OPEN DAY 2012
Saturday 1st December 2012
The exciting and informative programme of events will include: n Course specific presentations n Individual stands for each course, where you can meet our academic staff and current students to obtain detailed course information UNDERGRADUATE PROSPECTUS n Demonstrations and laboratory tours n Presentations about student sports, societies and the Students’ Union n Specific sessions for mature students, access students, and parents n Campus tours and tours of College facilities, including the sports centre
Full details will be available at www.tcd.ie/Admissions/undergraduate in November. WE LOOK FORWARD TO MEETING YOU AT OUR OPEN DAY!
ONLINE INFORMATION
Courses: www.tcd.ie/courses Admissions: www.tcd.ie/Admissions/undergraduate 2013 CAO Points: www.tcd.ie/Admissions/undergraduate/requirements/entrypoints Copies of this publication are available Accommodation: www.tcd.ie/accommodation/StudentsandStaff/ free of charge from Students/TrinityHall Main TCD website: www.tcd.ie The Admissions Office Trinity College Virtual tour: www.tcd.ie/virtualtour Dublin 2, Ireland Student life: www.tcdlife.ie Telephone: +353 1 896 4444 Sports clubs: www.ducac.tcdlife.ie Fax: +353 1 872 2853 Sports facilities: www.tcd.ie/sport Email: [email protected] Student societies: www.trinitysocieties.ie Website: www.tcd.ie/admissions/undergraduate
www.facebook.com/trinitycollegedublin The Board of Trinity College is not bound www.youtube.com/trinitycollegedublin by errors in or omissions from this publication http://itunes.tcd.ie UNDERGRADUATE http://twitter.com/#!/tcddublin PROSPECTUS 2013 Welcome from the Provost
Our safe and friendly campus provides an ideal environment for studying, learning, relaxing and living. Located in the heart of Ireland’s capital city, it has state-of-the-art facilities such as a modern Sports Centre, the Science Gallery and the Trinity College Library, the largest research library in Ireland with almost 5 million books and over 70,000 journals.
Trinity has over 112 diverse and colourful societies and 50 sports clubs; the clubs and societies accept new members each year during ‘Orientation Week’ in September.
There are also opportunities to take a semester abroad while progressing in your course through Trinity College’s partnership agreements with leading universities in other countries.
I hope that you will consider joining us as a student at Trinity Employers worldwide hold Trinity graduates in high esteem. College Dublin. Trinity is recognised as Ireland’s top university.* The College has produced generations of outstanding We are well-known globally for the excellence of our courses graduates. Some of the most famous people in Irish history and the commitment of our staff. have been educated here: writers like Oscar Wilde and Samuel Beckett; scientists like William Rowan Hamilton and E.T.S. Trinity was founded in 1592 and is Ireland’s oldest university. Walton (the winner of the Nobel Prize for splitting the atom), Today the College has a vibrant cosmopolitan community of as well as two Irish presidents and many industry leaders. students representing every county in Ireland and some 122 nationalities. I hope you will consider Trinity as your first choice for undergraduate study for an exciting new journey that will open At Trinity you will learn from professors who are world leaders in your mind to new experiences, ways of thinking and friendships, their fields of study. You can chose from over 400 undergraduate many of which will last for a lifetime. degree courses across a range of disciplines in the Arts, Humanities, Engineering, Science, Business, Technology, Social Sciences, and Health Sciences. The Trinity curriculum is aimed at not just acquiring knowledge but at developing critical faculties of the human mind. Freedom of expression, willingness to engage in debate and express diverse points of view are valued and welcomed. Patrick Prendergast Provost Solid academic and pastoral support is provided throughout your time in the university. Each incoming student is assigned July 2012 a Tutor, a member of the academic staff, who is there to advise * Trinity College Dublin is ranked 1st in Ireland, and in 65th position in the top you and help if any personal problem arises. Our tutorial system 100 world universities and 21st position in the top European universities by is unique in Ireland. There is also a student-to-student mentoring the QS World University Rankings 2011. In the Times Higher Education World programme for first year students. We offer a wide range of high University Rankings, TCD is ranked 1st in Ireland, 117th in the top 200 world quality services to all students such as the Careers Advisory universities and 42nd in the top European universities. Service, the Health Centre and a Counselling Service. Fáilte ón bPropast
Tá súil agam go smaoineoidh tú ar theacht go Coláiste na Tá os cionn 112 cumann éagsúil bríomhar i gColáiste na Tríonóide, Baile Átha Cliath, mar mhac léinn. Aithnítear Coláiste Tríonóide chomh maith le os cionn 50 club spóirt. Glacann na na Tríonóide mar an ollscoil is fearr in Éirinn.* Tá cáil ar chúrsaí cumainn agus na clubanna le ballraíocht nua gach bliain le linn Choláiste na Tríonóide agus ar dhíograis na foirne ar fud an Sheachtain na dTosaitheoirí i Meán Fómhair. domhain mhóir. Bíonn deiseanna ann freisin, trí shocruithe comhpháirtíochta I 1592 a bunaíodh Coláiste na Tríonóide, an ollscoil is sine in Choláiste na Tríonóide le hollscoileanna den scoth i dtíortha eile, Éirinn. Tá pobal bríomhar nua-aimseartha mac léinn as gach seimeastar a chaitheamh thar lear le linn duit a bheith i mbun contae ar fud na hÉireann agus as 122 tír ar fud an domhain staidéir. ag freastal air sa lá atá inniu ann. Bíonn an-mheas go deo ag fostóirí ar fud an domhain ar I gColáiste na Tríonóide beidh tú ag foghlaim ó ollúna ar chéimithe Choláiste na Tríonóide. Tá céimithe den scoth tagtha ceannródaithe iad ina réimsí staidéir féin. Tá 400 cúrsa fochéime amach as Coláiste na Tríonóide le blianta fada. D’fhreastail ar fáil ann i réimse disciplíní sna hEalaíona, sna Daonnachtaí, roinnt de na daoine is mó le rá i stair na hÉireann ar an san Innealtóireacht, in Eolaíocht, Gnó agus Teicneolaíocht, gColáiste: na scríbhneoirí Oscar Wilde agus Samuel Beckett; sna hEolaíochtaí Sóisialta agus sna hEolaíochtaí Sláinte. Tá na heolaithe William Rowan Hamilton agus E.T.S. Walton curaclam Choláiste na Tríonóide dírithe ar eolas a thabhairt ach, (a bhuaigh Duais Nobel as an t-adamh a scoilteadh), chomh chomh maith leis sin, ar smaointeoireacht chriticiúil an duine a maith le beirt d’Iar-Uachtaráin na hÉireann agus go leor fhorbairt. Tugtar cead cainte do mhic léinn agus spreagtar iad le ceannairí tionsclaíochta. páirt a ghlacadh sa díospóireacht agus a gcuid tuairimí sainiúla féin a chur in iúl. Tá súil agam go smaoineoidh tú ar Choláiste na Tríonóide a roghnú i dtosach ar choláistí eile le dul i mbun staidéir agus Cuirfear tacaíocht thréadach agus acadúil láidir ar fáil le linn le tabhairt faoi aistear úr i do shaol, aistear a thabharfaidh do thréimhse san ollscoil. Bíonn oide (ball den fhoireann dearcadh nua ar an saol duit, a chuirfidh bealaí úra acadúil) ag gach mac léinn a thagann isteach, a bhíonn ar fáil smaointeoireachta i do láthair agus trína ndéanfaidh tú cairde le comhairle a chur ort agus le cuidiú leat le haon deacrachtaí buana saoil. pearsanta a thiocfadh chun cinn. Níl a leithéid de chóras oidí le fáil in aon choláiste tríú leibhéal eile in Éirinn. Chomh maith leis sin, tá clár meantóireachta le mic léinn níos sine ar fáil do mhic léinn na chéad bhliana. Cuirimid réimse leathan seirbhísí ardchaighdeáin ar fáil do gach mac léinn, mar shampla an Patrick Prendergast tSeirbhís Ghairmthreorach, an tIonad Sláinte agus an tSeirbhís Propast Chomhairleoireachta. Iúil 2012 Is timpeallacht den scoth é an campas – áit chairdiúil shábháilte le dul i mbun léinn, le foghlaim, le bheith ar do chompord agus le * Tá Coláiste na Tríonóide, Baile Átha Cliath rangaithe sa chéad áit in Éirinn, maireachtáil ann. Lonnaithe i lár phríomhchathair na hÉireann, sa 65ú háit i measc an 100 ollscoil is fearr ar domhan agus sa 21ú háit i measc ollscoileanna ceannródaíocha na hEorpa de réir shraithliosta QS um tá saoráidí den scoth againn – ionad spóirt nua-aimseartha, an Rangú Domhanda Ollscoileanna 2011. I sraithliosta um Rangú Domhanda tÁiléar Eolaíochta agus Leabharlann Choláiste na Tríonóide, an Ollscoileanna de cuid Times Higher Education, rangaítear TCD sa chéad áit in leabharlann taighde is mó in Éirinn, ina bhfuil beagnach 5 milliún Éirinn, sa 117ú háit i measc an 200 ollscoil is fearr ar domhan agus sa 42ú háit leabhar agus breis is 70,000 irisleabhar. i measc ollscoileanna ceannródaíocha na hEorpa. CONTENTS
General Information Arts, Humanities and Social Sciences Welcome from the Provost 35 Arts courses at Trinity College – an overview 36 Arts: TSM* (Two Subject Moderatorship) 4 Trinity College’s Location 37 Business, economic and social studies (BESS) 5 Student Life at Trinity College 41 Business studies and a language (French, German, 5 Student entertainment & media Russian, Polish or Spanish) 6 Student societies 118 Business: Computer science and business 7 Sports centre and sports clubs 43 Classics 7 Theatres 45 Classics: Classical civilisation (TSM) 7 Gallery & Science Gallery 46 Classics: Greek (TSM) 8 Restaurants and coffee shops 48 Classics: Latin (TSM) 8 Accommodation 49 Clinical speech and language studies 9 An Ghaeilge/The Irish language 52 Deaf studies 55 Drama and theatre studies 10 Student Support Services 55 Drama studies (TSM) 10 Orientation for new entrants 57 Drama: Acting – The Lir (non-CAO) 10 Personal tutor 58 Drama: Stage management and technical theatre – 10 Peer mentoring programme The Lir (non-CAO) 10 Careers Advisory Service 59 Economics (TSM) 11 College Health Service 61 Education 11 Student Counselling Service 62 English studies 11 Chaplaincy 62 English literature (TSM) 11 Day nursery 64 European studies 12 Mature students’ officer 67 Film studies (TSM) 12 Access services 68 French (TSM) 12 Disability Service 69 Geography (TSM) 13 Learning Supports 70 German (TSM) 13 Student Learning Development 72 History 13 Library 72 History (TSM) 13 IT services for students 74 History: Ancient and medieval history and culture 14 Optional courses 75 History and political science 77 History: Ancient history and archaeology (TSM) 15 Find Out More About Trinity College 79 History of art and architecture (TSM) 15 Open Day 2012 80 Irish: Early and modern Irish 15 Mature students information seminar 80 Irish: Early Irish (TSM) 15 Mathematics/Physics open day 80 Irish: Modern Irish (TSM) 15 Nursing & Midwifery open day 82 Irish studies 15 Nationwide careers fairs 85 Italian (TSM) 15 School visits 86 Jewish and Islamic civilisations (TSM) 15 Visiting Trinity College & Campus tours 87 Law 16 Transition year programmes 90 Law with a language (French or German) 16 Online information 92 Law and business 17 Scholarships and Awards 94 Law and political science 164 Mathematics (TSM) 19 How to Apply 95 Music 24 Admission Requirements 2013 95 Music (TSM) 97 Music education Further Information 98 Philosophy 200 Index 98 Philosophy (TSM) 203 Alert list – 2013 99 Philosophy, political science, economics and sociology 204 Important dates for applicants 101 Political science 102 Political science and geography 104 Psychology 104 Psychology (TSM) 106 Religions: Catholic theological studies 107 Religions: World religions and theology 107 Religions: World religions and theology (TSM) 109 Russian (TSM) 110 Social studies (Social work) 112 Sociology (TSM) 113 Sociology and social policy 115 Spanish (TSM) * TSM (Two Subject Moderatorship) is a joint honors degree, choose two TSM subjects and study both to 2 honors degree level. See page 36 for further details. Engineering, Mathematics and Science Health Sciences
Computer science 171 Dental hygiene 117 Computer science 172 Dental nursing 118 Computer science and business 174 Dental science 120 Computer science and language 176 Dental technology 122 Information systems (non-CAO) 177 Human health and disease 124 Management science and information systems studies 178 Human nutrition and dietetics (MSISS) 179 Medicine 183 Midwifery Engineering 185 Midwifery: Bachelor in midwifery studies 125 Integrated engineering (common entry), with specialisations in: 186 Nursing 129 Biomedical engineering 186 General nursing 130 Civil, structural and environmental engineering 186 General nursing (Adelaide) 132 Computer engineering 186 Psychiatric nursing 133 Electronic engineering 186 Intellectual disability nursing 135 Electronic and computer engineering (joint programme) 186 Children’s and general integrated nursing 136 Mechanical and manufacturing engineering 190 Bachelor in nursing studies 137 Integrated engineering with management 191 Occupational therapy 193 Pharmacy Mathematics and Science 195 Physiotherapy 140 Science (common entry), with specialisations in: 196 Radiation therapy 144 Biochemistry 145 Chemistry 146 Environmental sciences 147 Functional biology 148 Genetics 149 Geography 150 Geology 151 Immunology 152 Microbiology 153 Molecular medicine 154 Neuroscience 155 Physics 155 Physics and astrophysics 157 Physiology 158 Plant sciences 159 Zoology 160 Chemistry with molecular modelling 161 Earth sciences 162 Human genetics 164 Mathematics 165 Medicinal chemistry 167 Nanoscience, physics and chemistry of advanced materials 168 Theoretical physics
This document is also available in alternative formats upon request. For further information contact the Admissions Office, Trinity College, Dublin 2. Phone: +353 1 896 4444, E-mail: [email protected] 3 Trinity College’s Location
Trinity College’s new Biomedical Sciences Institute.
Trinity College Dublin’s campus is situated in the heart of Dublin has a well deserved reputation as one of Europe’s Dublin’s city centre. Its state-of-the-art modern facilities include leading cities for tourism and entertainment. Many of its best the Sports Centre, Science Gallery, Nanoscience research cultural, historical and entertainment centres are within easy centre, Long Room Hub, and the new Biomedical Sciences walking distance of the College gates. The vibrant social scene Institute, situated in a 47-acre campus of cobbled squares, in the city and on campus ensures that students enjoy historic buildings and green playing fields. a wonderful social life while studying at Trinity College.
Trinity College’s central location makes it highly accessible for Take a virtual tour of Trinity College’s campus: all forms of public transport, such as LUAS (light rail transit) www.tcd.ie/virtualtour. lines, the DART line (Dublin’s suburban rail system) and a large number of Dublin’s bus routes. The national bus routes are a few Browse campus maps and directions to Trinity College minutes walk away, Dublin’s main two train stations are in close at www.tcd.ie/maps proximity, while Dublin airport is 13km from the campus and is directly accessible via bus or taxi.
L CONNOLLY O STATION SAVOY W R105 CINEMA E DART M R LUAS
A G Trinity College’s Location College’s Trinity DUBLIN CITY CENTRE O R A ’ L R T C B D S O O I N S N R N O E N E R I U E T S T S M L G LBO T L A A C CINEWORLD H T
A S
P T S T E R L E S E
T T J
E BUSARUS
R BUS STATION V
GEO I R GE’S D S O T CK S DP R L RY O S F N ES E T H R E GPO B
T ST Y S Y BE AR AB M R WE O IFSC L THE CUSTOM
HOUSE
ABBEY
B
T
U THEATRE A
T
C L
USTO Y T M UA B ET HOUSE Q
TRE COMEDY
S O EY S
B B AB E E
L THEATRE D Y T ID A R M U A
Q
I
B
N N E D NOR
TH S D W
L E R ALL Q
G
UA A LUAS W Y O
I O
D M
E ’ R
C ’ G C
U L O
B E A I E R N Y F K S L UA R105 L A Q F E I Y
W N D H B E ’S RG Y
R E U E Y G LO B RIVER LIFFEY
B
E L C TS H E S L C C R
T I K C O A TY L T B H Q I
H U E
A RT AY D
A T O M P
N N1 G
N11 W POOLBEG ST T
E
O
N4 E L W
K B
S
T D R
S I L
N S E
’ A I
T O U
D
S
’ R
Y L S
K S S
T O
A G I A
U E T UT
E H Q M
R S
SCREEN G E Y
UA N LO
S U Q S S T C ND TO O EST
O T CINEMA T ER TO FOUR ORM AS T ST
R COURTS OWER N4 L E
Y L UA T Q A D ST TOWNSEND S S RIVER LIFFEY B LEET T N C F MO Y N R E O UA E T
ER Q ET S D E D P D FL P N C T
U TO OWNS R F G EN N I D S A I S DART T L L L O
E N P E1 B T I E
W E A M A R R E S R E M
E
S A D G T S
U E O
Y R
A S
U T X Q G L E R
S S K E ES Y E AST O L
T T H
C L P A S N A EA S O
W O E V A R E
ON T R
I C S STAT C C E M A C ST
N M TEMPLE ST AR
O R K E
HEUST E ’S LN A O COPE ST L
TO O BAR S
N11 E1 P W
R T S
I
E
OLYMPIA S N
S IFI T
THEATRE T N CINEMA N81 E DAME ST G T N81 G A S
R E1 M E A N
S F R O CHRISTCHURCH ME LN T
DAM DA E E LN O
U LN P CATHEDRAL D S EA S U PEARSE RS R T ’ N E S CITY A W F T E H E F O STATION M R HALL L S W K
G D T E ST O
R N L C
E A N11 T A T
T S N11
G EXCHEQUER ST WICKLO E W S
O N T AS
R SAU G B ST OY
E N
POWERSCOURT G E
’
S ST
DUBLIN T R T
TOWNHOUSE DART S S A S
CASTLE T T CENTRE F Y T
S K R T S S C O
P O I U N LAC
U M TH L E
N R N R A LE O I E IN C
D O
L D STE IN
S UKE D R S TL
L ST S I T E R R114 W W F F A E C NIAN H L N11 ST D H A T R T E L U S OW S T ER O T S S S T M EPH S OL OU ES E E E C TH A W H NNE OR R N N N A ST TH L TH A N R A ST NATIONAL S M S NATIONAL U O E S T R
A T LIBRARY OF T
E GALLERY Q H R U E T S T G IRELAND M P S S
N E G N R P I E
G R U O I N D N11 R I O
I E GAIETY N E
E AS A R
T B S K R R THEATRE D Q
O E C L U
S I A W MANSION M R A
T K E L HOUSE T M N S E MERRION TEPHEN S ’S GOVERNMENT W SQUARE ST PATRICK’S T GR CATHEDRAL S EEN BUILDINGS N11 ST STEPHEN’S N11 LUAS GREEN
1 MILE
1 KM
4 Student Life at Trinity College
Student entertainment and media Trinity Publications The award-winning magazines and newspapers that constitute Student entertainment Trinity College’s vibrant student media are supported by Trinity Publications. These include Trinity News (Trinity’s independent University life is about so much more than just education and broadsheet newspaper) and its supplement magazine Tn2, The nowhere is that more evident than at Trinity College Dublin. By Bull (Ireland’s only student financial paper), The University Times attending Trinity you have the option to experience 112 societies (Student Union broadsheet newspaper), Icarus (literary review), and 50 sports clubs and play a part in a vibrant student media TCD Miscellany (commentary and the oldest student publication environment, the oldest and best in the country. Through these in the country), The Piranha (satire), Trinity Film Review (film activities you will gain a true sense of the Trinity Experience, review), The Attic, The Social and Political Review, and The something that involves so much more than just academia. You Histories and Humanities Journal. will also have the benefit of one of the best student unions in the country providing students with a broad range of entertainment 2012 was a successful year for Trinity’s Publications at the and services. While all elected representatives work tirelessly National Student Media Awards, with the University Times to make sure your Trinity Experience is an enjoyable and winning ‘Newspaper of the year’ for the third year in a row, while productive one, the Students Union officer that is likely to have the editor of Trinity News won the ‘Editor of the Year’ award. the greatest impact on your time at Trinity is the Entertainment Other awards for Trinity Publications included ‘Best Magazine’, Officer or ‘Ents Officer’. The Ents officer will ensure you have and the ‘Sports Writer of the Year’. In total Trinity claimed over someplace to go whenever you feel like a night out and is also one fifth of all awards on offer. If you think you may like a future responsible for the world renowned Trinity Ball - a night to career in media then we, as national leaders, can give you the remember year in and year out. best possible experience. Student Life at Trinity College
The Pav is Trinity’s on campus bar located on the edge of the Trinity Publications celebrated alumni include author and sports pitches and the entertainment hub of the University. journalist Mark Little; Peter Murtagh and Eoin McVey – Listening to live music, watching matches on big screens, or Managing Editors of The Irish Times; Paul McGuinness – simply relaxing with friends watching the sun sets over an Manager of U2; Ed Mulhall – former Managing Director of News institution that is older than the state itself have made the at RTÉ, former Financial Times editors and many more notable Pav a favoured haunt for generations of students. When you figures in Irish and international media. feel like a change from the Pav, you have all of Dublin’s night clubs, Temple bar and a plethora of other venues right on your All students are encouraged to contribute to our publications. We doorstep. No other Irish university can offer such a diverse and also welcome applications to start up new student publications in easily accessible entertainment scene. College, and can offer funding to cover print costs and the use of our industry-standard design software and equipment. Of course Trinity’s entertainment goes much further than nightlife. The university is renowned for attracting some of Visit www.trinitypublications.ie where you find more the most interesting and famous quests from around the information on what we do as well as links to all of our world. Recent speakers included – Bono, Nancy Pelosi, Sean publications. Alternatively keep up to date with all things William Scott (American Pie), Eddie Jordan, Rafa Benitez, Alex Trinity on www.trinitynews.ie or www.universitytimes.ie. Ferguson, Helen Mirren and John McCain to name but a few. Should you still require more ways to spend your time, Trinity’s societies and clubs organise numerous trips abroad to various European destinations, many events, and even an annual ski trip to one of Europe’s best resorts.
