VMWGSPP University of the West of England, Bristol Business and Management 8MPP](VMWGSPP7QMXL Trinity College Dublin Sociology and Geography )QQE(YRGER Durham University Law James Geaves Cardiff University International Relations and Politics Rosie Gee-Turner University of Sussex Anthropology &IGO]+VYFF University of Cambridge History of Art Allen Haigh University of Leeds Philosophy and Sociology Lydia Hallam Queen Mary, University of London Drama 0E[VIRGI,EVXPI] Portsmouth University Media and Digital Practice Will Harvey Queen Mary, University of London Geography Tiger Hornby University of Manchester American Studies Imo Horton Oxford Brookes University Psychology

University Destinations 2017 • 75 UNIVERSITY DESTINATIONS 2017

Class of 2016 Name Destination Course India Hulme Kingston University Fashion Design Beatrice Jervis University of Durham Anthropology and Sociology Araby Joll University of Manchester Psychology Ned Jones Royal Holloway, University of London Physics Naveed Khalessi Newcastle University Biology (Cellular and Molecular) Harriet King University of the West of England Psychology Hannah Lester University of Southampton Fashion and Textiles Design Eleanor Little University of Manchester Social Anthropology Amy Lock 9RMZIVWMX]SJ7LIJ½IPH Geography Sam MacGuffog University of Sussex Physics and Astronomy Freddy Mardlin University of Durham Classics Morgan McKay University of Brighton Fashion Communication with Business Studies Charlie Milliken Trinity College Dublin Classics Ben Mynk University of Liverpool Sociology Patrick Newlands University of Bath Mechanical with Automotive Engineering Esther Palmer University of Bristol Anthropology Josephine Parker Maastricht University Liberal Arts Oscar Pemberton University of Bristol Classics Chloe Polkinghorne University of the Arts London Fine Art Freya Priestly Falmouth University Creative Events Management Anisha Raithatha Cardiff University Business Management Hannah Rogerson University of Edinburgh Social Anthropology Izzy Rollason University of Bristol Cellular and Molecular Medicine Juliet Shapiro University of Oxford Human Sciences Flora Shaw University of Leeds Philosophy and Politics Izzy Soper University of Leeds 4LMPSWSTL]4W]GLSPSK]ERH7GMIRXM½G8LSYKLX Callum Steele Academy of Contemporary Music Music Business and Innovation Struan Tait University of Essex Marine Biology Frankie Vetch University of Manchester Politics and Modern History Jack Voorhees Cardiff University Pharmacy Ella Wooldridge Trinity College Dublin Ancient and Medieval History Min Yu University of the Arts London Print & Time Based Media Class of 2015 Name Destination Course Saskia Church Queen Mary University Psychology Ruan Evans University of Exeter Drama Evie Jacobs University of the West of England, Bristol Illustration Ochre Seagrim Durham University Sociology Class of 2014 Name Destination Course Charlotte Riddick Bournemouth University Ecology and Wildlife Conservation

76 • University Destinations 2017

The Lavenham Press, Water Street, Lavenham, Sudbury, Suffolk CO10 9RN