In the pages that follow you can read in detail just how the Trinity Experience can make sure that your time at university is one you will never forget.
5 Students’ Union Student societies The Students’ Union is the hub of student life on campus. Whether you are looking for a place to hold a class party, There is more to the Trinity experience than lectures and study. looking for general advice on how College operates, feeling One of the core elements of student life is the range of activities stressed and need someone to talk to, having problems with organised by students for students. Trinity’s 112 societies, timetables, or for almost any other reason you can think of the covering a broad range of interests from Afro-Caribbean to Students’ Union will point you in the right direction. It is the main Zoology, constitute the most dynamic and active set of university representative body for all students in Trinity College and its role student societies in Ireland. is to work on behalf of students. The Students’ Union provides There is something for everyone with large societies such as a broad range of services, including two shops, a bookshop, the Philosophical Society and the College Historical Society with a café, a travel card and information office, and job listings. their established debating tradition and impressive list of guests; The union also organises a comprehensive entertainment to DU Players, the drama society who hold approximately 50 programme including class parties, gigs, nights out, mystery shows a year, which as a member of, anyone can get involved tours, comedy nights and the famous Trinity Ball. with at any level. You can learn all about horse racing, engage Five full-time officers are elected to work as union officers every in activism with DU Amnesty or make a difference with Vincent year. These are: the President, Education officer, Welfare officer, de Paul. You can write and produce your own film with the Communications officer and Entertainments officer. Part-time Filmmakers Society, host a show with Trinity FM, perform with officers work on representing and promoting specific areas the renowned Trinity Orchestra or learn all various aspects of of College and every class has a class representative who digital and SLR photography with the Photography Society. organises class parties as well as helping with student problems You can try your hand to everything from singing to sci-fi, and acting as a link between students and College officers. juggling to jazz, alternative music to animal rights, and politics The Students’ Union is also affiliated to the Union of Students to paintballing, relax with the Yoga society or de-stress in a in Ireland (USI). All students are automatically members of the different way with the arts and craft activities run by the likes union and it’s very easy to get involved as a class rep, by writing of the Trinity Arts Workshop. for student union newspaper, The University Times or by being Joining societies is an ideal way to meet people and offers on the Ents crew. It’s your union, so we hope that you will use it! invaluable support as well as an introduction to Trinity life. For more information visit www.tcdsu.org However, if you don’t find a society that interests you, you can always set one up yourself!
You cannot miss the array of society stands in Front Square during Orientation Week but never fear if you don’t join during this week – societies are open to new members throughout the year. Student Life at Trinity College Student Life at Trinity
Find out more about Trinity Colleges student societies at: www.trinitysocieties.ie
6 Sports centre and sports clubs The ladies hockey club play in the 1st Division of the Leinster League, the rugby club was promoted to AIL Division 1B and the Gaelic Football club gained promotion to the Sigerson Cup. Sports centre These clubs also cater for recreational sport and the Gaelic Club Whether a budding sports star of the future or a sporadic introduced recreational hurling and football (Camán Abú and Peil exerciser, our state of the art sports facilities, backed up with Abú) last year. a selection of excellent services, provide the ideal venue for a For more information on our sport clubs please view the range of activities, available to all students, at all levels. departmental website at www.ducac.tcdlife.ie The Sports Centre contains a vast array of facilities, including a 25m swimming pool, sauna and steam rooms, fitness theatre and holistic treatment rooms. The main hall hosts a range of Theatres sports including basketball, badminton, volleyball and 5-a-side The Samuel Beckett Centre comprises the Samuel Beckett soccer. Also on-campus are squash courts, tennis courts, a Theatre (a 208-seat black box performance space), Players futsal pitch, rugby, soccer and cricket pitches, and a grass Theatre (the studio theatre of the student drama society), a athletics track in the summer. Two miles upstream from the dance studio/rehearsal space, seminar rooms and offices. College is a boathouse accommodating the Ladies’ and Mens’ During term time the Samuel Beckett Theatre showcases the Boat Clubs and at Santry Avenue, five miles north of the work of Drama and theatre studies. It has also hosted visits from campus, there are additional pitches for rugby, soccer, hockey some of the most prestigious dance and theatre companies from and gaelic games. Ireland, Europe, Japan and the United States. Regular events at The sports centre also runs and manages a growing programme the Samuel Beckett Theatre include the Dublin Theatre Festival, of sports courses, and inter-college competitions; as well as as well as an on-going series of lectures in contemporary theatre fitness assessments/programmes and over 20 aerobic/dance by practitioners and scholars. classes every week, including Studio Cycling, Power Pump, Find out more at www.tcd.ie/Drama Pilates, Circuits and much more. This is a great opportunity Student Life at Trinity College to maintain a healthy and fun-filled lifestyle whilst studying at The Lir Academy includes two studios – Studio One (a 150- Trinity. For more information visit our website: seat black box performance space) and Studio Two (a 70-seat www.tcd.ie/sport black box performance space). From September 2013 The Lir’s performance spaces will present a continuous programme of work featuring graduating students of the Academy, directed Sports clubs and designed by some of Ireland’s leading theatre practitioners. Thousands of new students use sport clubs each year to forge The Lir also hosts professional productions as part of the friendships which often last a lifetime. Student sport clubs are Dublin Theatre Festival and Dublin Fringe Festival as well as managed by the Dublin University Central Athletic Club which an occasional series of once-off performances, entitled The Lir runs approximately 50 sport clubs ranging from team sports Presents…, conceived in the context of the degrees and courses such as GAA, rugby, soccer and squash to individual sports offered at The Lir featuring performances from some of the such as athletics, fencing, rifle shooting and triathlon. Whether world’s leading theatrical innovators. you are new to a sport or would like to get involved at a more Find out more at www.thelir.ie advanced level; there is something to suit everybody.
Gallery & Science Gallery
Located at the Nassau Street entrance of Trinity College, the Douglas Hyde Gallery is one of Ireland’s leading galleries of contemporary art. These are twelve exhibitions each year, including shows by some of the most highly regarded international painters and photographers, as well as highlighting interesting and exciting new art from Ireland. It is often the case that an exhibition in the Gallery is the first time an artist’s work is shown in this country.
The Gallery regularly holds free film screenings, talks, and music events. Students can avail of a discount on the Gallery’s books and our wide range of art, architecture, and culture magazines. Find out more at www.douglashydegallery.com
Science Gallery is a world first. A new type of venue where At intervarsity level last year, Trinity clubs were successful in today’s white-hot scientific issues are thrashed out and you can a number of sports including boxing, climbing, cycling, gaelic have your say. A place where ideas meet and opinions collide. games, fencing, lawn tennis, rifle and volleyball. In addition a See www.sciencegallery.com significant number of students achieved individual success at intervarsity, regional and national levels, in their chosen sport.
7 Restaurants and coffee shops Cost of rooms in Trinity Hall 2012/2013 Twin en-suite room €4,256 On-campus, students have a wide choice of restaurants and Single room with shared bathroom €4,605 coffee shops to suit all tastes and budgets. All outlets are proudly Single en-suite room €5,536 operated and managed by Trinity College’s Catering department. Students can choose from the Buttery Food Court with a hot Rent inclusive of utilities, data, and cable TV. food counter, deli counter and gourmet coffee option; the Hamilton Restaurant, and the very popular Dining Hall, where How to apply for Trinity Hall lunch is enjoyed in traditional splendour. You will also find coffee As soon as you have accepted a place in Trinity College you shops serving Lavazza coffee in the Arts Building, the Westland, may submit an application for Trinity Hall online at www.tcd.ie/ Aras an Phiarsaigh, and the new Biomedical Sciences Institute. accommodation/StudentsandStaff/Students/ApplyforaRoom All coffee and tea served is ethically sourced and of superior quality. For more information on opening times and menus visit www.tcd.ie/catering or for details of upcoming events or special On-campus rooms offers follow us on twitter. Rooms on campus are mostly reserved for students in their final year and Trinity Scholars (see page 17). There are a number of In addition, Dublin city’s wide selection of restaurants, cafés, rooms on the campus suitable for students who have mobility delis and coffee shops are within a few minutes walk of College. difficulties and who are capable of independent living. Where, due to medical or other particular circumstances, participation in Accommodation College may be facilitated by the provision of accommodation, applications will receive special consideration. Applications There is accommodation both on campus and at Trinity from students with special needs should be addressed to the Hall a short distance away. New entrants are predominantly Registrar of Chambers, Accommodation Office, West Chapel, accommodated at Trinity Hall which is in Dartry, near Rathmines Trinity College, Dublin 2 as soon as an offer to a course at Trinity – about 2.5 miles from the city centre and easily accessible College is received. A supplementary form will then be sent from Trinity College by bus and the LUAS tram system. There requesting information from a medical practitioner and other are over 1,000 residential rooms at Trinity Hall and a significant relevant professionals, this form can also be downloaded from number are reserved for new entrants to College. the web.
Find out more at www.tcd.ie/accommodation/ Trinity Hall StudentsandStaff/Students/ApplyforaRoom Rooms are arranged in self-catering apartments, with each typically accommodating six persons and consisting of a mix Other options for first-year students of single and twin en-suite bedrooms with a large kitchen/living Student Life at Trinity College Student Life at Trinity For students who do not apply for or do not secure a place in room. All rooms are centrally heated, all floors are serviced College accommodation the alternative is to seek private rented by lifts, electric appliances are supplied in the kitchens, and accommodation, usually sharing an apartment or a house with for security, electronic swipe card locks are used throughout other students. and are fitted on bedroom doors. Residents of Trinity Hall also become members of the Junior Common Room which organises The Accommodation Advisory Service operates annually a range of extra-curricular activities. from late August to the beginning of term in cooperation with the Students’ Union. It provides information and contacts for Why apply for a place in Trinity Hall? See www.tcd.ie/ students wishing to secure rented accommodation and offers accommodation/StudentsandStaff/Students/TrinityHall/whyhalls guidance on what to look for when renting. Phones are provided To hear from former residents and parents of Hall residents so that students may make contact with landlords. The Advisory view our video clip at www.tcd.ie/accommodation/ Service may also be able to give some information on digs or StudentsandStaff/Students/TrinityHall lodgings (residing in a room in a house with meals provided).
Ar mhaith leat páirt a ghlacadh i Scéim Chónaithe Dhartraí, For further information and advice see www.tcd.ie/ scéim i Halla na Tríonóide do lucht na chéad bhliana? Would accommodation/StudentsandStaff/UsefulInformation/ you like to take part in Scéim Chónaithe Dhartraí, an Irish PrivateRentedAccommodation speaking residential scheme for Junior Freshman students in Trinity Hall?
Tuilleadh eolais/For further information, go to www.tcd.ie/ gaeloifig/sceim-chonaithe/sceim-dhartrai
Trinity Hall Open Days are usually held on the Friday afternoon and Saturday in August after the Leaving Certificate results are published.
8 An Ghaeilge/The Irish language
Tá an Ghaeilge faoi bhláth anseo i gColáiste na Tríonóide i gcroílár Bhaile Átha Cliath, agus bíonn sí á labhairt ar fud an Choláiste. Tá sí le feiceáil i bhfoilseacháin oifigiúla an Choláiste agus i nuachtáin na mac léinn. Tá líon mór ball sa Chumann Gaelach (féach www.cumann.ie), ceann de na cumainn mac léinn is bríomhaire sa tír, a chuireann clár spleodrach imeachtaí sóisialta ar fáil.
Tá Oifig na Gaeilge (féach www.tcd.ie/gaeloifig) ann chun an Ghaeilge a chur chun cinn ar fud an Choláiste, mar aon le comhairle a thabhairt maidir leis an Acht Teanga. Bíonn an Oifig ag feidhmiú i gcomhar le Coiste na Gaeilge, le tacaíocht ó údaráis an Choláiste agus ón Údarás um Ardoideachas. Leagtar amach gealltanais maidir le seirbhísí dátheangacha i Scéim Teanga an Choláiste.
Cuirtear cúrsaí deonacha Gaeilge ar fáil saor in aisce do mhic léinn agus cuirtear fáilte ar leith roimh mhic léinn úra nach bhfuil ag déanamh staidéir ar an nGaeilge mar ábhar acadúil. Tá dhá Scéim Chónaithe Ghaeilge againn do mhic léinn: Scéim Chónaithe Dhartraí i Halla na Tríonóide (do dhaoine atá ag tosú sa Choláiste) agus Scéim Chónaithe an Champais (ar phríomhchampas an Choláiste, do dhaoine atá sa dara bliain Student Life at Trinity College nó níos airde).
Go luath sa dara téarma, bíonn féile mhór Gaeilge an Choláiste – Éigse na Tríonóide – ar siúl ar feadh seachtaine, le réimse leathan imeachtaí, idir spóirt, díospóireachtaí, ceolchoirmeacha agus eile. Bain sult as do shaol trí Ghaeilge i gColáiste na Tríonóide!
Irish is flourishing here in Trinity College in the heart of Dublin. You will hear it being spoken throughout the campus and will see it in College and student publications. College’s Cumann Gaelach (see www.cumann.ie) is one of the most vibrant Irish-language student societies in the country, with an exciting programme of social events.
The Irish Language Office/Oifig na Gaeilge (see www.tcd.ie/ gaeloifig) promotes the Irish language in College generally as well as advising in relation to the Official Languages Act. The Irish Language Office operates in conjunction with Coiste na Gaeilge, Trinity College’s Irish Language Committee, and with the support of the College authorities and the Higher Education Authority. Commitments in relation to bilingual services in College are set out in TCD’s Irish Language Scheme.
Voluntary Irish classes are available free of charge to all students, including those who are not studying Irish as part of their academic course. Trinity College has two Irish-speaking student residential schemes – Scéim Chónaithe Dhartraí (in Trinity Hall, for first-year students) and Scéim Chónaithe an Champais (on the main campus, for continuing students).
Early in the second term, College’s annual week-long Irish festival, Éigse na Tríonóide, takes place. The programme features a wide range of activities – including sport, debates, concerts and tours. Enjoy the Irish language as part of your Trinity College experience!
9 Student Support Services
Orientation for new entrants Peer mentoring programme
During your first week in College (Orientation Week), Trinity From the moment you arrive in College right the way through College offers a comprehensive orientation programme to new to your end of year exams, the Student 2 Student (S2S) peer entrants. The programme includes general orientation meetings, mentoring programme is here to make sure your first year is specific meetings for your course, library tours, sports tours, fun, engaging and a great foundation for the rest of your time advice sessions about issues such as managing your finances, in Trinity. You’ll meet your two S2S mentors during Orientation and a range of nights out – organised by clubs, societies and the Week and they will make sure that you know other people in Students’ Union. your course before your classes even start. They will keep in regular touch with you throughout your first year and invite you Trinity College has a vast array of clubs and societies for you to to events on and off campus. They will also give you useful join during Orientation Week. They are a fantastic way to make information about your course and what to look out for. Mentors new friends and to get a feel for the sense of community here are students who have been through first year and know exactly at Trinity College. Also be sure to look up the Students’ Union to what it feels like, so you never have to worry about asking them find out what is happening throughout the year. a question or talking to them about anything that’s worrying you.
S2S also offers trained Peer Supporters if you want to talk confidentially to another student or just to meet a friendly face for a coffee and a chat. S2S is supported by the Senior Tutor’s Office and the Student Counselling Service.
http://student2student.tcd.ie, E-mail: [email protected] Phone: + 353 1 896 2438
Careers Advisory Service
The Careers Advisory Service (CAS) offers a range of services and resources to assist students in preparing for, making, and implementing informed decisions about their future careers. Student Support Services
n Group and one to one guidance to help with career-planning including support after graduation. n Assistance with the search for internships, employment or further study options. The VACWORK programme offers students the opportunity to secure work experience during the summer before their final year. n Access to specialist careers information resources including dedicated databases available exclusively from our award- winning website. n Extensive training in all aspects of the further study or job Personal tutor application process including CV preparation, completion of application forms and the preparation of personal Each undergraduate student at Trinity College is assigned a statements. personal tutor on entry to College. n Practice interviews on video. Tutors are members of the academic staff who are specifically n Development of skills through volunteering in Ireland and abroad. appointed to tutorship to provide personal and academic support to undergraduate students. Their main function is to advise, Find out more at www.tcd.ie/careers and www.tcd.ie/community. listen to concerns, help tutees deal with issues as far as possible The careers Advisory Service continues to provide careers and refer more serious difficulties to the appropriate student support after graduation and, in association with the Alumni services. Tutors provide a welcoming ear for students allowing Office, the very successful Trinity Alumni Career Network provides them the freedom to talk confidentially about any issues which workshops to assist graduates seeking employment as well as may arise. those considering a career change. In addition, Front Gate Online Find out more at www.tcd.ie/Senior_Tutor is the web based alumni community, which allows graduates to connect with other alumni and support current students.
Find out more at www.tcd.ie/careers or at www.tcd.ie/alumni
10 College Health Service Student Counselling Service
The College Health Service provides primary health care for The Student Counselling Service is staffed by qualified registered students. professional psychologists and psychotherapists. It provides n It also focuses on the psychological and occupational a range of free services to TCD students including: aspects of student health and health education. n Short-term individual counselling for personal and n Student consultations are free of charge with modest fees for psychological issues, including a daily emergency slot and additional services. lunchtime drop-in consultations. n There are specialised clinics in physiotherapy, psychiatry, n Groups, e.g. for anxiety, depression, bereavement, travel health, sexual health, eating disorders and minor mindfulness, and support for international students. surgery. n Wellbeing workshops e.g. self-esteem, body image issues, and relaxation. Health care provision in Ireland n The Online Mental Health Portal, a TCD web community All EU students from outside the Republic of Ireland pursuing for obtaining self help information and getting anonymous a full degree programme should contact the Health Service counselling support: https://mymindmatters.ie Executive for advice regarding healthcare provision – see n An after-hours Niteline telephone service run by students www.hse.ie for students. Free-phone: 1 800 793 793, Thurs-Tues, 9pm-2.30am. n All EU students should bring with them a European Health Insurance Card issued in their country of origin. For more information and resources: n Non-EU students are not entitled to free national health www.tcd.ie/student_counselling services in Ireland, and are advised to take out insurance cover for hospitalisation or to extend private health insurance before leaving their home country. Chaplaincy Student Support Services n Students without private health insurance who will be n The ecumenical Chaplaincy team work closely together and resident in the country for a minimum period of one represent four of the main Christian traditions in Ireland: academic year may apply to the Health Service Executive to Catholic, Anglican, Presbyterian and Methodist. be assessed for entitlements. n It’s a place of hospitality for all members of the College community; students of all faiths, or none, are welcome. n A variety of worship gathering & events are organised during the year – traditional, and non-traditional, Christian services take place weekly in College. n During term time, tea and coffee are available all day in the Chaplaincy Common Room (House 27) and students are invited to call in for lunch on Tuesdays – Come early, it’s always full!
Find out more at www.tcd.ie/Chaplaincy
Day nursery
Trinity College’s day nursery takes care of children from 3 months to 4.5 years of age. There are five different rooms for children of different age groups.
See www.tcd.ie/about/services/daynursery for further details.
11 Mature students officer Disability Service
Trinity College recognises the unique contribution and Trinity College is committed to a policy of equal opportunity in commitment that mature students make to College academic education and to ensuring that students with a disability have as and social life. A full-time mature students officer provides complete and equitable access to all facets of College life as can guidance and support to both prospective applicants and current reasonably be provided. This includes students with a physical, mature students. sensory, medical, mental health condition or specific learning difficulty that impacts on their ability to achieve academic goals. Supports include: n One-to-one guidance and support for prospective mature Support available to students include: applicants. n Pre-entry advice on admissions, course choices and College n Further Education College visits and presentations. life. Study skills and assistive technology solutions for Leaving Certificate students: www.tcd.ie/pathways-to- n An information morning on preparing for College for all trinity e-mail [email protected] successful mature applicants each July. n Needs assessment on entry to determine any additional n A week long orientation programme for mature student prior learning requirements. to the start of term in September. n Assistive technology training and technology rooms in n Weekly student support drop-in clinics for registered mature College libraries. students. n Liaison with your tutors/lecturers to help arrange accessible For further information on studying in TCD as a mature student programme materials. please phone +353 1 896 1386, e-mail: mature.student. n An e-mail distribution list to keep you in touch. [email protected] or visit www.tcd.ie/maturestudents n Extended library loans. n Liaison with other University services such as Access services Accommodation, Buildings, Examinations and outside agencies. TAP (the Trinity Access Programmes) provide a range of n UNILINK: a practical occupational therapy service for supports and services through their Post-Entry Progression students registered with the Disability Service who may be Programme. These supports are available to students who experiencing mental health difficulties, or have a physical enter undergraduate programmes in TCD through the Higher disability or significant on-going illness www.tcd.ie/ Education Access Route (HEAR), Foundation Courses for Young disability/services/Unilink/index.php. Adults and Mature Students, and the CDVEC University Access n Specialist support service for students with Asperger’s Courses (in partnership with Pearse College, Plunkett College Student Support Services Syndrome. and Liberties College). n Comprehensive information about the full range of services These supports include: is available from www.tcd.ie/disability e-mail [email protected] n A tailored week long pre-university orientation programme or by phone directly on +353 1 896 3111. (the week before Orientation Week). Students with a disability should follow the application process n Academic supports including extra tuition, a laptop lending detailed on page 19. service, a writing resource centre and maths help room, and the TAP studio – a designated study space equipped with IT resources. n Social and personal supports – each Junior Freshman (first-year) student is linked to a member of TAP staff, their TAP advisor. Advisors meet with students regularly and offer advice, guidance and support and assist students with any personal or academic issues. TAP also runs a number of social activities throughout the year for students. n Financial support (when available and applicable) including a TAP scholarship, supported childcare scheme and the TAP hardship fund.
Comprehensive information about the full range of TAP services and supports is available from: web www.tcd.ie/Trinity_ Access/current e-mail [email protected] or by phone +353 1 896 2751 / 3598.
12 Learning Supports
Student Learning Development The Old Library (1732) is one of Ireland’s greatest buildings, and the Long Room is one of the most famous library spaces Student Learning Development provides learning support to help in the world. It contains the reading rooms for manuscripts and students improve their academic performance and to reach their for early printed books, as well as providing a public exhibition academic potential. The supports include: space with the Book of Kells (entrance is free for Trinity College students). n Individual consultations – meet with a learning advisor to discuss your study issues and ways to become a self- The Library offers many facilities including group study rooms, directed learner. a multimedia resource area and assistive technology suites. n Free workshops throughout the year on a variety of topics for Undergraduates are encouraged to browse and explore the students from all departments, including undergraduate and online catalogue: the key to finding the Library’s printed and postgraduate students. electronic resources. You can also use the catalogue to renew n A website with a range of resources including podcasts, and request books online. downloads and interactive workshops that provide academic support to students. Topics include time management, Tours, seminars and workshops are given throughout the year to effective study skills, exams, academic writing, presentation help students get the most out of using the Library. One to one skills and more. help is available too at the Duty Librarian desks and from the Subject Librarian team who offer specialised subject help. n For more information please visit http://student-learning. tcd.ie Students can access the Library’s electronic collections on n Other supports for learning in College include: campus or at home. Find out more about the Library at l The Maths Help Room, which provides informal help www.tcd.ie/Library from Trinity students. It is located in the Maths Seminar Learning Supports Room, 2nd Floor, 18 Westland Row and is open on Monday-Friday, from 1-2pm. IT services for students l The Programming Support Centre is available to all Undergraduate students at TCD are provided with access to computer science and engineering students taking a wide range of computer facilities and services provided by programming courses. See www.scss.tcd.ie/misc/psc the Information Systems Services department, known as IS n Peer Learning is available in several of the modern language Services. These include: departments. It involves working with other students to get n Access to hundreds of computers located in over twenty the most from your course to improve performance. E-mail student computer rooms across the campus. Many of these us for further information: [email protected] rooms are open 24 hours a day, 7 days a week. In addition to the standard software packages such as MS Office, Library some computer rooms have specialist software to support particular courses or projects. Dedicated e-mail/web stations Trinity College’s library is the largest research library in Ireland. located close to large lecture theatres enable students to The collections include 4.5 million printed volumes, almost check their e-mail and to use the web between lectures. 300,000 electronic books and journals and an extensive n All student residences are networked to provide a fast collection of literary, historical and political manuscripts, including broadband service. In addition, some residences, and many the Book of Kells. The Library has the country’s largest collection areas of the campus, have Wi-Fi access to the College of maps and printed music. network and internet. This network is designed to the highest security standards and students register their computers to The reading rooms are in a number of buildings, all of which gain access. have access to the College wireless network. The Berkeley/ Lecky/Ussher library complex contains the collections for arts, n At registration each student is issued with a Trinity College humanities, social sciences, geography, geology, and nursing, e-mail account, together with a range of other applications, together with the Map Library. hosted by Google. Students retain this account for life after leaving Trinity College. The Hamilton Science Library holds the collections for n E-learning plays an important role in the learning experience engineering, mathematics, science and some health sciences. of students in Trinity College. Resources for many courses are available in the College’s learning management system. Clinical health science material is held at the John Stearne Medical Library at St. James’s Hospital at the AMNCH Hospital, n All students have access to the IS Services Helpdesk where Tallaght. queries regarding any of the above services are dealt with by a team of IT professionals. n Find out more at isservices.tcd.ie
13 Optional courses Optional language courses Optional evening language courses (for students who are not studying a language as part of their degree) are available. The Broad Curriculum number of places available for first-year students is limited, but The University of Dublin is renowned internationally for the breadth students may apply for optional and credit-bearing language and depth of the degrees it awards. Trinity College is dedicated courses in subsequent College years. The courses take place at to encouraging the following qualities in its students and graduates: the Centre for Language and Communication Studies (CLCS), inquisitiveness and analytical ability; creativity and reflectiveness; and are designed to help develop practical communication skills adaptability; breadth of reading; ethical responsibility; international for study or work experience abroad. CLCS language modules outlook; articulacy; literacy; and numeracy. may also be taken for credit (5 ECTS) by undergraduate To assist with the development of these qualities, Trinity College students under the Broad Curriculum. offers students the opportunity to study one module outside The following language modules are available: their chosen course, via the Broad Curriculum. These Broad Curriculum modules are usually available to students in the Irish (A1, B1); French (A1, B1, B2); Spanish (A1, B1); Italian Senior Freshman (second) or Junior Sophister (third) year. (A1, A2); German (A1, A2, B1, B2); Turkish (A1, A2, B1); Korean The chosen module would typically account for approximately (A1, A2); 10% of the teaching for the year. A1 level classes are for complete beginners; A2 classes are for At the time of publication, Trinity College offers 18 broad post-beginners. For B1 and B2 level classes, the minimum entry curriculum modules in literature, film studies, languages (2 modules), philosophy, psychology, political science, living requirement is a Leaving Certificate (or equivalent) qualification sustainably (2 modules), criminal law, business, planet earth, in the relevant language. art in Ireland (2 modules), science and technology, gender and Find out more at www.tcd.ie/slscs/undergraduate/clcs- society, and history (2 modules). language-modules Find out more at www.tcd.ie/Broad_Curriculum
OPEN DAY 2012 Learning Supports Saturday 1st December 2012 The exciting and informative programme of events will include:
n Course specific presentations
n Individual stands for each course, where you can meet our academic staff and current students to obtain detailed course information
n Demonstrations and laboratory tours
n Presentations about student sports, societies and the Students’ Union
n Specific sessions for mature students, access students, and parents
n Campus tours and tours of College facilities, including the sports centre
Full details will be available at www.tcd.ie/Admissions/undergraduate in November.
14 WE LOOK FORWARD TO MEETING YOU AT OUR OPEN DAY! Find Out More About Trinity College
Open Day 2012 School visits
The staff and students of Trinity College would like to invite all Staff from Trinity College are available to visit a limited number students, their parents/guardians, mature students, teachers and of schools to provide a presentation about Trinity College and guidance counsellors to attend our Open Day, which will take our range of courses. If you would like to request a visit to place on Saturday 1 December 2012. See the preceding page your school please contact the Admissions Liaison Officer by for further details. telephone at +353 1 896 3992 or by e-mail: schools.liaison@ tcd.ie Mature students information seminar Specific visits from our Schools of Computer Science and Statistics, Nursing & Midwifery, and Engineering are also A seminar providing advice and information on making an available (where visits may be impractical due to geographic application to TCD for prospective mature students will take location, visits can be organised for small groups of prospective place on Thursday 10 January 2013 from 5 pm to 6 pm. This students to meet the academic staff in Trinity College). seminar will be repeated from 6 pm to 7 pm. Please visit the mature students website in December 2012 for more To request a visit please contact: information: www.tcd.ie/maturestudents n The School of Computer Science and Statistics: E-mail: [email protected] Tel: +353 1 896 3665 n The School of Engineering: E-mail: [email protected]
Mathematics/Physics open day Find Out More About Trinity College Tel: +353 1 896 1142 The Schools of Mathematics and Physics will hold a specific n The School of Nursing and Midwifery (Jeni Ryan): Mathematics/Physics open day on Saturday 10 November E-mail: [email protected] Tel: +353 1 896 3860 2012. This is a special event for students interested in studying maths or physics, parents and teachers are also very welcome to attend. There are interesting talks by our professors and Visiting Trinity College lecturers on topics like particle physics, string theory, complex & Campus tours numbers, nanophysics or astrophysics, and lots of useful information on how to apply and about career opportunities Guidance counsellors may request an on-campus presentation for maths and physics graduates. We will also provide lunch and a campus tour from the Admissions Liaison Officer (for (a great time to meet the lecturers and students currently visiting school groups). On-campus tours and presentations are studying in Trinity College) and a tour of the laboratories and limited so please book in early! See above for contact details. other facilities. See www.maths.tcd.ie or www.physics.tcd.ie for more details closer to the date. In addition, the School of Computer Science and Statistics also offer small groups of students the opportunity to meet members of their teaching staff on-campus. For further information please Nursing and Midwifery open day contact the School of Computer Science and Statistics directly by e-mail: [email protected] or by telephone: +353 1 896 3665. The School of Nursing and Midwifery also organise a specific Nursing open day each year during January. This is a special The Trinity College campus is an open campus and visitors are event for students interested in studying Intellectual Disability welcome at all times. The Book of Kells is on display in the Old Nursing or Psychiatric Nursing; parents and teachers are also Library and second-level students may visit the Book of Kells very welcome to attend. There are presentations, nursing skills and library exhibition free of charge. It is advised that groups demonstrations and an opportunity to talk to our professors, book in advance – please contact +353 1 896 2320. lecturers, clinical tutors and current students about the courses. Light refreshment are provided. See www.nursing-midwifery. The Admissions Office in Trinity College is open daily, Monday- tcd.ie for more details in December. Friday from 10.00-12.45 and from 2.00-4.00. Potential applicants are more than welcome to drop in to discuss Trinity College’s application procedures. Nationwide careers fairs
Trinity College is represented at all of the major nationwide IGC careers fairs and at many other regional careers fairs each year. At these events prospective students can obtain copies of the prospectus and can find out about Trinity College’s courses, specific entry requirements and student life at Trinity College. For details of careers fairs in your area contact the Guidance Counsellor in your school, your local adult education college, or see www.qualifax.ie.
15 Transition year programmes Nursing The School of Nursing and Midwifery will run a transition year Biochemistry and Immunology programme in early 2013. Exact dates and further details for the programme will be announced on the School of Nursing and The School of Biochemistry and Immunology runs two separate Midwifery website in autumn 2012: www.nursing-midwifery.tcd.ie work-experience weeks for transition year students each year – one in November and one in February. There are 16 transition year interns in each cohort. Interns are selected from Physics different schools in order to maximise school participation and The School of Physics hosts a number of outreach events geographical spread. Each intern spends half of the week in one during the academic year. The popular Transition Year Physics of the School’s laboratories, under the supervision of one of the Experience (TYPE) is held in November and March of each lab’s researchers, participating in the research activities that are academic year. Information is sent to all secondary schools current in the lab at the time. The rest of the week involves group inviting them to submit applications for selected students. Public activities with talks, quizzes and visits to other scientifically lectures for secondary school students are also held during relevant sites on campus. Application forms available on the Science Week. The details are posted on the Science Week School website: www.tcd.ie/Biochemistry website (www.scienceweek.ie). Details on the various events can be found on the School of Physics website: Botany www.tcd.ie/Physics/outreach The Department of Botany hosts transition year students for week-long work experience in a range of activities. Students Science Gallery have the chance to experience what happens behind the scenes The Science Gallery runs two separate week long mentoring in an active research environment, working alongside technical programmes for up to 20 transition year students in each week, staff, PhD students and professional scientific researchers. In from different schools nationwide – one week in February/March addition to working at the Trinity Botanic Gardens, students and one in October/November. Each programme is developed have the chance to carry out various analytical techniques in for students to participate in workshops and experiments, the Environmental Sciences laboratory, to extract DNA in the lab visits and exhibition tours, presentations, talks, quizzes molecular laboratory, to assist with ecological sample processing and an opportunity to potentially develop project ideas for (including samples of soils, pollen, seeds, and insects) and to upcoming exhibitions. For application details and other work in the internationally important Herbarium. In addition, enquiries related to the mentoring programme please transition year students have the opportunity to attend selected e-mail [email protected] lectures and practicals with current undergraduate students. Students seeking further information should contact the Zoology Department directly via e-mail: [email protected]. More information The Department of Zoology offers a Transition Year Programme about the Department can be found at www.tcd.ie/Botany to introduce secondary school students to the exciting world of Find Out More About Trinity College About Trinity Find Out More scientific research and teaching in our department. During your Chemistry week with us you will get to meet our staff, students and post- The School of Chemistry hosts a week long programme aimed graduates in a friendly and structured week of laboratory and at transition year students. The programme involves a series of related activities. lectures, practical work and interactive tours of the facilities. This See for further details. course offers a unique opportunity for interaction with students www.tcd.ie/Zoology/TY/index.php from different schools and for hands-on exposure to advanced methodology in world-class laboratories. Dates for the 2012-13 Online Information TY programme will be announced on the School of Chemistry Courses: www.tcd.ie/courses website in autumn: www.tcd.ie/Chemistry Admissions: www.tcd.ie/Admissions/undergraduate CAO Points: www.tcd.ie/Admissions/undergraduate/ Medicine requirements/entrypoints The School of Medicine runs a one week Transition Year Accommodation: www.tcd.ie/accommodation/ Programme during the academic year. There are a limited StudentsandStaff/Students/TrinityHall number of places available and students are selected from different schools in order to maximise school participation Main TCD website: www.tcd.ie and geographical spread. In order to provide an insight for TY Virtual tour: www.tcd.ie/virtualtour students into the life of a medical student/clinical practitioner, Student life: www.tcdlife.ie they spend 1 day in teaching activities with 1st and 2nd medical Sports clubs: www.ducac.tcdlife.ie year students in TCD, 1 day in clinical skills tutorials, and the remainder of the week assigned to a clinical team in the teaching Sports facilities: www.tcd.ie/sport hospitals. Application procedures are available on the School Student societies: www.trinitysocieties.ie website: www.medicine.tcd.ie/education/THTYP www.facebook.com/trinitycollegedublin www.youtube.com/trinitycollegedublin http://itunes.tcd.ie http://twitter.com/#!/tcddublin 16 Scholarships and Awards
Since its foundation in 1592, Trinity College has sought to assist Scholarships are open to all sports and are tenable for one year, students of limited means. Although financial assistance is not however, they may be renewed (on a yearly basis) for up to four normally given to first-year students, there are exhibitions that additional years. Application forms may be downloaded from the you may be entitled to. For students in later years provision is website listed below. The closing date for applications is Friday made through the Financial Assistance Committee. You should 5th July 2013. consult your tutor when you come to Trinity College for more information. For a full list of current sports scholars and further details, eligibility and how to apply please contact the Department of Sport: Entrance Exhibitions Tel: +353 1 896 1502 Entrance Exhibitions are awarded to Junior Freshmen (first year) E-mail: [email protected] new entrants provided that sufficient merit is shown in public Website: www.tcd.ie/sport examination results. Each exhibition is in the form of a book prize worth €300 over two years. Exhibitioners and their parents/ guardians are invited to attend a ceremony during their first term. School prizes The schools in which exhibitioners received their post-primary Prizes are available to students from the following schools: the education are informed. Abbey School, Tipperary; Portora Royal School, Enniskillen; Mount Temple Comprehensive, Dublin; St. Andrew’s College, Sizarships Booterstown and Alexandra School, Dublin. A booklet setting out all the awards available in Trinity College may be obtained from Scholarships and Awards Sizars are Entrance Exhibitioners of limited means who have the Admissions Office, Trinity College, Dublin 2. Commons (evening meal) free of charge. Application to be Tel: +353 1 896 4444, E-mail: [email protected] considered for the award of a sizarship should be made to the Admissions Office on or before 1 October of the year of entry. Application details are available at www.tcd.ie/Admissions/ undergraduate/scholarships. Sizarships are normally tenable for the first two years of an undergraduate course.
Foundation scholarships
Students in the Senior Freshman (second) year may compete for a foundation scholarship. Up to seventy foundation scholars are elected annually on the basis of performance in the scholarship examination, which is usually held in the week before the start of the second term. Foundation scholars are entitled to certain privileges, which include having their course fees paid by the College (non-EU students pay EU fees), Commons (evening meal) free and an entitlement to College rooms free of charge during the academic year. Foundation scholarships are normally held for a term of five years.
Sport scholarships
Every year sports scholarships are awarded to sportsmen and sportswomen of national/international standard who come to study and compete for Trinity College. The scholarships provide the following benefits: n Financial grant. n Physiological assessment/fitness testing and follow-up training. n Workshops to include Nutrition, Psychology etc.
17 Reid entrance exhibition Choral scholarships
In 1888, the sum of £6,200 was received under the will and Eight choral scholarships valued at €1,300 are available for all testament of the late Richard Touhill Reid to found additional voices for the year 2013/14. sizarships. The awards, which do not exceed five in number, are open only to students of limited means and who are natives The choral scholars form the core and leadership of the Chapel of county Kerry (see www.tcd.ie/Admissions/undergraduate/ Choir: a mixed-voice choir of about twenty-five singers which scholarships for further details). They are granted to qualified performs in a liturgical context. The choir sings at two regular candidates on the basis of their public examination results and services during each week of lecture term and various special are tenable for two years. College and University services. However, the choir is not itself a religious organisation: applicants of any faith, denomination Students not eligible are those who: or none are welcome. Those considering applying for a choral scholarship should note that some previous choral experience (a) are above the standing of Junior Freshman (first year) is an advantage and the ability to read music is essential. OR International students find that membership of the Chapel Choir (b) are graduates of any chartered university opens up an element of University life not available to them in their home universities. OR (c) have completed their nineteenth year before 1 May of the Application is made in person at the Chapel Choir desk in Front year in which they compete. Square during Orientation Week; an appointment for an audition before the selection committee is then made. All candidates are Exhibitioners have their Commons (evening meal) free, are informed of the decision of the committee by the end of the first supplied with a laptop and receive a salary of €6,000 per annum. week of teaching term. There is no pre-application process. During the Senior Freshman (second) year, exhibitioners normally compete for Foundation scholarships. Those who fail to obtain such scholarships, but are deemed to have shown sufficient merit, may have their exhibitions extended for two further years.
Application details are available at www.tcd.ie/Admissions/ undergraduate/apply/forms. The deadline for applications is 31 May of the proposed year of entry. Scholarships and Awards Scholarships and
18 How to Apply
EU applicants 5 The Admissions Office may contact some applicants in order to seek supporting documentation regarding their status (EU/ Application for admission (except where otherwise stated) non-EU). should be made to the Central Applications Office. Applications 6 A student’s registered status (EU/non-EU) cannot be may be submitted online: www.cao.ie. Alternatively, application changed during a programme for which he/she is registered. forms may be obtained from your school or from: All other applications are considered to be non-EU The Central Applications Office (CAO), applications (see page 22 for further information). Tower House, Eglinton Street, Galway. Tel: +353 91 509 800, Fax: +353 91 562 344 EU enquiries Normal application deadline: 1 February; Late application All enquiries from EU applicants concerning undergraduate deadline: 1 May; Change of mind deadline: 1 July. Note that admission should be addressed to: applications to Medicine, to restricted entry courses, and by The Admissions Office, Trinity College, Dublin 2, Ireland. mature students must be made by 1 February, see page 204. Applications to Medicine must be submitted online. Tel: +353 1 896 4444, Fax: +353 1 872 2853 E-mail: [email protected] Am I an EU applicant? Website: www.tcd.ie/Admissions/undergraduate An EU applicant is a person: Applicants with a disability 1 who is ordinarily resident1 in the EU2 Students may require particular supports or reasonable AND accommodations due to a disability or specific learning difficulty; n who will have received full-time post primary education therefore it is important that Trinity College has notification How to Apply AND/OR of these requirements in advance of admission to College. Disclosure of a disability or specific learning difficulty will not n who has worked full-time3 in the EU adversely affect your application in any way. for three of the five years immediately preceding admission to Trinity College Disability Access Route to Education (DARE) OR The Disability Access Route to Education (DARE) is a 2 who holds a passport from an EU2 state and has received supplementary admissions scheme for school leavers with all full-time post primary education in the EU2 disabilities. DARE has been set up by a number of colleges and OR universities as clear evidence shows that disability can have 3 who has a negative impact on how well a student does at school and whether they go on to college. n official refugee status4 OR School leavers who meet the eligibility criteria compete for a quota of places allocated to applicants on a reduced points n been granted humanitarian leave to remain in the State basis in Trinity College Dublin. All applicants must meet the Irish and who has been ordinarily resident in the EU2 for three Leaving Certificate (or equivalent) matriculation/minimum entry of the five years immediately preceding admission to Trinity and, where relevant, subject specific requirements, see page 24. College
Notes: Who Should Apply to DARE? 1 For students aged under 23, the student’s parent(s) must DARE is for school leavers (under 23 years old as of 1 January also have been ordinarily resident (that is – principal 2013) who have the ability to benefit from and succeed in higher residence for the purpose of taxation) in an EU2 Member education but who may not meet the points for their preferred State for three of the five years prior to the student’s entry to course due to the impact of a disability. Mature and FETAC Trinity College. students have different admissions routes, see below and page 24. 2 EU or EEA countries (Norway, Iceland and Lichtenstein) or Switzerland. How to Apply to DARE? 3 Where an applicant can show that they have been in receipt 1. Apply to CAO by 17:15 on 1st February 2013. of social welfare payments this may be taken in lieu of full- 2. No later than 17:15 on 1st March 2013, you must disclose time employment. your disability and/or specific learning difficulty in your CAO 4 Applicants who have written confirmation that they have application and fully and correctly complete Section A of the been allowed to come to Ireland as part of the family re- Supplementary Information Form (the SIF is a part of your unification scheme may also be eligible.
19 CAO application). If you wish to be considered for the DARE Mature students scheme, you must indicate this on Section A of the fully All undergraduate courses in Trinity College are open to mature completed SIF by 17:15 on 1st March 2013. applicants. Mature student applicants are not required to satisfy the 3. Instructions will be given about the completion and return normal matriculation requirements and are not required to meet of Sections B and C of the SIF, which must arrive at CAO competitive academic entry levels (e.g. Leaving Certificate points), by 17:15 on 1st April 2013. but are considered in the first instance on the basis of how relevant their life, work and educational experiences are to the course(s) that Condition of a DARE Offer they wish to pursue. In addition, all applicants should demonstrate Students who receive a DARE offer must register with the an interest in and knowledge of their course choice(s). Disability Service and agree on a schedule of meetings with the service. In order to apply to Trinity College as a mature applicant you must:
n be an EU applicant (see page 19). More Information n be at least 23 years of age on 1 January 2013. More Information on DARE is available from your school Guidance Counsellor or the Disability Office (see below). n submit a CAO application form to the Central Applications Information can also be found on: www.accesscollege.ie, Office (CAO) by 1 February 2013. www.cao.ie; www.tcd.ie/Admissions/undergraduate/apply/ n submit a Trinity College Mature Student Supplementary eu/disability Application Form (required for all CAO courses with the exception of nursing and midwifery) by 1 February 2013. In addition, a DARE Application Clinic will be held on Wednesday 23 January 2013, from 6pm – 8pm in the Arts Late applications will not be considered from mature students. Building, Trinity College Dublin. To reserve a place please contact the Disability Service on 01 896 3111. CAO applications may be made online at www.cao.ie The Trinity College Mature Student Supplementary Application Language or mathematics waiver Form should be submitted online. See www.tcd.ie/Admissions/ Students with specific learning difficulties and hearing disabilities undergraduate/apply/eu/mature for full details and to complete may apply for a waiver of the modern language requirement. the supplementary application form.
In addition, students with dyscalculia may be eligible to request Please note that a valid CAO number is required prior to exemption from the matriculation requirement of a pass in submitting a Trinity College Mature Student Supplementary mathematics, where mathematics does not form any component Application Form. How to Apply How to of their intended course. Applicants to all courses may be required to attend an interview. See www.tcd.ie/Admissions/undergraduate/apply/eu/disability Interviews are usually held between mid-March and mid-May. for further details. Please note: Certain courses may also require applicants to meet other 1. This is a separate application to the DARE supplementary assessment criteria. For information on additional assessments admissions process and written application must be made to for specific courses please refer to the Mature Student the Admissions Office, Trinity College, Dublin 2 before 1 July Guidelines booklet available from the Admissions Office, Trinity of the year of entry. College, Dublin 2, tel: +353 1 896 4444. The Mature Student 2. Students should be aware that the criteria for waiving the Guidelines booklet is also available to download at language or mathematics requirement are different to that www.tcd.ie/maturestudents/apply required for the DARE scheme. Therefore the granting of a language waiver does not mean that a student is Trinity College will inform mature applicants of the outcome automatically eligible for the DARE scheme. of their application before the end of May to allow successful applicants the maximum time possible to prepare for the start of Allocation of places the academic year 2013. Official offers to successful applicants are made through the CAO in early July. To secure your place Where demand for places exceeds the number of places you must return a formal acceptance notice to the CAO by the available, places are awarded on merit. specified reply date.
Further information An information session on preparing for College will take place If you wish to clarify any issues or concerns you may have for all successful mature applicants in July 2013. An orientation in relation to your disability and the demands of a course, or programme for all successful mature applicants will take place on professional practice after qualification, please contact a in September 2013. member of the Disability Service staff by phone or e-mail at: For further information on studying in TCD as a mature student Phone: + 353 1 896 3111 please contact the mature student officer, phone +353 1 896 1386, E-mail: [email protected] or [email protected] e-mail: [email protected] or visit www.tcd.ie/ maturestudents Website: www.tcd.ie/disability or www.tcd.ie/pathways-to-trinity Mature Student information seminar: see page 15.
20 Access initiatives More information on HEAR is available from your school Guidance Counsellor or Trinity Access Programmes. Information The Trinity Access Programmes (TAP) co-ordinates initiatives to can also be found on: www.accesscollege.ie or www.cao.ie facilitate increased participation at third-level of students whose social, economic and educational experiences have prevented Students who accept places in TCD through HEAR are offered a them from realising their full academic potential. variety of academic and personal supports while studying at third level. Details of post-admission supports for HEAR entrants can Since 1993, TAP has developed partnerships with designated also be found on page 12, and at www.accesscollege.ie and disadvantaged primary and second-level schools in the inner-city www.tcd.ie/Trinity_Access and greater Dublin area. Through a variety of pre-entry outreach initiatives, TAP aims to promote positive attitudes to education TAP Foundation Course for Young Adults within families and the community at large, and to increase the number of students who complete their second-level education This one-year course aims to equip students with the skills they and who proceed to third-level education. TAP also organises will need to benefit from and participate in a third-level education over thirty annual activities for students, teachers and parents course. It is open to Leaving Certificate pupils from schools including summer programmes, educational achievement awards, in the greater Dublin area which are affiliated to third-level maths and science exploration programmes, student shadowing access programmes. Applicants should have taken the Leaving days, parents’ evenings and early visits to Trinity College, as well Certificate in the year of application or not more than two years as preparatory foundation courses for third-level. prior to that. Minimum entry requirements are grade OD3 or above in five subjects and grade HC3 or above in one subject. TAP offers a range of application routes to students of all ages FETAC and Leaving Certificate Applied qualifications are also and various post-entry supports including a writing resource considered. centre, peer tutors, a laptop lending service and a designated study space equipped with IT resources. Applicants for the Foundation Course for Young Adults may apply online from November 26th 2012. You may also apply Higher Education Access Route (HEAR) for the University Access Course which Trinity College runs in partnership with Liberties College on this application form. The The Higher Education Access Route (HEAR) is a third-level closing date for receipt of applications is February 7th 2013. admissions scheme for school leavers (under 23 years of
Students are not required to apply to the Central Applications How to Apply age), from socio-economically disadvantaged backgrounds. Office. Apply online, find out more or download application HEAR has been established by a number of Higher Education guidelines at www.tcd.ie/Trinity_Access/prospective/access/ Institutions based on clear evidence that socio-economic young.php Alternatively phone +353 1 896 2751. disadvantage has a negative impact on educational achievement at school and progression to higher education. TAP Foundation Course for Mature Students School leavers who provide the necessary supporting financial This one-year course prepares mature students (EU students documents relating to their socio-economic circumstances and who are over twenty three years of age on 1 January of the meet the Irish Leaving Certificate matriculation/minimum entry proposed year of entry) for entry to undergraduate studies at requirements and any course specific requirements are eligible Trinity College and other third-level institutions. There are no to compete for a quota of places allocated to applicants on a standard educational requirements but evidence of a particular reduced points basis in TCD. interest in studying at university and strong personal motivation are essential. In addition, if English is not your first language Who should apply to HEAR? you will be required to provide evidence of English language HEAR is for school leavers (under 23 years old as of 1 January proficiency, see page 26. 2013). Mature and FETAC students have different admission Applicants for the Foundation Course for Mature Students may routes, see pages 20 and 24. apply online from November 26th 2012. You may also apply How to apply to HEAR? for the University Access Courses which Trinity College runs in partnership with Pearse College and Plunket College on this Step 1 application form. The closing date for receipt of applications Apply online to CAO by 17:15 on 1 February 2013. is March 28th 2013. Students are not required to apply to the Central Applications Office. Apply online, find out more Step 2 or download application guidelines at www.tcd.ie/Trinity_ Indicate that you wish to apply to HEAR and finalise all elements Access/prospective/access/mature.php Alternatively phone of your HEAR online application by 17:15 on 1 March 2013. +353 1 896 2751.
Step 3 Submit relevant evidence in support of your application to arrive at CAO by 17:15 on 1 April 2013.
HEAR applications can only be made online at www.cao.ie
21 Receiving an offer Non-EU applicants Offers to all successful EU applicants (school leavers) are made through the CAO in August following the publication of Leaving Non-EU applicants may apply online for admission to Certificate and GCE A-Level results. The University does not undergraduate courses. See www.tcd.ie/Admissions/ make conditional offers prior to the publication of examination undergraduate/apply/non-eu for full details and to make an results; however, the level at which entry was granted in 2012 application. may give an indication of the level of achievement required All enquiries from non-EU applicants concerning undergraduate for 2013. Applicants are advised that the competitive entry admission should be addressed to: level may fluctuate (see the 2012 entry levels at www.tcd.ie/ Admissions/undergraduate) The Admissions Office, Trinity College, Dublin 2, Ireland. Tel: +353 1 896 4444, Fax: +353 1 872 2853, Offers to successful mature student applicants and to candidates E-mail: [email protected], www.tcd.ie/Admissions/ who have deferred entry from the previous year will be issued by undergraduate CAO in early July. The normal closing date for applications is 1 February 2013. Accepting an offer Late applications may be considered for courses other than Medicine and Dental science. Applicants who wish to accept an offer of a place must return a formal acceptance notice to CAO, either online or in hard copy, In order to be considered for admission all applicants are within the specified time period. If an acceptance is not returned required to satisfy the University matriculation requirements in time the offer will lapse. (see page 26) and, where relevant, meet any course specific requirements (see pages 27-30). Please note that if an applicant does not follow the instructions in full, the right is reserved to cancel the offer. Due to restrictions on the number of clinical placements available in the School of Nursing and Midwifery, non-EU Deferred entry students may only be considered for vacant places. Students who have received an offer notice may apply to defer their entry to Trinity College for one year. On receipt of a CAO Receiving an offer and accepting a place Offer Notice: Successful non-EU applicants will be notified in writing by Trinity College. Students who wish to accept an offer of a place in the 1 Do NOT accept the offer. College will be required to return an acceptance fee within a
How to Apply How to 2 Write or send an e-mail IMMEDIATELY to the Admissions specified time. Details of the due date and method of payment Officer, Trinity College, Dublin 2 setting out the reason(s) will be included in the offer letter. for the request. 3 The letter must arrive in the Admissions Office at least two Deferred entry days before the ‘Reply Date’ shown on the Offer Notice. Trinity College will notify the applicant of the decision in Non-EU students applying for deferred entry should contact the writing. If the deferral is not granted, you may then accept Admissions Officer, Trinity College, Dublin 2 in writing prior to the the offer for the current year. deadline for acceptance of their offer. 4 In order to take up the deferred place, the applicant must re- apply through the CAO by 1 February 2014 and the deferred course must appear as the first and only choice on this application. 5 After re-applying, the applicant must send their new CAO application number to The Admissions Office, Trinity College, Dublin 2, E-mail: [email protected].
Students who were permitted to defer their place will receive an offer of a place on the course in July of the following year.
A place may be deferred for one academic year only.
Transferring course and Advanced entry Students seeking to transfer from a course in another third- level institution to the second or third year in Trinity College (Advanced entry) should consult: www.tcd.ie/Admissions/ undergraduate/apply/transferred/from-third-level
22 One-year and one-term students
A limited number of places are available for EU and non-EU students who are already enrolled in another university and do not wish to undertake a four-year course in Trinity College. While students may wish to be admitted for one term only, preference is given to those who wish to attend for a full academic year, particularly in the case of EU visiting students.
Applications may be made online, see www.tcd.ie/admissions/ undergraduate/apply
Completed applications must be received by 1 March 2013.
Applying for accommodation
Applicants may only apply for accommodation in Trinity Hall after they have been offered a place on a course at Trinity College. See page 8 for further details.
Fees information
Students who accept an offer of a place via CAO will be contacted by the College Fees Office with regard to payment of all fees due.
EU Students eligible for inclusion in the Irish government’s Free How to Apply Fees Initiative will be liable for the Student Contribution (€2,250 in 2012), previously known as the Student Charge. In addition students are required to pay the Union of Students in Ireland (USI) membership levy (€8 in 2012) and the Student Sports Centre charge (€77 in 2012), but will not be liable for tuition fees if approved for the Free Fees scheme.
Students eligible for a local authority grant will be liable only for the Union of Students in Ireland (USI) membership levy (€8 in 2012) and the Student Sports Centre charge (€77 in 2012).
EU students who are not eligible for inclusion in the Free Fees scheme pay the EU portion of the fees plus the other charges referred to above.
Students who are classified as non-EU students should pay the non-EU fee.
See www.tcd.ie/admissions/undergraduate/fees for further information.
Please note: The above information was correct at the time of publication. Any changes to this information after publication will be listed on the above website.
Applicants’ appeals process
Applications are assessed on the basis of criteria listed in this publication and on the Admissions Office website. This is also the case in categorising students for the purposes of tuition fees.
Where an applicant appeals a decision the initial appeal is considered by the Admissions Officer. If the applicant wishes to appeal the matter further it is passed to the Senior Lecturer for consideration.
23 Admission Requirements 2013
To qualify for admission to a degree course at the University Leaving Certificate scoring system you must: (i) meet the matriculation requirements (see below). Grade Higher Level Ordinary Level (ii) satisfy course specific requirements (where applicable), see A1 100 60 pages 27-30. (iii) where there is competition for places, have good enough A2 90 50 examination results to be included among those to whom B1 85 45 offers are made (see the Leaving Certificate scoring system or Advanced GCE (A-level) scoring system). Minimum entry B2 80 40 points for 2012 are available at: www.tcd.ie/Admissions/ B3 75 35 undergraduate/requirements/entrypoints C1 70 30
C2 65 25 Matriculation requirements: Irish Leaving Certificate C3 60 20 D1 55 15 To be considered for admission to the University you must: D2 50 10 n Present six subjects, three of which must be at grade C or above on higher Leaving Certificate papers or at least grade D3 45 5 C in the University matriculation examination (see page 26). n Bonus points for higher level Mathematics The six subjects above must include: Students presenting Leaving Certificate Mathematics at n A pass in English. honors level will be credited with an additional 25 points for n A pass in mathematics (or foundation-level mathematics achieving a grade HD3 or above. (see note 2)) and a pass in a language other than English OR An applicant’s six best results from one sitting of the Leaving Certificate will be counted for scoring purposes. Applicants may n A pass in Latin and a pass in a subject other than a language. combine results from the Leaving Certificate and the Trinity Notes: College matriculation examination of the same year for scoring
Admission Requirements 2013 purposes. 1 A pass means grade D or above on ordinary or higher papers in the Leaving Certificate and grade D or above Leaving Certificate Vocational Programme Link Modules are in the University matriculation examination. accepted for scoring purposes only and are awarded the 2 Irish at foundation-level is not acceptable for matriculation, following points: Distinction 70, Merit 50, Pass 30. course requirements or for scoring purposes. Mathematics at foundation-level is acceptable for matriculation purposes The minimum entry levels (points) for 2012 are available at only, for all courses except nursing or midwifery courses. www.tcd.ie/Admissions/undergraduate/requirements/ entrypoints 3 Students may combine grades achieved in different sittings of their Leaving Certificate/Matriculation examinations for the purpose of satisfying matriculation and/or course Entry Route for students presenting requirements, but not for the purposes of scoring. This FETAC qualifications is not permitted for Medicine – see note 3 on page 31. There is an entry route to a number of degree programmes in 4 Combinations of Leaving Certificate subjects not permitted: Trinity College for applicants presenting appropriate FETAC n Physics/chemistry may not be presented with physics (level 5) qualifications. Applicants presenting distinctions in or chemistry. five modules can be considered for admission to Science (TR071); General Nursing (TR091 & TR093); Psychiatric n Biology and agricultural science may both be used for Nursing (TR095); Intellectual Disability Nursing (TR097) and scoring purposes but biology may not be presented with Midwifery (TR913). Further details may be found at www.tcd.ie/ agricultural science as the two higher level subjects Admissions/undergraduate/requirements/matriculation/fetac required for Dental science, Earth sciences, Medicine, Medicinal chemistry, Physiotherapy or Science. In addition, Biology and agricultural science may not be presented as two of the three HC3 (or above) grades required for matriculation purposes. n Art and music may not be offered as two of the three higher Leaving Certificate grades for matriculation purposes but both may be used for scoring purposes.
24 Matriculation requirements: Advanced GCE (A-level) scoring system GCSE/Advanced GCE (A-level) for exams taken from 2010 to 2013 AS A2 To be considered for admission to the University you must: A* – 150 n Present six subjects at grade C or above on GCSE or A 65 135^ Advanced Subsidiary GCE (AS) papers. Two of these subjects must be at grade C or above on Advanced GCE B 60 120 (A-level) papers. C 50 100 The six subjects above must include: D 35 75 E 20 40 n A pass in English. AND n Bonus points for Mathematics: n A pass in mathematics and a pass in a language other than English Students presenting A-Level Mathematics, Further Mathematics or Pure Mathematics will be credited with OR an additional 25 points for achieving a grade E or above. n A pass in Latin and a pass in a subject other than a language. An applicant’s score will be calculated on the basis of either of the following: Notes: 1 their best 4 GCE Advanced level (A2) subjects from one 1 A pass means grade C or above on GCSE or Advanced academic year Subsidiary GCE (AS) papers. OR 2 Students may combine grades achieved in different Admission Requirements 2013 sittings of their Advanced GCE (A-level) examinations 2 their best 3 GCE Advanced level (A2) subjects from one for the purpose of satisfying matriculation and/or course academic year plus one Advanced Subsidiary level (AS) in requirements, but not for the purposes of scoring. This is a different subject from the same or the preceding academic not permitted for Medicine – see note 3 on page 31. year only.
3 Acceptable subjects: Students may not combine grades achieved in different sittings n Applied A-level, Vocational Advanced Subsidiary, of their GCE Advanced level (A2) examinations for the purpose Vocational A-level, National Vocational and Key Skills of scoring. However, examinations taken in January and June qualifications are not accepted for matriculation or of the same year are counted as a single sitting. scoring purposes. The minimum entry levels (points) for 2012 are available at n GCSE/Advanced GCE (A-level) subjects set by www.tcd.ie/Admissions/undergraduate/requirements/ recognised examination boards are, in principle, entrypoints acceptable for consideration with the following exceptions. Notes: l Physical education, General studies and Media ^ Applicants presenting A-level examinations from pre- studies are not acceptable. 2010 will be scored based on the above scheme, with the n Applicants who require advice about subject eligibility exception of the pre-2010 A grade, which will be awarded should contact the Admissions Office. 145 points. 4 Combinations of A-level subjects not permitted for n Cambridge Pre-U: Principle subjects will be accepted matriculation or scoring purposes: as alternatives to A-Levels in meeting general entry n Art may not be presented with History of art. requirements. The scoring scheme for Principle subject results is available at n Biology may not be presented with Botany or Zoology. www.tcd.ie/Admissions/ undergraduate/requirements/matriculation/gcse n English literature may not be presented with English language. Allocation of places n Environmental science may not be presented with Biology or Geography. Trinity College applies a two-stage admissions procedure whereby it, in the first instance, allocates ranges of CAO n Science may not be presented with Chemistry, Physics or points to A-level grades in order that A-level applications can Biology. be compared with Leaving Certificate applications. Places on n Not more than one specialised endorsed programme in art courses will then be determined based on the proportions of may be presented. eligible applications coming from the Leaving Certificate and 5 Art and Music may not be offered as the two Advanced GCE A-level examination systems or, in a small number of cases, (A-level) grades for matriculation purposes but both may be equivalent EU systems. Once these proportions are determined, used for scoring purposes. places on the course in question will be offered to applicants coming from each respective examination system group on the basis of ranking within that group. 25 Trinity College will continue to allocate fixed points to A-level The closing date for application for the examination is 1 March. grades for the purpose of determining student’s ranking only. Application forms and a syllabus can be obtained from the These points will not be used to compare A-level students Admissions Office, Trinity College, Dublin 2, against Leaving Certificate students. Further details are available at www.tcd.ie/Admissions/undergraduate/ Tel: 01 896 4444, E-mail: [email protected] requirements/matriculation/gcse
Trinity College reserves the right to make the final decision in all Additional requirements matters pertaining to the admissions process. Garda vetting Other EU school leaving Students on courses with clinical or other professional placements may be required to undergo Garda vetting qualifications procedures prior to commencing placements. If, as a result of the outcome of the Garda vetting procedures, a student Applicants who are presenting a second-level qualification other is deemed unsuitable to attend clinical or other professional than Leaving Certificate or Advanced GCE (A-level) should placement, he/she may be required to withdraw from his/ consult the Trinity College website (www.tcd.ie/Admissions/ her course. Students who have resided outside Ireland for a undergraduate/requirements/matriculation/other) or contact consecutive period of 6 months or more will be required to the Admissions Office (see page 19) for details of the relevant provide police clearance documentation from the country in matriculation and course requirements. which they resided at the time of registration.
Garda vetting forms will be distributed (as part of the student English language requirement orientation information) to students who have been offered a place in Trinity College. The completed forms must be returned If English is not your first language you will be required to to the Admissions Office prior to registration. provide evidence of English language proficiency.
n TOEFL Fitness to practice n Paper-based 570 (with a TWE score of 4.5) Professional courses demand that certain core competencies l Computer-based 233 (with a score of 4.5 in essay) are met by students in order to graduate and practice l Internet-based 90 (with a written score of 21) professionally after qualification. College has special n Cambridge Proficiency Grade C responsibility to ensure that all students admitted to all n Cambridge Advanced Grade A professional programmes will be eligible for registration by the n IELTS (academic version) 6.5 (no individual band below 6) relevant professional body upon graduation. It is important to
Admission Requirements 2013 us that our students are able to fulfil the rigorous demands of n For Dental courses: IELTS (academic version) 7 (no individual band below 7) professional courses and are fit to practice. n Pearson Test of English (Academic) – PTE Academic: a minimum score of 63 (with no section score below 59) Precautions against infectious diseases Offers of admission to a number of Health sciences courses are Note that examination results are only valid for 2 years. made subject to certain vaccination requirements and/or certain negative test results. See page 198 for further details. Age requirement
Applicants seeking admission in 2013 must have a date of birth before 15 January 1997.
University matriculation examination
A matriculation examination, graded in equivalent terms to grades used in higher Leaving Certificate examination papers, is held in Trinity College every year, usually in April. The subjects of the matriculation examination are Biblical studies and Geology. You may take one or both of the subjects available, but you should note that the range of University matriculation examination subjects available is not sufficient for the fulfilment of all matriculation requirements.
26 Course requirements 2013: Two-Subject Moderatorship (TSM/TR001) – Level 8 (Honors Degrees)
The two-subject moderatorship (TSM) is a joint honor programme. Students select two subjects from the list below (for permitted combinations see next page) and pursue both to honors degree level. Usually both subjects are studied for three years and one subject only is studied in the fourth and final year (see page 36). An honors degree is awarded in both subjects. The minimum entry points for each TSM combination are available at: www.tcd.ie/Admissions/undergraduate/requirements/entrypoints
Note: Students are not permitted to commence two new languages. Students wishing to combine two of: Greek, Italian, Latin, Russian, Spanish within TSM are required to present at least one of the chosen languages at grade C3 or better on a higher level Leaving Certificate paper or equivalent.
Subject Name Specific Subjects Required (reference is to Available Minimum Page higher level Leaving Certificate or Advanced Places in Points GCE (A-level) grades) 2012 Range 2011**
AH Ancient history and archaeology none 23 390*-535* 77
CC Classical civilisation none 29 390*-535* 45
DR Drama studies see note 12 24 445-540 52
EI Early Irish C3 in Irish 10 465-505* 80
EC Economics see note 1 43 435*-565 59 Admission Requirements 2013
EN English literature C3 in English 85 520*-560* 62
FS Film studies none 30 445*-540 67
FR French C1 in French 84 400*-560* 68
GG Geography‡ none 45 415-565 69
GE German C1 in German 32 415-535* 70
GK Greek C3 in Greek or C3 in a language excluding English 8 445-535* 46
HS History none 40 485*-540 72
AR History of art and architecture none 40 390*-540 79
IT Italian C3 in Italian or C3 in a language excluding English 30 390*-565 85
JS Jewish and Islamic civilisations none 10 425-565 86
LT Latin C3 in Latin or C3 in a language excluding English 10 420-535* 48
MT Mathematics B3 in mathematics 25 515*-565 164
MI Modern Irish C3 in Irish 30 390*-540 80
MU Music see note 5 10 540-565 95
PH Philosophy none 43 430*-565 98
PS Psychology none 17 560*-565 104
RU Russian C3 in a language excluding English 36 405-535* 109
SC Sociology none 59 390*-565 112
SP Spanish C3 in a language excluding English 41 425*-535* 115
BT World religions and theology none 24 390*-565 107
‡ Geography may also be read as part of a moderatorship course in science – TR071. See page 140 for course specific requirements for Science. * Not all applicants at this level were offered places. ** The minimum points required depend on which two subjects are chosen. A grid displaying the minimum points required in 2012 for all combinations of subjects is available at www.tcd.ie/Admissions/undergraduate/requirements/entrypoints Note that there may be different minimum entry levels for A-level applicants for some TSM combinations. 27 Two-Subject Moderatorship (TSM/TR001): Permitted combinations and CAO course codes
TR001 must NOT be entered on the application form.
Each possible combination of two subjects has a unique three-digit code. TR followed by the three-digit code of your chosen TSM combination should be entered on the application form, e.g. TR289 for French and German.
The absence of a code in a grid position indicates that the corresponding combination of subjects is not permitted.
AH AR BT CC DR EC EI EN FR FS GE GG GK HS IT JS LT MI MT MU PH PS RU SC SP
AH – 113 102 – – – – 106 107 – – – 110 112 115 547 116 – – – – – 121 – 123
AR 113 – 143 173 485 – 486 263 293 – 353 – – 443 475 555 476 – – 478 479 – – 482 483
BT 102 143 – 133 – – 156 136 137 310 139 – 140 142 – – 146 144 – – 149 150 151 152 153
CC – 173 133 – 185 – – 166 167 – – – 170 172 175 548 176 174 – – 179 – 181 – 183
DR – 485 – 185 – – – 276 306 311 366 – 395 – 545 – 575 515 – 635 – – 725 755 785
EC – – – – – – – – – – 199 198 – 202 – – – – 207 – 209 210 211 212 213
EI – 486 156 – – – – – – – – – – 456 – 549 576 – – – – – – – –
EN 106 263 136 166 276 – – – 257 312 259 – 260 262 265 550 266 264 267 268 269 270 271 272 273
FR 107 293 137 167 306 – – 257 – 313 289 – – 292 295 551 296 294 297 298 299 300 301 302 303
FS – – 310 – 311 – – 312 313 – 314 – – – 316 319 – 315 – 320 – – 317 – 318
GE – 353 139 – 366 199 – 259 289 314 – 321 – 352 355 552 – 354 357 – 359 – 361 362 363
GG – – – – – 198 – – – – 321 – – 322 – – – – 327 – 329 330 – 332 –
GK 110 – 140 170 395 – – 260 – – – – – 382 385 553 – – – – 389 – 391 – 393
HS 112 443 142 172 – 202 456 262 292 – 352 322 382 – 445 554 446 444 – 448 449 – 451 452 453
Admission Requirements 2013 IT 115 475 – 175 545 – – 265 295 316 355 – 385 445 – – 536 505 – – 539 540 541 542 543
JS 547 555 – 548 – – 549 550 551 319 552 – 553 554 – – 557 556 – – 558 559 560 561 562
LT 116 476 146 176 575 – 576 266 296 – – – – 446 536 557 – 506 – – 569 – 571 – 573
MI – – 144 174 515 – – 264 294 315 354 – – 444 505 556 506 – – 508 509 – 511 512 513
MT – – – – – 207 – 267 297 – 357 327 – – – – – – – 598 599 600 – – –
MU – 478 – – 635 – – 268 298 320 – – – 448 – – – 508 598 – 629 630 – – –
PH – 479 149 179 – 209 – 269 299 – 359 329 389 449 539 558 569 509 599 629 – 660 661 662 –
PS – – 150 – – 210 – 270 300 – – 330 – – 540 559 – – 600 630 660 – – 692 –
RU 121 – 151 181 725 211 – 271 301 317 361 – 391 451 541 560 571 511 – – 661 – – – 723
SC – 482 152 – 755 212 – 272 302 – 362 332 – 452 542 561 – 512 – – 662 692 – – 753
SP 123 483 153 183 785 213 – 273 303 318 363 – 393 453 543 562 573 513 – – – – 723 753 –
See the previous page for a listing of the above course abbreviations.
28 Course requirements 2013: Level 8 (Honors Degrees)
Course Name Specific Subjects Required (reference Available Minimum Page Code is to higher level Leaving Certificate Places in points in or Advanced GCE (A-level) grades) 2012 2011** TR002 Music see note 5 20 420 95 TR003 History none 38 445* 72 TR004 Law none 90 505* 87 TR005 Philosophy none 20 430 98 TR006 Psychology none 31 545* 104 TR007 Clinical speech and language studies see note 4 34 520* 49 TR008 World religions and theology none 29 345 107 TR009 Music education see note 5 10 450 97 TR012 History and political science none 24 505* 75 TR015 Philosophy, political science, economics see note 1 34 525* 99 and sociology TR016 Deaf studies See note 20 20 385 52 Admission Requirements 2013 TR017 Law and business see note 1 25 555* 92 TR018 Law and French C1 in French 15 550* 90 TR019 Law and German C1 in German 15 495 90 TR020 Law and political science none 20 560 94 TR021 Classics C3 in Greek or Latin 15 405 43 TR022 Early and modern Irish C3 in Irish 15 350 80 TR023 English studies C3 in English 40 495* 62 TR024 European studies see note 8 45 530 64 TR025 Drama and theatre studies see note 12 16 455 55 TR027 Irish studies See note 21 20 375 82 TR028 Ancient and medieval history and culture none 15 415 74 TR029 Political science and geography none 20 475 102 TR030 Catholic theological studies none 15 n/a 106 TR031 Mathematics B3 in mathematics 30 485 164 TR032 Integrated engineering C3 in mathematics 165 400 125 TR033‡ Computer science C3 in mathematics 80 385 117 TR034 Management science and information C3 in mathematics 27 385 124 systems studies TR035‡ Theoretical physics B3 in mathematics and B3 in physics 40 490* 168 TR038‡ Integrated engineering with management C3 in mathematics 18 380 137 TR039 Computer science and language see note 22 15 see page 120 120 TR051 Medicine see notes 3A and 3B 123 739* 179 TR052 Dental science see note 3A 32 570* 174 TR053 Physiotherapy see notes 1 and 6 40 535 195 TR054 Occupational therapy see note 7 40 500* 191 TR055 Radiation therapy see note 14 30 515* 196 TR056 Human health and disease see note 18 35 520* 177
29 Course Name Specific Subjects Required (reference Available Minimum Page Code is to higher level Leaving Certificate Places in points in or Advanced GCE (A-level) grades) 2012 2011** TR071‡ Science see notes 1 and 2 340 470* 140 TR072 Pharmacy see notes 1 and 9 75 545 193 TR073‡ Human genetics see notes 1 and 10 15 535* 162 TR074‡ Chemistry with molecular modelling see note 11 5 430 160 TR075‡ Medicinal chemistry see notes 1 and 2 28 500 165 TR076‡ Nanoscience, physics and chemistry see note 13 15 475 167 of advanced materials TR077 Earth sciences see notes 1 and 2 14 460* 161 TR081 Business, economic and social studies see note 1 236 480 37 TR082 Computer science and business see note 19 30 420 118 TR083 Sociology and social policy none 28 435 113 TR084 Social studies (Social work) none 45 465 110 TR085 Business studies and French C1 in French and see note 1 15 510* 41 TR086 Business studies and German C1 in German and see note 1 15 450 41 TR087 Business studies and Russian C3 in a language excluding English and 7 410* 41 see note 1 TR089 Business studies and Polish C3 in a language excluding English and 5 390 41 see note 1 TR090 Business studies and Spanish C1 in Spanish and see note 1 10 475 41 TR091 General nursing See note 15 92 415* 186 TR092 General nursing (mature applicants) See note 17 14 220* 186 TR093 General nursing – Adelaide School See notes 15 and 16 29 395* 186 of Nursing Admission Requirements 2013 TR094 General nursing (mature applicants) – See notes 16 and 17 4 226 186 Adelaide School of Nursing TR095 Psychiatric nursing See note 15 20 375 186 TR096 Psychiatric nursing (mature applicants) See note 17 25 203 186 TR097 Intellectual disability nursing See note 15 17 375* 186 TR098 Intellectual disability nursing (mature See note 17 13 188 186 applicants) TR911 Children’s and general integrated nursing See note 15 15 480* 186 TR912 Children’s and general integrated See note 17 5 232 186 nursing (mature applicants) TR913 Midwifery See note 15 25 445* 183 TR914 Midwifery (mature applicants) See note 17 15 225 183
Courses are funded by the Irish Government under the National Development Plan, 2007-2013. ‡ These courses are funded by the Irish government under the National Development Plan 2007-2013 and aided by the European Social Fund (ESF) under the Human Capital Investment Operational Programme 2007-2013. * Not all applicants at this level were offered places. ** Note that there are different minimum entry levels for A-level applicants for some courses, see the minimum entry points document at www.tcd.ie/Admissions/undergraduate/requirements/entrypoints
30 Notes 6 Two higher level grade Cs from the following subjects: 1 A mathematics requirement of grade C on the ordinary or physics, chemistry, biology, physics/chemistry, mathematics, grade D on the higher Leaving Certificate paper or grade B agricultural science. Physics/chemistry may not be at GCSE level. presented with physics or chemistry. Agricultural science may not be presented with biology. 2 Two higher level grade Cs from the following subjects: physics, chemistry, biology, physics/chemistry, mathematics, 7 One higher level grade C from the following subjects: geology, geography, applied mathematics, agricultural physics, chemistry, biology, physics/chemistry, agricultural science. Physics/chemistry may not be presented with science. physics or chemistry. Agricultural science may not be 8 Students entering this programme will study two languages presented with biology. Applied mathematics may not be from French, German, Italian, Polish, Russian and Spanish. presented with mathematics. Italian, Polish, Russian and Spanish are available from 3A A higher level grade B and a higher level grade C in two of beginner level. No student may study more than one physics, chemistry, biology, physics/chemistry, agricultural language as a beginner. Students accepted into this science. Physics/chemistry may not be presented with physics programme, subject to the above regulations, will normally or chemistry. Agricultural science may not be presented with have at least a higher level grade C in the Leaving Certificate biology. If you do not have some qualification in physics, you or equivalent, in two of French, German, Italian, Polish, must present mathematics at grade C on the ordinary Leaving Russian, Spanish (C1 in the case of French and German, Certificate paper, grade D on the higher Leaving Certificate and C2 in the case of Spanish if non-beginner). Students paper or grade B at GCSE level. who have only one language (other than English or Irish) may also be admitted, subject to the above regulations, if 3B This is a restricted entry course, therefore, applications must they achieve a higher level grade B in the language in the be submitted to the CAO by 1 February of the proposed year Leaving Certificate, or equivalent. of entry. Applicants must achieve a minimum of 480 points Admission Requirements 2013 and meet the matriculation and course specific requirements 9 A higher level grade C in chemistry and a higher level in the same sitting* of the Leaving Certificate examination. In grade C in one of physics, biology, mathematics, geology, addition, all applicants will be required to sit the admissions geography, applied mathematics and agricultural science. test (HPAT – Ireland) which will take place on 2 March 2013. 10 Two higher level grade Cs from the following subjects: Applicants must register for the test at www.hpat-ireland. biology, chemistry, physics, physics/chemistry, mathematics acer.edu.au by 20 January 2013. Test results are valid for and applied mathematics. Physics/chemistry may not be two years. Further details on the selection criteria are presented with chemistry or physics. Mathematics may not available at www.tcd.ie/courses or from the Admissions be presented with applied mathematics. Office: +353 1 896 4444. Applicants should note that application for Medicine must be made online at www.cao.ie 11 A higher level grade C in mathematics and a higher level grade C in one of physics, chemistry, physics/chemistry or * A-level applicants must satisfy matriculation and course biology. specific requirements within three consecutive years, e.g. GCSE (2011), AS (2012), A-levels (2013). 12 This is a restricted entry course; therefore, applications must be submitted to the CAO by 1 February of the proposed 4 A mathematics requirement of grade D on the ordinary or year of entry. If you indicate Drama studies or Drama and higher Leaving Certificate paper or grade C at GCSE level. theatre studies as a choice of subject, you will be sent a A grade C at higher level in one of English, French, German, questionnaire to complete in March. On the basis of the Irish, Italian, Russian, Spanish and a grade C at higher completed questionnaire some applicants will be called to level in one of mathematics, applied mathematics, physics, attend a workshop and interview (during April/May) before chemistry, biology, physics/chemistry, agricultural science. final selections are made. If you are presenting Advanced GCE (A-levels), a grade C at A-level is required in one of English, French, German, 13 Two higher level grade Cs from the following subjects: Irish, Italian, Russian, Spanish and a grade B at GCSE physics, chemistry, biology, physics/chemistry, applied level in one of physics, chemistry, biology, mathematics; or mathematics, mathematics. Leaving certificate applicants a grade C at A-level in one of physics, chemistry, biology, must present mathematics at ordinary level grade A2 or mathematics and a grade B at GCSE level in one of English, at higher level grade C3, while A-level applicants must French, German, Irish, Italian, Russian, Spanish. present mathematics at Grade A at GCSE level or Grade C at A-level. Physics/chemistry may not be presented with 5 This is a restricted entry course, therefore, applications must chemistry or physics. Mathematics may not be presented be submitted to the CAO by 1 February of the proposed year with applied mathematics. of entry. You will be called for an entrance test on 23 March 2013 (provisional date). This will include a simple harmony 14 One higher level grade C from the following subjects: paper, an ear test, a paper on general musical knowledge physics, chemistry, biology, physics/chemistry. and background and an essay paper. Some applicants will be called for interview (and in the case of TR009 applicants, further tests) in late April/early May when the final selections will be made.
31 15 A grade D on the ordinary or higher paper in mathematics 17 This is a restricted entry course, therefore, applications must and in one of biology, physics, chemistry, physics/chemistry be received by the CAO by 1 February of the proposed or agricultural science. year of entry. Mature applicants to Midwifery or Nursing are NOT required to submit a mature-student supplementary Applicants who have previously been unsuccessful application form to Trinity College. If you indicate Midwifery (academic and/or placement) in any Nursing or Midwifery or Nursing as a mature student, the Nursing Career Centre programme or have any issues which would affect their will invite you to a written assessment. registration with An Bord Altranais will only be considered for re-entry to Nursing or Midwifery on a case-by-case appeal Applicants who have previously been unsuccessful basis to the relevant Programme Board. Such applicants (academic and/or placement) in any Nursing or Midwifery should make their case in writing to the Admissions programme or have any issues which would affect their Officer and include any relevant details of extenuating registration with An Bord Altranais will only be considered for circumstances. re-entry to Nursing or Midwifery on a case-by-case appeal basis to the relevant Programme Board. Such applicants 16 This is a restricted entry course, therefore; applications must should make their case in writing to the Admissions be submitted to the CAO by 1 February of the proposed year Officer and include any relevant details of extenuating of entry. The Adelaide Hospital Society, which is a voluntary circumstances. charitable organisation, nominates suitable applicants each year to the Adelaide School of Nursing. In selecting 18 A higher level grade C in biology and a higher level grade C applicants, the Society has regard to its particular obligation in one of physics, chemistry or physics/chemistry. to applicants from the Protestant community and also to members of inter-church families. Applicants will be sent an 19 A higher level grade C3 or an ordinary level grade A2 in additional application form, to be returned to the Adelaide mathematics. Hospital Society. On the basis of information provided, 20 A higher level grade C in English and grade D at ordinary or applicants may be called to interview before final selections higher level in a language other than English. are made. 21 Applicants who wish to choose Strand B (see page 82) must attain at least grade HC3 in Leaving Certificate Irish or grade C in A-level Irish. There are no course specific requirements for Strand A.
22 A higher level grade C3 in mathematics. Also, a grade C1 at higher level in French or German if selecting French or German, or a grade B3 at higher level in Irish if selecting Irish. Admission Requirements 2013
Course requirements 2013: Ordinary degree and diploma courses
Course Name Specific subjects required Available Minimum Page Code Places in points in 2012 2011
TR801 Dental nursing (diploma) See notes A and C 25 330 172
TR802 Dental hygiene (diploma) See note B and C + Restricted entry 8 420 171
TR803 Dental technology (ordinary degree) See notes A and C + Restricted entry 6 400 176
Notes B Applicants are required to present six subjects, including A Applicants are required to present six subjects, including English, mathematics and one of physics, chemistry, biology, English, mathematics and one of physics, chemistry, biology, physics/chemistry or agricultural science. physics/chemistry or agricultural science. Of the six subjects presented, two must be of a standard of Of the six subjects presented, two must be of a standard of at least grade C3 on higher Leaving Certificate papers. The at least grade C3 on ordinary Leaving Certificate papers. remaining four subjects must be presented to a standard of The remaining four subjects must be presented to a standard grade D3 on ordinary Leaving Certificate papers. of grade D3 on ordinary Leaving Certificate papers. C Applications may also be considered from mature applicants who do not satisfy the academic entry requirements but can demonstrate appropriate experience relevant to the course.
Applications for restricted entry courses must be submitted to the CAO by 1 February of the proposed year of entry.
32 READ THIS PROSPECTUS
ON A TABLET DEVICE
Use the QR code below, or go to www.tcd.ie/admissions/undergraduate and open the .pdf version of this prospectus. 34 Arts, Humanities and Social Sciences Arts coursesat Trinity College–anoverview History ofartandarchitecture(TSM) History: Ancient historyandarchaeology (TSM) History andpoliticalscience History: Ancient andmedievalhistoryculture History (TSM) History German (TSM) Geography (TSM) French (TSM) Film studies(TSM) European studies English literature(TSM) English studies Education Economics (TSM) The Lir(non-CAO) Drama: Stagemanagementandtechnicaltheatre– Drama: Acting – The Lir(non-CAO) Drama studies(TSM) Drama andtheatrestudies Deaf studies Clinical speechandlanguagestudies Classics: Latin(TSM) Classics: Greek(TSM) Classics: Classicalcivilisation(TSM) Classics Business: Computerscienceandbusiness Russian, PolishorSpanish) Business studiesandalanguage(French,German, Business, economicandsocialstudies(BESS) Arts: TSM* (Two SubjectModeratorship) Arts, HumanitiesandSocialSciences 118 79 77 75 74 72 72 70 69 68 67 64 62 62 61 59 58 57 55 55 52 49 48 46 45 43 41 37 36 35 choose two TSM subjectsandstudybothtohonorsdegree level. * TSM (Two SubjectModeratorship)isajointhonors degree, Irish: EarlyandmodernIrish Spanish (TSM) Sociology andsocialpolicy Sociology (TSM) Social studies(Socialwork) Russian (TSM) Religions: World religionsandtheology (TSM) Religions: World religionsandtheology Religions: Catholictheologicalstudies Psychology (TSM) Psychology Political scienceandgeography Political science sociology Philosophy, politicalscience,economicsand Philosophy (TSM) Philosophy Music education Music (TSM) Music Mathematics (TSM) Law andpoliticalscience Law andbusiness Law withalanguage(FrenchorGerman) Law Jewish andIslamiccivilisations(TSM) Italian (TSM) Irish studies Irish: ModernIrish(TSM) Irish: EarlyIrish(TSM) 109 107 107 106 104 104 102 101 164 115 113 112 110 99 98 98 97 95 95 94 92 90 87 86 85 82 80 80 80 Arts, Humanities and Social Sciences 35
s Arts: what comes after graduation? Three types of Arts courses: Arts Three types of Arts courses at Trinity College – an overview College Trinity at Arts courses A high proportion of vacancies for new graduates are open to high proportion of vacancies for new graduates A students of any discipline and while an arts degree may not lead directly to one profession, arts graduates can be found in everything from accountancy to voluntary organisations (see the individual course entries for further details about career The arts graduate has no shortage of choices! opportunities). Details of first destinations for graduates of all disciplines are Advisory Service website: available on the Careers www.tcd.ie/Careers/student These may be organised around a particular theme, as in History and political science, or European studies; or around the development of a particular skill, as in the moderatorship in Music education, or Law and a language. Specially designed ‘packages’ of different of different Specially designed ‘packages’ subjects TSM is a joint honors degree that allows students to choose TSM is a joint honors degree that allows students to honors degree two subjects (from a list of 25) and study both level. See the next page for further details. Joint honor two-subject moderatorship Joint honor two-subject moderatorship (TSM) programmes Single honor courses almost In a single honor course one subject is studied subjects offer exclusively for the four years; however many particularly in the third students a wide range of module choices, and fourth years. All are designed to develop high levels of analytic and All are designed to develop the ability to understand unfamiliar ideas communication skills: ideas in a new light, to work out your own and to look at familiar are skills you ideas and express them lucidly and convincingly will acquire through an arts course. Some of the arts courses offered in Trinity College have a College have Trinity in offered Some of the arts courses for example Music education, Drama strong vocational element, courses do not have a vocational Many arts studies, and Law. excellent preparation for a wide variety of focus but provide an careers. common the study of the human mind and its historical, cultural mind and its historical, study of the human common the and linguistic manifestations. While the arts subjects cover a very wide range, they have in very wide range, they subjects cover a While the arts 36 Arts, Humanities and Social Sciences tcd.ie/Admissions/undergraduate/requirements/entrypoint Minimum entrypoints code (seepage28). Each combinationoftwosubjectshasadifferent CAOcourse three yearsandonesubjectonlyisstudiedinthefourthyear. most combinationsbothsubjectsarestudiedequallyforthefirst overall workloadissimilartothatofasinglehonorsdegree.In degree level. The twosubjectsaretaughtseparatelyandthe subjects (fromalistof25,seebelow)andstudybothtohonors TSM isajointhonorsdegreethatallowsstudentstochoosetwo Two-Subject Moderatorship(TSM) Ancient historyandarchaeology Jewish andIslamiccivilisations World religions andtheology History ofart&architecture Classical civilisation foreach TSM combination:seewww. English literature Drama studies Mathematics Modern Irish Modern Film studies Psychology Geography Economics Philosophy Sociology Early Irish Spanish German Russian History French Greek Music Italian Latin ✓ ✓ ✓ ✓ ✓ ✓ ✓ ✓ ✓ ✓ ✓ ✓ ✓ ✓ ✓ ✓ Ancient history and archaeology ✓ ✓ ✓ ✓ ✓ ✓ ✓ ✓ ✓ ✓ ✓ ✓ ✓ ✓ ✓ ✓ ✓ ✓ ✓ ✓ ✓ ✓ ✓ ✓ ✓ ✓ ✓ ✓ ✓ ✓ ✓ ✓ ✓ ✓ ✓ ✓ ✓ ✓ ✓ ✓✓ ✓ Classical civilisation ✓ ✓ ✓ ✓✓ ✓ ✓ ✓ ✓ ✓ ✓ ✓✓ ✓ ✓ ✓ ✓ ✓✓✓ ✓ ✓ ✓ ✓✓ ✓ ✓ ✓✓ ✓ Drama studies Early Irish ✓ ✓ ✓ * * * * * * * Economics ✓ ✓ ✓ ✓ ✓ ✓ ✓ ✓ ✓ ✓ ✓ ✓ ✓ ✓ ✓ English literature ✓ ✓ ✓ ✓ ✓ ✓ ✓✓ ✓ ✓ ✓
Film studies s ✓✓ ✓ ✓ ✓ ✓ ✓ ✓ ✓ ✓ ✓ ✓ ✓ ✓ ✓ ✓ ✓✓✓✓ ✓ ✓ ✓✓✓ French ✓ * * * * * Geography ✓✓ ✓ ✓ ✓ ✓ * * * * indicatescombinationsinwhichstudentsmaychoosetostudy: (both subjectsarestudiedtohonorsdegreelevel). three years,andonesubjectonlyisstudiedinthefourthyear ✓ indicatescombinationsinwhichbothsubjectsarestudiedfor * inthegridbelow. Possible combinationsofsubjectsfor TSM areindicatedby
German Possible combinations ✓ ✓ ✓ ✓ ✓ ✓ ✓ ✓ ✓ ✓ ✓ ✓ ✓ ✓ ✓ ✓ ✓ ✓ ✓ ✓ ✓ ✓ ✓ ✓ ✓ ✓ ✓ n n
Greek ✓ ✓ ✓ ✓ ✓ ✓✓ ✓ ✓ ✓ ✓ ✓ ✓ ✓✓ OR History both subjectsforfouryears. fourth year, both subjectsforthreeyearsandonesubjectonlyinthe ✓ ✓ ✓ ✓ ✓ ✓ ✓ ✓ History of art & architecture ✓✓✓✓✓ ✓ ✓ ✓ ✓ ✓ ✓ ✓ ✓ ✓ ✓ Italian ✓✓✓ ✓ ✓ ✓ * Jewish and Islamic civilisations ✓✓✓ ✓ ✓✓ ✓ ✓ ✓ ✓✓ ✓✓ ✓✓✓ ✓ Latin ✓ ✓ * * * Mathematics ✓✓✓✓✓✓ ✓✓ ✓ ✓ ✓ Modern Irish ✓ ✓ ✓ ✓ ✓ ✓ ✓ Music ✓✓ ✓ ✓ ✓ ✓✓✓✓✓ ✓ ✓ ✓ ✓ ✓ ✓ ✓ ✓ ✓ * * * * Philosophy ✓ ✓ ✓ ✓ ✓ ✓ Psychology ✓ ✓ ✓ ✓ ✓ ✓ ✓ ✓ ✓ ✓ ✓ ✓ ✓ Russian ✓ ✓ ✓ ✓✓✓✓✓✓ * * Sociology ✓ ✓ ✓✓✓✓ ✓✓✓✓✓✓✓✓ ✓ ✓ ✓ Spanish ✓ ✓ ✓ ✓ ✓ ✓ ✓ ✓ ✓ ✓ ✓ ✓ ✓ ✓ ✓ ✓ * World religions and theology ✓ or Arts, Humanities and Social Sciences 37 Sociology Political science and Sociology Economics and Sociology Political science Economics and Political science Business and Political science Economics
Consultations with your personal tutor, lecturers and the Consultations with your personal tutor, informed Advisory Service help to ensure that Careers choices are made. Access to all 10 degree options open and is completely unrestricted at the end of the common first year. Through judicious choice of subjects and associated to keep it is possible modules after the common first year, open up to three of the ten BESS degree options throughout of a thus facilitating the postponement the second year, Students final choice until the beginning of the third year. therefore have an opportunity to adjust their study programmes in accordance with their academic results, interests, aptitudes and emerging career aspirations. Economics Political science Organisation and management Sociology Mathematics and statistics OR Introduction to Central, East Law OR Social policy studies OR a language* Area European and Russian Single honor degrees Business (B.B.S.) of the above Joint honor degrees (combining any two four disciplines) Business and Economics Sociology and Business Course content Course * French, German, Spanish, Russian or Polish * French, German, Spanish, groups Lectures are complemented by smaller tutorial/seminar In this year. in which you will work throughout the academic best of both worlds: way BESS students are provided with the material which is then lectures deliver authoritative summaries of analysed in detail in small groups. n n n The common first year The common six modules: Students take n n n n n n Degree options BESS leads to the following 10 After the common first year, degree options. Features of the BESS degree structure: Mathematics Mathematics
TR081 236 480 in Bachelor or B.A. Business Studies (B.B.S.)) OC3/HD3 Grade B See also: TSM, page 36 TR001: page 98 TR005: Philosophy, 75 TR012: History and political science, page economics and political science, TR015: Philosophy, page 99 sociology, TR017: Law and business, page 92 TR020: Law and political science, page 94 page 102 TR029: Political science and geography, systems TR034: Management science and information studies (MSISS), page 124 TR090: Business studies TR089, TR087, TR086, TR085, and a language, page 41 page 118 TR082: Computer science and business, page 113 TR083: Sociology and social policy, Political science: page 101 Leaving Certificate GCSE COURSE CODE: PLACES 2012: POINTS 2011 AWARDED: DEGREE social studies (BESS) studies social entry programme common Business, economic and and economic Business, degree options leading to 10 Special Entry Requirements: Is this the right course for you? Course overview The common first year of BESS introduces you to a broad range of disciplines that will help you make sense of the complex world It gives you the freedom to discover and in which we live today. develop interests that you may not be aware you have until you From the second year onwards, the flexible enter university. structure of the BESS programme allows you to pursue these specific interests in greater breadth and depth while still retaining considerable freedom over the selection of individual modules. Graduates of former years invariably tell us that it is this broad flexible approach that allowed them build the knowledge and insights that they rely on progressively as they advance to more senior positions in their careers. BESS is a uniquely flexible programme offering 10 different 10 different BESS is a uniquely flexible programme offering degree options: Business (B.B.S.) and nine other (single honor and joint honor) possibilities, in the disciplines of Business, Economics, Political science and Sociology (see Degree options, below). It provides students with a broadly-based education, a high level of flexibility in two very important ways from offering the second year onwards: (a) in choosing the specific degree you wish to read; and, (b) in choosing individual modules. 38 Arts, Humanities and Social Sciences Full moduledetails areavailablevia as electives) (available modules Complementary Sociology science Political BESS ataglance Business Economics n n n Year 2(6modules) n n n n n n n n n n n n n n n n n n n n
(see page14) Comparative politics International relations Mathematics andstatistics Economics ofpublicpolicy Economy ofIreland Broad Curriculumoptions Law Language option(1of5) Crime andIrishsociety Housing policy Health policy Social securitypolicy Logic andphilosophyofscience History ofphilosophy Introduction tosocialresearch European societies History ofpoliticalthought Intermediate economics management introduction tooperations Introduction tofinance/ financial analysis Introduction toaccounting/ principles ofmarketing Organisational behaviour/ Central problemsinphilosophy Gender, cultureandsociety www.tcd.ie/bess/downloads/Booklet.pd
n n n n n n n n n n n n n n n n n n n n n n n n n n n n n n n Year 3(6modules)
Economics ofpolicyissues Investment analysis Economics oflessdeveloped European economy Money andbanking Innovation, entrepreneurship and Business insociety Services andinformation Organisation theoryandchange Human resourcemanagement Marketing management International law Commercial law Company law Crime andsocialpolicy Race, ethnicityandidentity Researching society Globalisation anddevelopment European Unionpolitics Democracy anddevelopment Government andpoliticsofthe Irish politics Econometrics Mathematical economics Industrial economics countries Economic analysis new venturedevelopment management Applied finance accounting Financial andmanagement Comparative welfarestates Social theory United States scientists Research methodsforpolitical f n n n n n n n n n n n n n n n n n n n n n n n n n n n n n Year 4(4modules)
Economic andlegalaspectsof Monetary thoughtandpolicy International economics Quantitative methods Transport economics Economics offinancialmarkets Managing newproduct Managing non-profit Advances inmarketingtheory Financial marketsandthe Financial reportingandanalysis Exploring organisational Migration Popular cultureanddigitallives Conflict studies Economic sociologyofEurope Research seminar The politicsofinequality Comparative politicalreform African politics Contemporary international Issues incontemporarypolitics Political parties Economics dissertation Economic theory development organisations and practice corporate sector experiences global economy International businessandthe redistribution Poverty, inequalityand Sociology dissertation relations Contemporary politicaltheories competition policy Arts, Humanities and Social Sciences 39 (Financial Why choose the Trinity College of Business? School to business you need decide on a career in When you to succeed. you have the best preparation ensure that of your education to enable you This includes the quality standards. It also includes having to perform to the highest qualification that provides you with a globally recognised and a network of global contacts first class education world to you on your graduation. to open the business yourself with one of the world’s Thus, you need to align The Trinity recognised universities. best and most widely is ranked 1st in Ireland College School of Business in Europe 11th 2011), (Eduniversal Rankings, and 28th in the 2011), Business School Rankings, Times Rankings, 2011). (Eduniversal World a host of top international professors and have We the students, leading business people who engage with in the challenge them and guide them into top roles College School Trinity global business world. Past world of of Business students are now leaders in the business, government, entertainment, technology, in Ireland and innovation and non-profit businesses, both College School of Trinity So by joining the internationally. in one Business you give yourself a wonderful education yourself the of the top universities in the world; you give leading experts opportunity to hear some of the world’s of the in business; and you leave with a core knowledge projects and real world through case studies, company aboard an international dimension through our study programme. Languages and study abroad Many students in BESS have the opportunity to study abroad in Many students in BESS have the opportunity First and second year BESS students have the their third year. Russian or Polish. option to study French, German, Spanish, proficiency may Students who have the prerequisite language This apply to participate in an Erasmus exchange programme. will mean spending all or part of the third year abroad at a Russia or Italy, Austria, Belgium, France, Germany, university in Spain. English-speaking international exchange BESS also offers programmes to prestigious universities in Europe, North Asia (China, Hong Kong and Japan). Australia and in America, There are a limited number of places available on a degree programmes involving an extended period of study at the This leads to École des Haute Etudes Commerciales (HEC). the double award of the degree of B.A. (Moderatorship) or College Trinity the Bachelor in Business Studies (B.B.S.) from Dublin and a postgraduate qualification from the partner institution. Assessment Most BESS modules involve a system of continuous assessment, research-based essays, projects and presentations contributing up to 50% of the overall grade for the year. The remainder is based on results of written end-of-year examinations. Final-year dissertation/case study: or permitted to write students may be required In the final year, This allows students to a dissertation or prepare a case study. research a particular subject, issue or company in greater depth, at the same time providing an excellent opportunity to position study. postgraduate for or sector specific a in career a for oneself Throughout years 2-4, joint honor students take about half Throughout years 2-4, joint honor students they select. of their modules from each of the two disciplines among the full range Since module choices may be made from offer available in two disciplines, joint honour programmes programme design exceptionally high flexibility with regard to and module choice. Choosing modules – joint honor degrees: Choosing modules – joint honor In the third and fourth years, students take the majority of their In the third and fourth years, students take in keeping with the modules from their chosen discipline but, there is significant scope to BESS philosophy of flexibility, from the range of choose those modules which appeal most specialist subjects that is available. In the second year, students take approximately half of their In the second year, leaving them free to module load from their preferred discipline, or more of the other choose their remaining modules from one modules. three disciplines and from the set of complementary Choosing modules – single honor degrees: This portfolio of modules illustrates the range of more This portfolio of modules small A that are available in the later years. specialised modules are considered to be ‘core subjects’ number of these modules options and are designated as mandatory for particular degree for that degree. The total number of modules available to choose from each year available to choose from each year The total number of modules 3: 30 modules, Year 2: 20 modules, Year is roughly as follows: 4: 40 modules. Year Years 2-4 Years you a sense (see above) gives at a glance’ The table ‘BESS modules that are available and diversity of of the richness and fourth years, including in the second, third within BESS by other disciplines. modules offered complementary 40 Arts, Humanities and Social Sciences E-mail: [email protected] Tel: +35318961840 www.tcd.ie/BESS modern employment. within theflexiblecareerstructuresthatarehallmarkof problems –allofwhichwillprepareyouforrapidadvancement in andleadteams,conductresearchanalysecomplex career skillssuchastheabilitytocommunicateeffectively, work The BESSmultidisciplinaryapproachwillhelpyoubuildvaluable students/degree forfurtherdetails. and Voluntary organisations.See consulting, Politics,Publicservice, Teaching, Policybodies, organisations, Journalism,Law, Marketing,Management Accountancy, Banking&corporatefinance,International a diverserangeofemploymentopportunitiesinareassuchas: programmes both in Ireland and abroad. The remaining 50% enter of our graduates proceed to further study in masters and doctoral BESS is your roadmap to a wide and varying career. About 50% Further information Career opportunities
www.tcd.ie/Careers/
working inRussia?” life abroad.WhowouldhavethoughtIbelivingand me withmanyopportunitiestoexperienceprofessional international marketsandrelationspresented degree preparesyouwell.Myextensiveknowledgeof does notconfineyoutoIreland,orindeedEurope. The The worldisyouroysterbeingaBESSgraduate!It for mecareerwise. me beforeuniversity, butwaspositivelytherightchoice market). This combinationwouldneverhaveappealedto management, ManagementandtheEuropeanlabour subjects (e.g.Industrialrelations,Humanresource Sociology, intertwinedwithsimilarlyrelatedbusiness me intherightdirection.Ichosetofollowadegree ended upbeingsuchagreatdecisionforme–itset thought todobeforeuniversity. That’s mainlyhowBESS altered throughtryingothersubjectsIneverwouldhave To mysurprise,originalintentionsofpursuingbusiness political science. related subjectsaswellanintroductiontosocialand me aninvaluableinsightintoamultiplicityofbusiness accounting seemedenticing!MyfirstyearinBESSgave was alwayscuriousaboutinternationalpolitics,andeven ‘ultimate’ choice.Ifanciedmyselfstudyingbusiness,but several subjectsfromdifferent facultiesbeforemakingthe I couldmakeabetterinformeddecisionifsampled BESS afforded mewiththisoption.Iwasconfident options toosoon,andmakethedecisionatalaterstage. any particular vocation. It was then I decided not to close my dazzled me and at best, confused my intentions towards decide on a future career path! The degree options available “Leaving cert year is stressful enough without having to Susan Murray Student Profile
Arts, Humanities and Social Sciences 41 Is this the right course for you? Is this the right course for Course overview Course Students on all five strands of this programme must have well- Students on all five strands of this programme and in developing balanced interests in learning about business a high level of proficiency in a language. From start to finish, whether as beginners (on the ab initio Russian and Polish* streams) or as more advanced learners (in French, German or Spanish), you will be required to demonstrate a high level of motivation and commitment to mastering core business modules (see the table BESS at a glance, page 38) and to all aspects of language learning. Educational experts emphasise the special challenges associated with the study of two disparate disciplines teaching approaches and requiring different employing different learning styles on the part of the student, but they also stress that mastery of these challenges builds skills that are particularly sought after by employers. * Special provisions can be made for students with prior knowledge of Russian or Polish (heritage speakers, near-native speakers or those who have an entrance qualification in Russian or Polish). The programme offers an exciting way of learning about an exciting way of offers The programme in a variety theories and models business concepts, mainstream and to grips in an in-depth areas as well as getting of subject its language, with another country’s comprehensive manner its four years, culture and business environment. Over society, studying and working abroad, the the third of which is spent broadens and deepens your academic course simultaneously theories and practices and develops command of business At the same time, you will be your linguistic competence. of generic and transferable skills that developing a wide range in a variety of careers and employment are increasingly required in multi-disciplinary/multi-cultural teams, situations (e.g. working and international management, all intercultural negotiation exceptionally open in Ireland’s of which are highly relevant economy). B.B.S. (Lang.) degrees College’s Trinity The distinctiveness of of the business centres on the following: (a) there is integration programme, and language dimensions in all years of the when final year, especially during the year abroad and in the foreign language, students write a lengthy case study in the professors; (b) under joint supervision by business and language ‘language language instruction is provided by specially-trained lecturers, most of whom are native for business and economics’ business environment, speakers; (c) lectures on the economy, are provided by society and culture of the relevant country research in their experts who are continuously conducting complete a work specialist field of study; and (d) students apply and develop placement in the target culture in order to setting. their business and language skills in a professional
French (TR085) German (TR086) In a language Spanish (TR090) German (TR086) In a language Spanish (TR090) other than English TR089) (TR087 & (TR085, TR086, (TR085, TR089 & TR087, TR090) other than English TR089) (TR087 & TR086, (TR085, TR089 & TR087, TR090) Mathematics French (TR085) Mathematics TR085: French (15 places, TR085: French (15 places, 510*) points 2011: places, TR086: German (15 450) points 2011: TR087: Russian (7 places, 410*) points 2011: TR089: Polish (5 places, 390) points 2011: places, TR090: Spanish (10 475) points 2011: B.B.S. (Lang.) HC1 HC1 HC3 HC1 Grade C Grade C Grade C Grade B Grade C OC3/HD3
See also: TR017: Law and business, page 92 TR034: Management science and information systems studies (MSISS), page 124 TR081: BESS, page 37 TR082: Computer science and business, page 118
GCSE
COURSE CODES: AWARDED: DEGREE Special Entry Requirements: Leaving Certificate (French, German, Russian, Business studies and Polish or Spanish) Advanced GCE (A-Level) a language 42 Arts, Humanities and Social Sciences n n Business studies Modules inthefirstandsecondyearsinclude: should bematchedbyasimilarlevelofpersonalstudy. per weekdependingonwhichsubjectoptionsarechosen. This There areapproximately18-20hoursoflecturesandtutorials The Freshmanyears(years1&2) to managingacrosscultures. simultaneously buildinglanguageskillsandknowledgerelevant Much oftheteachingisprovidedthroughtargetlanguage, as distinctfromahistoricalorliterature-basedperspective. contemporary socio-economicandbusinessorientation, the languagecomponentsofprogrammewillhavea formal andinformal,ofbusinessmanagers. Accordingly, Teaching isspecificallygearedtotheeverydayneeds,both associated withyourchosenlanguage. you willstudythesociety, institutions,cultureandcivilisation to studyingmodulesinbusiness,economicandsocialstudies, organisations andmanagementacrosscountries.Inaddition understand thesocial,politicalandculturalcontextsofmarkets, and skillsnecessarytocommunicateinternationally This programmeaimstoprovideyouwiththeknowledge n n n Language sociology, politicsandeconomics inthesecondyear. There isalsotheoptiontoattendmodulesinareassuchas n n n n n n n
Course content n Did youknow? Overall economic and business environmentofthe region/ andbusiness Overall economic society,Contemporary institutionsandculture forbusiness(written,oral andlanguage General language Mathematics andstatistics Economics behaviour Organisational Operations management Finance Accountancy andfinancialanalysis Law Marketing and organisation Management country ofyourchosenlanguage and auralproficiency) department/s bye-mailorphone(seebelow). either theSchoolofBusinessorlanguage options withamemberoftheteachingstaff. Contact during teachingterms. You mayalsodiscussyour to samplelectures College, butwanttobesure,youaremostwelcome thiscourseat If youareconsideringstudying Trinity intheparticipatingdepartments and presentationexercisesarerequiredthroughouttheyear. examinations. Inthelanguagearea,regularwritten,oral,aural projects, essays,termtests),thecasestudyandend-of-year a rangeofcontinuousassessmentexercises(e.g.group evaluation ofthefinalyearin Trinity Collegeconsistsof assessments andexaminationsofthehostuniversity. The The evaluationoftheyearabroadisbasedonnormal practice. mandatory businessmoduleStrategicmanagement:theoryand the countryofyourchosenlanguageandwillbelinkedto This willinvolvetheanalysisofabusinessenterprisebasedin study (approx10,000words,writtenintheforeignlanguage). areas effectively, youwillresearchandwriteamajorcase study ofandpracticeinthelanguage. To integratethetwo or lessevenlybetweenbusinessmodulesandmoreadvanced In theSeniorSophister(fourth)year, studiesaredividedmore months’ duration. is gainedthrougha the businesscultureincountryofyourchosenlanguage language. Onconclusionoftheacademicyear, experienceof your yearabroadwillbethroughthemediumofchosen The vastmajorityofmodulesandexaminationstakenduring leading universitiesandbusinessschoolsthroughoutEurope. Trinity Collegehasexchangeagreements witharangeof business schoolinthecountryoflanguageyouarestudying. The JuniorSophister(third)yearisspentatauniversityor The Sophisteryears(years3&4) See page79. research ininternationalbusinessatpostgraduatelevel. researchers). Severalproceedtoundertakefurtherstudyand others occupymorespecialistpositions(e.g.asanalystsor working inmarketingorinternationalmanagementroleswhile organisations, embassiesandpublicsectorbodies.Manyare Capital MarketsandGoldmanSachs,aswellbyconsultancy international companiessuchasGoogle,Whirlpool,KPMG, AIB graduates areemployedinIrelandandabroadbyleading level ofcompetenceinthelanguageyouhavestudied.Recent international businessandmanagement,togetherwithahigh- On graduationyouwillhaveastrongacademicknowledgeof Assessment School ofBusiness? Why choosetheTrinity College Career opportunities work placementofapproximatelytwo Arts, Humanities and Social Sciences 43
Greek or Latin Greek or Latin TR021 15 405 B.A. HC3 Grade C Ancient history and archaeology, page 77 Ancient history and archaeology, Classical civilisation, page 45 Greek, page 46 Latin, page 48 (A-Level) See also: TR001/TSM subjects: Classics CODE: COURSE PLACES 2012: POINTS 2011 AWARDED: DEGREE Special Entry Requirements: Leaving Certificate Advanced GCE
Is this the right course for you? Is this the right course for Course content Course overview If you are interested in studying the languages, the poetic If you are interested in studying the languages, imagination, the depths of thought and the historical value of two civilisations that shaped the western world, you will enjoy this course. Over the four years you will read texts in a wide variety of history and philosophy, drama, genres, including epic poetry, letter writing. Whether you are continuing your language studies you will or taking up one of the languages as a beginner, engage with ancient texts both as literature and as a gateway Through the critical study of ancient into culture and thought. myth and religion, you will acquire a comprehensive and history, interdisciplinary perspective on classical culture. For all of your language-based courses the groups will be small, stimulating lively discussion, analytic skills, and the development of independent thinking. The study of Classics is concerned with the language, literature, The study of Classics is concerned with the Through the Rome. history and thought of ancient Greece and Latin and the reading of literature in the original Greek and you will develop examination of key aspects of ancient history, and a critical a thorough knowledge of the classical world you have already approach to textual and material culture. If can learn the other studied either Greek or Latin at school, you Trinity Classics has been taught in language as a beginner. Trinity years ago, and College since its foundation just over 400 Greek and Latin. College is unique in having Chairs in both
Further information Further Business studies and Spanish: E-mail: [email protected] +353 1 896 2416 / 896 1896 Tel: Susana Bayό Belenguer: Dr. E-mail: [email protected] +353 1 896 3496 / 896 1257 Tel: Business studies and Russian: Tsiskarashvili: Dmitri Dr. Business studies and Polish: Ewa Stanczyk: Dr. E-mail: [email protected] +353 1 896 1291 / 896 1896 Tel: Business studies and German: Gillian Martin: Dr. E-mail: [email protected] +353 1 896 2329 / 896 1373 Tel: e E-mail: [email protected] +353 1 896 1472 Tel: or Claire Laudet: Dr. E-mail: [email protected] +353 1 896 2313 / 896 1553 Tel: Business studies and French: Business studies and Paule Salerno-O’Shea: Dr. Business School: l www.tcd.ie/business/bs e E-mail: [email protected] +353 1 896 2707 Tel: Course Office: l www.tcd.ie/business/bs e E-mail: [email protected] +353 1 896 1840 Tel: 44 Arts, Humanities and Social Sciences n Latin fornon-beginners n n Greek fornon-beginners n n week. group seminars. There aretwelvetofourteencontacthoursper literature andhistory. Coursesaretaughtbylecturesandsmall- year youwillcontinuethestudyofGreekandLatinlanguage, languages asabeginner. InyourSeniorFreshman(second) studied bothGreekandLatinbeforeoraretakingoneofthe language-based coursesyoutakedependonwhetherhave the criticalstudyofancienthistory, cultureandliterature. The In theJuniorFreshman(first)yearyouwillbeintroducedto The Freshmanyears n Greek orLatinforbeginners n before enteringuniversity. at thesamelevelasthosewhohavestudiedGreekorLatin read originaltextsandyourcommandofthelanguagewillbe the language.Byendofyearyouwillbereadyto Elementary GreekorLatin–anintensiveintroductionto covered inthetext-basedcourses. translation skillsandtostudythelanguageofauthorsnot Latin languageyour –thiscourseallowsyoutopractice and thelettersofPliny Younger. Caelius, Virgil’s Aeneid, the love poems of Catullus and Ovid, Plautus and Terence, Cicero’s famousspeechOnBehalfof early republicantotheimperialperiod:comediesof and contextualisationofRomanpoetryprosefromthe critical readingofLatinliteraturethroughacloseexamination Latin authors covered inthetext-basedcourses. translation skillsandtostudythelanguageofauthorsnot your Greek language–thiscourseallowsyoutopractice Plato. Euripides andSophocles,thephilosophicalproseof Odyssey, theHistoriesofHerodotus,tragedies Iliadand influential worksinwesternliterature:Homer’s examination andcontextualisationoftheoldestmost the criticalreadingofGreekliteraturethroughaclose to Greek authors–text-basedcoursesintroduceyou myth andthefunctionsofwithinsociety. and materialevidence. The coursealsoexplorestheoriesof myths andreligionsoftheclassicalworldusingbothliterary Mythology and religion power, colonisation,warandconflict. of Alexander, theemergenceofRomeasamajorimperial as politicsandpower, Athenian democracy, theconquests the earlyRomanEmpire. The coursecoverstopicssuch Greek andRomanworld,fromthe Archaic ageto Greek andRomanhistory–anintroductorysurveyofthe – text-based courses introduce you tothe –text-basedcoursesintroduceyou – anintroductiontothemajor and athesisinthefinalyear. language tests,textualcommentaries,seminarpresentations) assessment (e.g.essays,unseentranslationsandother A combinationofend-of-yearexaminationandcontinuous interests you. skills, whileinvestigatingingreatdepthanareathatparticularly allow youtodevelopindependentideasandacquirecritical of yourchoice. This isanopportunitytodoresearchwhichwill Senior Sophister(fourth)yearyouwillwriteathesisonsubject your fluencyandaccuracyinreadinginterpretation.Inthe language classesprovideadditionalassistanceinimproving year youwillcontinuetostudyancienthistory, whileseparate Satire, Desireandthebody. InyourJuniorSophister(third) Latin topicsmayinclude Augustan poetry, Latinhistorians, Empire, Archaic poetry, Greekcomedy, andHellenisticpoetry. theories. GreektopicsmayincludePolybiusandtheHellenistic methodologies, suchastextualcriticism,linguisticsandliterary literary andculturalcontextthroughmorespecialisedskills history andculture. You willrefineyouranalysisoftextsintheir an in-depthstudyoftopicsinGreekandRomanliterature, In theSophister(thirdandfourth)yearsyouwillprogressto The Sophisteryears Tel: +35318961208 E-mail: [email protected] www.tcd.ie/Classics merchant banks. as theSundayIndependent,EuropeanCommissionand relations, translationandteaching,withemployerssuch graduates havealsotakenupcareersinjournalism,public academic careersbothinEuropeand America. Recent who havecontinuedontopostgraduatestudyandsuccessful Trinity CollegehasalongtraditionofClassicsgraduates Freshman (second)yearabroad. Cyprus. This allowsstudentstheoptionofspendingtheirSenior programme withuniversitiesinFrance,Switzerlandand abroad, includingactiveparticipationintheErasmusexchange Trinity Collegehasstronglinkswithmanyclassicsdepartments Assessment Further information Career opportunities Study abroad Arts, Humanities and Social Sciences 45
– an introduction to the major – an introduction to the Mythology and religion Mythology and the classical world using both literary myths and religions of of The course also explores theories and material evidence. and includes myth and the functions of myth within society, critical skills seminars designed to develop analytical and relevant to the study of literature. – an introductory survey of the survey of the Roman history – an introductory Greek and Archaic age to Greek Roman world from the Greek and topics such The course covers Empire. the early Roman conquests the Athenian democracy, and power, as politics as a major imperial emergence of Rome the Alexander, of and conflict. colonisation, war power, and architecture – an introduction Greek and Roman art major artistic achievements in to the development and art The course places and painting. architecture, sculpture social and political context; it focuses and architecture in its use of narrative and mythology in on themes such as the the development of architectural forms art, urbanisation, and and Roman baths. such as temples, theatres Assessment A combination of end-of-year examination and continuous combination of end-of-year examination and A assessment (e.g. essays, seminar presentations and short commentaries on texts), and a thesis in the final year. The Senior Sophister year If you decide to study Classical civilisation in the final year you will be able to choose two special subjects from a range on offer. recently include Ethnicity in the ancient world; Courses offered The Jews of Palestine; Attica; Athens and The city of Rome; Ancient Cyprus; Entertainment and spectacle in the Greek and Roman worlds; Goddesses of the ancient Mediterranean; Anthropology and the Greeks. This is will also write a thesis on a subject of your choice. You an opportunity to do research which will allow you to develop independent ideas and acquire critical skills while investigating in great depth an area that particularly interests you. n n n The second and third years or five course which In each of these two years you will take four Virgil, Herodotus), genres focus on specific authors (e.g. Homer, philosophy) or themes (e.g. gender and comedy, (e.g. tragedy, identity and self-image). In these courses you will sexuality, as gateways into analyse ancient texts both as literature and relevance to both the culture and thought, discuss key themes of analysis of texts in ancient and modern world, and refine your specialised skills their literary and cultural context through more by lectures and All the courses are taught and methodologies. small-group seminars. example, how the Greeks and Romans saw will learn, for You to make sense of themselves and other cultures; how they tried and religion; how they through philosophy world around them the life and ethnicity and identity, thought about politics and ideology, death.
TR001 (TSM) 29 390*-535* B.A. See page 27 Latin, page 48 Greek, page 46 Ancient history and archaeology, page 77 Ancient history and archaeology, TR021: Classics, page 43
COURSE CODE: COURSE PLACES 2012: POINTS 2011 AWARDED: DEGREE Classical civilisation Classical TSM points: cannot be studied as a single honor Classical civilisation with one other subject within course. It must be combined is TSM (TSM) programme. the two-subject moderatorship See also: TR001/TSM subjects: a joint honor programme. An honors degree is awarded in a joint honor programme. both subjects. with Classical civilisation see For subjects that combine page 36. Course content Is this the right course for you? Course overview In the Junior Freshman (first) year you will be introduced to the art, myth and religion, with a view critical study of ancient history, to acquiring a comprehensive and interdisciplinary perspective There are approximately six hours of on classical culture. classes in the Junior Freshman year. The Junior Freshman year Over four years you will develop a broad understanding of the will move You classical world, primarily through its literature. from introductory courses in the first year to the study of specific authors, genres and themes in the second and third years. In your final year you will choose from a range of specialised small-group All courses are taught by lectures and options. seminars. If you enjoy literature; if you want to acquire an understanding of the past and its influence; if you would like to engage with the poetic imagination, depth of thought and historical mythology, value of two civilisations that shaped the western world, this is the course for you. The study of Classical civilisation is concerned with the The study of Classical civilisation is concerned Through Rome. literature and culture of ancient Greece and works and the examination and contextualisation of literary history and art, you the analysis of the main aspects of ancient classical world and will develop a thorough knowledge of the All texts are culture. a critical approach to textual and material Greek or Latin is studied in translation and no knowledge of required. 46 Arts, Humanities and Social Sciences teacher trainingandinternationalpeacestudies. study haveselectedcoursesrangingfromlawandmarketingto St. LazarePlayers.Studentswhooptedtoundertakefurther as SmurfitCommunications,BlackwellPublishingandtheGare entered. Recentgraduatesareworkingfor companies asdiverse and theatrearesomeofthemanyfieldsrecentgraduateshave Business, librarianship,museumwork,publishing,teaching Freshman (second)yearabroad. Cyprus. This allowsstudentstheoptionofspendingtheirSenior programme withuniversitiesinFrance,Switzerlandand abroad, includingactiveparticipationintheErasmusexchange Trinity Collegehasstronglinkswithmany Classicsdepartments Tel: +35318961208 E-mail: [email protected] www.tcd.ie/Classics Further information Careers Study abroad many ancienttheoriesandideasaretomoderndebates.” Western culture:youlearn toappreciatejusthowrelevant is thebeautyofstudyingClassicsasfoundation to thewayweapproachworldaroundustoday. That both groundedinancientconcernsandalsostillpertinent and satisfyingtothinkhardaboutcomplexissuesthatare own ideasandopinionstoourpeers.Itwaschallenging cutting-edge researchandtheopportunitytopresentour privilege ofstudyingwithlecturerswhowereimparting in alessformalseminarformat. This afforded usboththe areaofexpertise,andaregiven centre oneachlecturer’s Classes infourthyeartheDepartmentofClassics my projectintoasatisfyinglysubstantialpieceofwork. wiles togainpowerandinfluence),workingshaping case ImperialRomanwomenwhousedtheirfeminine about exploringanareaofmyownchoosing(in I wasfullyequippedwiththenecessaryskill-settoset thought andresearch.Butbythefinalyearofmydegree, year ortwotofullycomprehendtheideaofindependent the LeavingCertificateeducationsystem,itcantakea my Collegeexperience.ForIrishstudentscomingoutof Fourth yearinClassicalcivilisationwasthehighlightof glaring discrepanciesofHollywoodblockbusterscripts. just beingthepedantinaudiencewhoscoffs atthe to begainedfromthestudyofClassicalcivilisationthan the answertoallofthesequestions.Butthereisfarmore the literarycoursesin2ndand3rdyearwouldgiveyou and HistoryinthefirstyearofClassicalcivilisation, Lightening Thief bogus? The foundationcoursesinMyth Why istheentirepremiseofPercyJacksonand sunny dayatHydaspesasdepictedbyOliverStone? Thermopylae? Was Alexander actuallyinjuredona “Were therereallyonly300Spartansatthebattleof Kate Higgs Graduate Profile analytic skills,andthedevelopment ofindependentthinking. courses thegroupswillbesmall, stimulatinglivelydiscussion, perspective onclassicalculture. Forallofyourlanguage-based religion, youwillacquireacomprehensiveandinterdisciplinary thought. Through thecritical studyofancienthistory, mythand ancient textsbothasliteratureandagatewayintoculture studies ortakingGreekasabeginner, youwillengagewith and historiography. Whetheryou arecontinuingyourlanguage genres, includingepic,tragedy, comedy, philosophy, oratory Over thefouryearsyouwillreadtextsinawidevarietyof shaped theWestern world,youwillenjoythiscourse. the depthofthoughtandhistoricalvalueacivilisationthat If youareinterestedinstudyingthelanguage,poeticimagination, culture. classical worldandacriticalapproachtotextualmaterial ancient history, youwilldevelopathoroughknowledgeofthe in theoriginalGreekandexaminationofkeyaspects and thoughtofancientGreece. Through thereadingofliterature The studyofGreekisconcernedwiththelanguage,literature Course content Is thistherightcourseforyou? Course overview honor Classicsdegree– TR021 (seepage43). Greek andLatinmaybestudiedtogetherinthesingle advanced level. Greek maybestudiedfromeitherbeginners’ oramore page 36. both subjects.ForsubjectsthatcombinewithGreeksee joint honorprogramme. An honorsdegreeisawardedin two-subject moderatorship(TSM)programme. TSM isa It mustbecombinedwithoneothersubjectwithinthe Greek (TSM)cannotbestudiedasasinglehonorcourse. Advanced GCE(A-Level) Leaving Certificate Special EntryRequirements: TSM points: DEGREE AWARDED: POINTS 2011 PLACES 2012: COURSE CODE: Greek
HC3 Grade C See page 27 B.A. 445-535* 8 TR001 (TSM) In Greekorina In Greekorina than English language other than English language other
Arts, Humanities and Social Sciences 47 Study abroad Career opportunities Further information Assessment Trinity College has strong links with many Classics departments College has strong links with many Classics departments Trinity Erasmus exchange abroad, including active participation in the and programme with universities in France, Switzerland This allows students the option of spending their Senior Cyprus. Freshman (second) year abroad. including art Recent graduates are working in many fields business, civil service, restoration, banking and accountancy, librarianship, computers, journalism and broadcasting, law, publishing, teaching and theatre. s www.tcd.ie/Classic E-mail: [email protected] +353 1 896 1208 Tel: The Sophister years The Sophister to an years you will progress (third and fourth) In the Sophister culture. literature, history and of topics in Greek in-depth study and cultural of texts in their literary refine your analysis will You skills and methodologies, more specialised context through linguistics and literary theories. such as textual criticism, and the Hellenistic Empire, may include Polybius Topics In your Hellenistic poetry. and Greek comedy, Archaic poetry, you will continue to study ancient year, Junior Sophister (third) additional while separate language classes provide history, your fluency and accuracy in reading assistance in improving the Senior Sophister (fourth) year you will and interpretation. In in Classical culture and write a thesis also study a special topic to do The thesis is an opportunity on a subject of your choice. you to develop independent ideas and research which will allow while investigating in great depth an area acquire critical skills, that particularly interests you. combination of end-of-year examination and continuous A and other assessment (e.g. essays, unseen translations presentations), language tests, textual commentaries, seminar and a thesis in the final year. – an introduction to the major – an intensive introduction to the ancient Greek language – this course allows you to practice your translation skills and to study the language of authors not covered in the text-based courses. Greek authors – text-based courses introduce you to a close the critical reading of Greek literature through and most examination and contextualisation of the oldest influential works in western literature: Homer’s Iliad and the Histories of Herodotus, the tragedies of Odyssey, Euripides and Sophocles and the philosophical prose of Plato. Elementary Greek Mythology and religion Mythology and and archaeology – an Sources and evidence in history and theories introduction to the materials, methodologies employed by historians and archaeologists. will be ready to Greek language. By the end of the year you language will be read original texts and your command of the Greek before at the same level as those who have studied entering university. – an introductory survey of the – an introductory survey Greek and Roman history Archaic age to world, from the Greek Greek and/or Roman The course covers topics such the early Roman Empire. the conquests democracy, Athenian as politics and power, of Rome as a major imperial the emergence Alexander, of colonisation, war and conflict. power, using both literary myths and religions of the classical world also explores theories of The course and material evidence. myth and the functions of myth within society. n n Greek for non-beginners Greek for beginners n n n n The Freshman years The Freshman to you will be introduced Freshman (first) year In the Junior The and literature. culture study of ancient history, the critical you have depend on whether courses you take language-based your it up as a beginner; before or are taking studied Greek history and culture depends on your choice of a topic in ancient your Senior Freshman (second) year you TSM combination. In Greek language, literature and history. continue the study of There lectures and small-group seminars. Courses are taught by hours per week. are six to eight contact 48 Arts, Humanities and Social Sciences course. civilisation thatshapedtheWestern world,youwillenjoythis language, thepoeticimagination,andhistoricalvalueofa and researchinClassics.Ifyouareinterestedstudyingthe Latin, andithasalongdistinguishedtraditioninteaching Trinity CollegeistheonlyuniversityinIrelandwithaChair world andacriticalapproachtotextualmaterialculture. history youwilldevelopathoroughknowledgeoftheclassical the originalLatinandexaminationofkeyaspectsancient thought ofancientRome. Through thereadingofliteraturein The studyofLatinisconcernedwiththelanguage,literatureand development ofindependentthinking. be small,stimulatinglivelydiscussion, analyticskills,andthe culture. Forallofyourlanguage-based coursesthegroupswill a comprehensiveandinterdisciplinary perspectiveonclassical critical studyofancienthistory, mythandreligionyouwillacquire literature andasagatewayintoculturethought. Through the Latin asabeginner, youwillengagewithancienttextsbothas Whether youarecontinuingyourlanguagestudiesortaking genres, includingepic,comedy, lovepoetry andhistoriography. Over thefouryearsyouwillreadtextsinawidevarietyof Course content Is thistherightcourseforyou? Course overview honor degreeClassics– TR021 (seepage43). Latin andGreekmaybestudiedtogetherinthesingle advanced level. Latin maybestudiedfromeitherbeginners’ oramore For subjectsthatcombinewithLatinseepage36. subjects. honor programme. An honorsdegreeisawardedinboth subject moderatorship(TSM)programme. TSM isajoint It mustbecombinedwithoneothersubjectwithinthetwo- Latin (TSM)cannotbestudiedasasinglehonorcourse. Advanced GCE(A-Level) Leaving Certificate Special EntryRequirements: TSM points: DEGREE AWARDED: POINTS 2011 PLACES 2012: COURSE CODE: Latin
Grade C HC3 See page27 B.A. 420-535* 10 TR001 (TSM) In Latinorina In Latinorina than English language other than English language other Latin forbeginners n n n are sixtoeightcontacthoursperweek. Courses aretaughtbylecturesandsmall-groupseminars. There you continuethestudyofLatinlanguage,literatureandhistory. TSM combination.InyourSeniorFreshman(second)year, choice ofatopicinancienthistoryandculturedependsonyour have studiedLatinbeforeoraretakingitupasabeginner;your language-based coursesyoutakedependonwhether the criticalstudyofancienthistory, cultureandliterature. The In theJuniorFreshman(first)yearyouwillbeintroducedto The Freshmanyears area thatparticularly interestsyou. and acquirecritical skillswhileinvestigatingin great depthan do researchwhichwillallowyou todevelopindependentideas thesis onasubjectofyourchoice. The thesisisanopportunityto you willalsostudyaspecialtopic inClassicalcultureandwritea reading andinterpretation.Inthe SeniorSophister(fourth)year additional assistanceinimproving yourfluencyandaccuracyin study ancienthistory, while separatelanguageclassesprovide body. InyourJuniorSophister (third)yearyouwillcontinueto include Augustan poetry, Latinhistorians, Satire,Desireandthe as textualcriticism,linguisticsandliterarytheories. Topics may context throughmorespecialisedskillsandmethodologies,such You willrefineyouranalysisoftextsintheirliteraryandcultural in-depth studyoftopicsinRomanliterature,historyandculture. In theSophister(thirdandfourth)yearsyouwillprogresstoan The Sophisteryears n n Latin fornon-beginners n employed byhistoriansandarchaeologists. introduction tothematerials,methodologiesandtheories Sources andevidenceinhistory andarchaeology–an of mythandthefunctionswithinsociety. and materialevidence. The coursealsoexplorestheories myths andreligionsoftheclassicalworldusingbothliterary Mythology and religion power, colonisation,warandconflict. of Alexander, theemergenceofRomeasamajorimperial as politicsandpower, Athenian democracy, theconquests the earlyRomanEmpire. The coursecoverstopicssuch Greek and/orRomanworld,fromthe Archaic ageto Greek andRomanhistory–anintroductorysurveyofthe covered inthetext-basedcourses. translation skillsandtostudythelanguageofauthorsnot Latin language your –thiscourseallowsyoutopractice Catullus andOvid,thelettersofPliny Younger. On BehalfofCaelius,Virgil’s Aeneid, thelovepoemsof comedies ofPlautusand Terence, Cicero’s famousspeech early republicantotheimperialperiod. Texts includethe and contextualisationofRomanpoetryprosefromthe critical readingofLatinliteraturethroughacloseexamination Latin authors entering university. at thesamelevelasthosewhohavestudiedLatinbefore original textsandyourcommandofthelanguagewillbe language. Bytheendofyearyouwillbereadytoread introductiontotheLatin Elementary Latin–anintensive – text-based courses introduce you tothe –text-basedcoursesintroduceyou –anintroductiontothemajor
Arts, Humanities and Social Sciences 49 In one of English, In one of In one of physics, In one of English, chemistry, biology, biology, chemistry, mathematics French, German, Irish, Italian, Russian or Spanish French, German, Irish, Italian, Russian or Spanish biology chemistry, or mathematics French, German, Irish, Italian, Russian or Spanish mathematics, applied mathematics, physics, biology, chemistry, physics/chemistry or agricultural science Mathematics In one of English, In one of physics, Mathematics TR007 34 520* B.Sc. (Clin. Lang.) HC3 HC3 Grade B Grade B Grade C Grade C Grade C OD3/HD3
In addition: Either GCSE Clinical speech and and speech Clinical studies language CODE: COURSE PLACES 2012: POINTS 2011 AWARDED: DEGREE Special Entry Requirements: Leaving Certificate In addition: GCSE Advanced GCE (A-Level) Or GCSE Advanced GCE (A-Level) See Precautions against infectious diseases, page 198. Garda Vetting: Students will be required to undergo Garda vetting. See page 26 for further details.
Further information Career opportunities Study abroad Assessment s www.tcd.ie/Classic E-mail: [email protected] +353 1 896 1208 Tel: Recent graduates are working in many fields including art Recent graduates are working in many fields business, civil service, restoration, banking and accountancy, librarianship, law, computers, journalism and broadcasting, publishing, teaching and theatre. Trinity College has strong links with many Classics departments College has strong links with Trinity participation in the Erasmus exchange abroad, including active in France, Switzerland and programme with universities their Senior This allows students the option of spending Cyprus. abroad. Freshman (second) year is used, and a thesis is written in the final year. is used, and a thesis A combination of end-of-year examination and continuous and continuous of end-of-year examination combination A translations and other (e.g. essays, unseen assessment seminar presentations) textual commentaries, language tests, 50 Arts, Humanities and Social Sciences oriented, adaptableandenjoycollaborativeproblem-solving. and languageisimportant,itcriticalthatyouarepeople- working withparentsand/orfamilies.Whileaninterestinscience hospitals. Inalmostallinstances,youwillalsofindyourself including schools,communityclinics,specialistclinicsand all agesandwillhavetheoptiontoworkinarangeofsettings, language therapist,youwillcomeintocontactwithpeopleof you interestedinhowpeoplecommunicate? As aspeechand approach tolearning? Are youflexibleandadaptable? Are Do youenjoyworkingwithpeople?haveaquestioning instances theymaybesituatedwithinspecialistclinics. care clinics,inschoolsand/ordaycentresorsome hospitals, communitysettingssuchasprimaryandcontinuing others. Therapists workinavarietyofsettings,including doctor, occupationaltherapist,nurseandsocialworkeramong multidisciplinary teamthatmayincludeateacher, psychologist, people withmentalhealthdisorders. They oftenworkaspartofa people withwrittenlanguageproblems(e.g.dyslexia)and autism), peoplewhostutterorhaveproblemswiththeirvoice, cerebral palsy),learningdifficulties(e.g.intellectualimpairment, (e.g. followingstroke),peoplewithphysicalimpairments who haveacquiredcommunicationand/orswallowingproblems development ofspeechsounds. They alsoworkwithpeople who aredelayedintheirearlylanguagedevelopmentand/or Speech andlanguagetherapistscommonlyworkwithchildren at birth,othersareduetoaccidentsorillnesslaterinlife. life andtheyhappenforavarietyofreasons.Somearepresent Communication difficultiescanoccuratanystageinaperson’s swallowing difficulties. skills. They alsoassess,diagnoseandtreatpeoplewith ways tomaximisetheirspeech,languageandcommunication people whohavecommunicationdifficulties,helpingthemtofind language therapy. Speechandlanguagetherapistsworkwith studies isafour-yearprofessionalhonorscourseinspeechand The undergraduateprogrammeinClinicalspeechandlanguage Is thistherightcourseforyou? language studies? What isClinicalspeechand Theory andClinicalpractice. The componentcoursesaregroupedundertwoheadings: in theJuniorFreshman(first)year, includingclinicalvisits. There areapproximatelytwenty-fourteachinghoursperweek developing yourknowledgebase. experience inresearchtechniques,sothatyoucancontinue are majorcomponentsofthecourse. You willalsogain difficulties. Linguistics,psychologyandbiomedicalsciences to assistthosewhohavecommunicationandswallowing as wellswallowingdisorders,sothatyouareplaced understanding ofcommunicationdevelopmentanddisorders Over thefouryears,youwillbeexpectedtodevelopanin-depth by theIrish Association ofSpeechandLanguage Therapists. This isafour-yeardegreewhichrecognisedandaccredited projects. an on-siteclinicwhereyoumaybeinvolvedinclinicalresearch ensure thatstudentsgetabroadrangeofexperience,aswell the start.We haveaccesstoawiderangeofclinicalsettings, Clinical placementsareanimportantlearningcontextrightfrom that mirrortheproblemspeopleencounterinaclinicalsituation. stages inthecourse,youwillbeinvolvedsolvingproblems This courseisforstudentswhoenjoylearningbydoing. At all feedback guidesstudentsatevery stage. through group oral presentations and/or written assignments. Tutor important skillsinteamwork.Many oftheproblemsareassessed set. They share their information with each other and develop in groups (under supervision) to research how to ‘solve’ the problem structured problems for specified learning objectives. Students work Problem-based or problem-centred learning provides students with PBL countries. be possible,byspecialarrangement,toattendclinicsinother While youwillgenerallyattendclinicsaroundIreland,itmay also organisedwithintermtimeintheSeniorSophisteryear. Senior Sophister(fourth)year. A six-toeight-weekblockis Junior Sophister(third)yearandaone-weekblockinthe Senior Freshman(second)year, afour-weekblockinthe clinical practiceoutsidetermtime:athree-weekblockinthe for studentclinicalwork. You willalsoberequiredtoundertake During termtimeanaverageofonedayperweekisreserved Clinical practice problems setintheproblem-basedlearningapproach. learning, aswellgroupworkinsmallteamstoaddress Teaching methodsincludelectures,tutorialsandcase-based and audiology. through humandissectionandlectures),physiology, neurology linguistics, psychology, discourseanalysis,anatomy(studied Major subjectareasincludespeechandlanguagepathology, Theoretical component Course overview
Arts, Humanities and Social Sciences 51 g. Graduates of the course who wish www.hpc-uk.or Further information Career opportunities Assessment degree and College The Trinity practice professional For more detailed information on your career prospects, visit the e and websites at www.iaslt.i professional associations’ g www.rcslt.or e www.tcd.ie/slscs/clinical-speech-languag +353 1 896 1496 Tel: Your theoretical knowledge is assessed by a combination of is assessed by a combination theoretical knowledge Your end-of-year examinations. assessment and written continuous College Trinity place both in examinations take Practical clinical you have been attending on placement. and in the clinics that examined on a continuous assessment Clinical placements are are There who work with you. basis by practice educators procedures where students are observed additional assessment their clinical work for examination to in practice, and present College mentors. College Dublin is Trinity On graduation, your qualification from and Language recognised as a licence to practise as a Speech the degree are eligible to Those holding Therapist in Ireland. of Speech and Association apply for membership of the Irish e. Graduates who www.iaslt.i Therapists (IASLT) Language Health Professionals wish to work in the UK should contact the Council, to apply for to work in another European country will have If you are considering government approval in that country. as a Speech- applying for professional recognition to work you should contact Language Pathologist in the US or Canada, Association at: www. American Speech-Language-Hearing the Association of Speech-Language asha.org or the Canadian h Audiologists at www.caslpa.ca/englis Pathologists and Psychology Clinical and experimental phonetics Linguistics Physiology – the study of the functions of living organisms Disorders of speech, language and communication and frameworks and swallowing – you will learn about possible areas, as well as tools for assessing skills in each of these difficulties can how to ensure individuals with communication participate in society Linguistics – introduction to language,Linguistics – introduction the individual and database society; Syntax; the CHILDES of vocal sounds Phonetics – the study Psychology General and neuro-anatomy (studied through lectures and human dissection) Clinical practice Pre-clinical skills Speech and hearing In the Senior Freshman (second) year, theoretical courses move theoretical In the Senior Freshman (second) year, to more specific areas and you will study: The clinical component takes on greater significance in the final two years of the course. By the end of the Senior Sophister (fourth) year you will be expected to participate fully in assessment and diagnosis, as well as in therapy planning and implementation. Such work is supervised, with students learning self-evaluation and reflective skills during the process. The Sophister years theoretical In the Sophister (third and fourth) years the on therapy component of the course focuses more specifically to also continue You approaches and clinical management. and linguistics (i.e. psychiatry study aspects of psychology, discourse analysis). n n n n n n n n n n n n In the Junior Freshman (first) year you will be introduced to the you will be introduced Freshman (first) year In the Junior courses will be These speech. acquisition and area of language in and include modules study, for later years of the foundation The Freshman years – theoretical – theoretical years The Freshman component: 52 Arts, Humanities and Social Sciences for developingvaluableresearchskillsaspartofthiscourse. public informationservicedelivery. There arealsooptions hearing people,openingupopportunitiesinsubtitlingand in developingaccessiblemultimediaforDeafandhard-of- Ireland. Those specialising inDeafstudieswilldevelopskills of professionalISL/EnglishinterpretersandISL teachersin a secondlanguage. There iscurrently asignificantshortage their familiesathome,andwithadultswhoarelearningISL as learning inarangeofcontexts,workingwithDeafchildrenand employment relatedsettings.ISL teachersdeliverlanguage including legal,medical,educational,socialservices,and communication inarangeofcommunityandconferencesettings or asgeneralistsinDeafstudies.ISL interpretersfacilitate Sign Languageinterpreters,Irishteachers Sign Language(ISL)andmaychoosetospecialiseasIrish historical perspectives.GraduateswilldevelopfluencyinIrish of theDeafcommunityfromsocial,educational,policyand Deaf studiesisadisciplinethatencompassesanunderstanding What isDeafstudies? may beeligibleforinclusioninthescheme. this course.EUstudentsregisteredforDeafstudies The Government’s FreeFeesInitiative DOEScover See page26forfurtherdetails. Students willberequiredtoundergoGardavetting. GARDA VETTING: studies iftheyholdaII.2orabove. may applyforentrytoyear3oftheBachelorinDeaf Sign Language(ISL)teachingandISL/Englishinterpreting Graduates oftheCentre’s DiplomasinDeafstudies,Irish Entry to Year 3ofBachelorinDeafstudies: GCSE Advanced GCE(A-Level) Leaving Certificate Entry Requirements: DEGREE AWARDED: POINTS 2011 PLACES 2012: COURSE CODE: Deaf studies
Grade C HC3 Grade C OD3/HD3 (B.St.Su.) (B.St.Su.) Bachelor inDeafStudies 385 20 TR016 English literature English other thanEnglish language (A or B) (A orB)English other thanEnglish In alanguage In alanguage
of ISL/EnglishinterpretingorISL teaching. culture, andforthosefollowingspecificpaths,theprofession competencies relatedtotheDeafcommunity, itshistoryand equip studentswithabroadspectrumofknowledge,skillsand involves anintegratedprogrammeofstudywhichisdesignedto those wishingtoworkinorwiththeDeafcommunity. The degree comprehensive introductiontotheDeafcommunityandISL for No priorknowledgeofISL isrequired. The courseprovidesa Deaf studiesisafour-yearfull-timehonorsdegreecourse. and societybeopentousingtechnologyinyourlearning. You shouldhaveaninterestinlearningaboutlanguage,culture to becapableofworkingindependentlyandaspartateam. that youareadaptableandpeople-oriented. You willalsoneed of Deafandhard-of-hearingpeople.Itisimportant,therefore, many instances,youwillalsofindyourselfdealingwithfamilies communities andbridgingcommunicationculturalgaps.In settings. You willbeworkingbetweenDeafandhearing clinics, hospitals,legalcontextsandawiderangeofcommunity of settings,whichmayincludeeducationalcommunity with peopleofallagesandwillberequiredtoworkinarange Working intheareaofDeafstudiesyouwillcomeintocontact Language, Theory andPractice. The componentcoursesaregrouped underthreeheadings: are approximately17hoursofdirectteaching. the EuropeanUnion.InJuniorFreshman(first)year, there the DeafcommunityinIrelandor(throughErasmuslinks)across include practiceplacementswithorganisationsworkingwith/for culminates inadissertation.Forallstudentsyearsthreeandfour of-hearing peopleorcarryingoutaresearchproject,which the developmentofaccessiblemultimediaforDeafandhard- taking theDeafstudiesroute,thereareoptionsrelatingto a curriculumandassessingstudentperformance.Forthose introduced alongwithguidanceonplanningandimplementing ISL teachingroute,aspectsofthepsychologyeducationare are emphasisedinyearsthreeandfour. Forstudentstakingthe and thepracticalskillsofinterpreting,guidedbyethicalpractice two. ForISL/Englishinterpretingstudents,translationtheory language forDeafchildrenarealsoexploredinyearsoneand sociolinguistic contextandthepathtoacquisitionofasigned are explored.UnderstandingofthestructureISL, signed languagesandaccesstocriticalpublichealthservices of Deafpeopleinthemedia,legalandpoliticalstanding and two,themessuchasDeafeducation,therepresentation society. ISL isstudiedacrosstheprogramme,whileinyearsone of Deafpeopleinternationally, historicallyandincontemporary of understanding theIrishDeafcommunityandof the experience This four-yearfull-timedegreecoursegivesyouanin-depth Course overview Is thistherightcourseforyou? Course content
Arts, Humanities and Social Sciences 53
– introduces theories – including issues – focusing on experiences of late acquisition of languages – spoken and/or signed – of late acquisition of languages – spoken for deaf children. of mental health and mental illness in the Deaf community and practice and interpreting: philosophy Translation or (for those aiming to pursue the interpreting strand) Perspectives on deafness Perspectives on society of being a deaf/deafened person and how to deaf (contemporary and historically) has responded This course has a strong international dimension people. culture, Deafhood and and looks at the issues of community, what it means to be deaf in Europe today. and deafness Language acquisition and considers the of first and second language acquisition deaf children varied pathways to language acquisition that and the impact take: includes discussion of “home signing” Apsects of written language Interactive discourse analysis Deaf education the Deaf community with Working Ethics 1 Sociolinguistics – introduces the ways in which theSociolinguistics social reference to context impacts on language use, including of generation regional variation and the impact gender, Also use. educational policy and the media on language language looks at issues of language recognition and planning. Introduction to sign linguistics – introduces aspects of to sign linguistics Introduction phonology, the grammar of signed languages including semantics, and pragmatics. syntax, phonetics, morphology, Students can step out of the programme on successful completion of year 2 with a Diploma in Deaf studies or may continue on to degree level. n n n n n n n The Freshman years – language – language years The Freshman component: is fluency the Deaf community of working with The cornerstone level. at ab initio (beginner) is introduced in ISL. ISL Freshman (first two) years are ISL1, Courses taken in the Six to nine hours of contact time per ISL2, ISL3 and ISL4. setting facilitates rapid lecturers in an immersion week with ISL skill. development of ISL years – theoretical The Freshman component: you will be introduced to the area of Deaf In the Freshman years for These courses will be the foundation studies and linguistics. These are: later years of study. n n Teaching ISL as L1 as ISL Teaching as L2 ISL Teaching for the national curriculum ISL Teaching Translation and Philosophy and practice interpreting: Translation Methods of assessment Curriculum planning methods Teaching Theories of education Research methods Aspects of written language Deaf education with the Deaf community Working Deaf people and the media Ethics An introduction to sign linguistics Sociolinguistics Perspectives on deafness Interactional discourse analysis Language acquisition and deafness Students can also select one course from the Broad Curriculum in both years one and two (see page 14). Practice component Practical components are introduced in the Sophister (third and fourth) years and will include placements with organisations. These will include a six-week block placement in the Junior Sophister (third) year and an eight week block in the Senior attend placement While you will usually Sophister (fourth) year. in an Irish organisation, it is possible, by special arrangement, to arrange a placement abroad. In previous years, students have undertaken placements with a wide range of Irish organisations Kerry Deaf Resource DeafHear, including the Irish Deaf Society, Association Centre, Deaf Community Centre (Limerick), Cork for the Deaf, Sign Language Interpreting Service (SLIS), Bridge Interpreting, and the National Chaplaincy for Deaf People. n n n n n n n n n n n n n n n n n n n Theoretical component introduce you to aspects of language Theoretical courses will social and sociolinguistics, social policy, acquisition, linguistics, course involves two to four hours studies. Each theoretical plus an expectation of self study. of lecture time per week Theoretical courses include: Language component Language to you will be introduced four years of the degree, Across the high degree. be developed to a and language skills will ISL to the Common European teaching is mapped Our language Europe), so (Council of of Reference for Languages Framework of your progress against your knowledge you will be able to map hours of have six to nine hours of ISL other languages. Students class contact per week. 54 Arts, Humanities and Social Sciences n n n n n n n (ii) n n n n (i) practice ineachofthethreestrands,asoutlinedbelow: components inyears3and4arecloselyalignedtoprofessional theoretical courses(suchasEthics2),butgenerally, theoretical In theSophisteryears,youwillundertakesomecommon The Sophisteryears–Theoreticalcomponent the language. make formalpresentationsinISL andinteractwithconfidencein will beabletounderstandanacademiclecturedeliveredinISL, ISL6, ISL7 andISL8, bringing youto a levelof fluency whereyou In years3and4,youwillcompletefourmoreISL courses:ISL5, The Sophisteryears–Languagecomponent Freshman (second)year. ISL route,youwillneedtohaveachieved a II.2intheSenior specific areaofinterest.Inordertooptfortheinterpretingor based coursestosupportprofessionalskilldevelopmentinyour Sophister years,youwilltakespecifictheoreticalandpractice- While theISL componentsaresharedacross allcourses,inthe Interpreting, (ii)ISL teachingor(iii)Deafstudies. In years3and4,youwillopttofollowoneofthreestrands:(i) The Sophisteryears professional practice. professionals inthefieldwhocan offer guidanceonyourpathto Deaf communityinauthenticsettings,andengagementwith interpreters orISL teachers,activeengagementwiththe core competenciesthathavebeenidentifiedforprofessional The objectivesofplacementsincludethedevelopment or abroadtosupportyourprofessionalskilldevelopment. In years3and4,youwillundertakeplacementsinIreland The Sophisteryears–Practicalcomponent n n n (iii) ISL teaching Interpreting Deaf studies Research project Research methods themedia Deaf peopleand Teaching ISL asL2(asecondlanguage) Teaching ISL asL1(afirstlanguage) Teaching ISL forthenationalcurriculum Methods ofassessment Theories ofeducation Teaching methods Curriculum planning interpreting2 Simultaneous interpreting1 Simultaneous Liaison interpreting Consecutive interpreting Service andotherpublicservicebodies. law, etc.GraduateshavealsogoneontoworkintheCivil communications, anthropology, multiculturalism,genderstudies, for continuingtofurtherstudyinareassuchaslinguistics, ISL teacher, orasanISL interpreter. There isalsoscope as teaching,childcare,socialwork,media,etc.,workan a resourceofficer)orcombinedwithanotherskillset,such Graduates frequentlyworkinDeaforganisations(e.g.as allowed furtherplacementexperience. placement performanceisconsideredunsatisfactorymaybe practice placement,andfinalexaminations. A studentwhose Award ofthedegreeisbasedoncontinuousassessment,a College Dublin. Communication Sciences,4thFloor, Arts Building, Trinity Centre forDeafStudies,School ofLinguistic,Speechand E-mail: [email protected] Tel: +3538301252 www.tcd.ie/slscs/cds Career opportunities Assessment Further information n Did youknow? Deaf Studieswasestablishedin2001. collaboration withBristolUniversity). The Centre for and ISL teacherswasestablishedherein1992(in first professionaltrainingforISL/Englishinterpreters of Irelandoffering aDeafstudiesprogramme. The Trinity Collegeistheonlyuniversityonisland and hasbeenformallyrecognisedinNorthernIreland. languages recognisedbytheEuropeanInstitutions Centre forDeafStudies.ISL isoneofthemanysigned language ofIrelandandistheworkingat Irish SignLanguageisthesecondindigenous
e Arts, Humanities and Social Sciences 55 Is this the right course for you? the right course Is this Course overview These courses provide students with a broad foundation in all with a broad foundation provide students These courses allow students to They theatre and performance. aspects of are areas of theatre and in one or more practical specialise students for careers and further training in designed to prepare nature of The strong developmental theatre and related fields. means that, in addition to a high level Drama and theatre studies you will need to possess resourcefulness, of analytical ability, time-management skills. By its nature, self-motivation and good calls for full-time commitment to rehearsal practical theatre work will also need to You times of the year. and production at certain as a member of a team to succeed on have the ability to work this course. the relationship Both these courses aim to enable you to explore to discover between the theory and the practice of theatre, do this by uniting elements They how and why theatre works. cultural, historical and sociological studies with a of literary, arts. practical understanding of the various performing The Freshman years second) years The Junior and Senior Freshman (first and historian, analyst will provide you with the skills of the theatre provides an During these years, the course and practitioner. is Teaching introduction to drama, theatre and performance. and is arranged in by lecture, seminar and practical workshop over each of the two a series of three-week intensive modules periods, genres semesters. Courses cover defined historical Shakespeare, and movements, such as ancient Greek theatre, theatre and Melodrama, Gender and performance, Postmodern in addition to all Asian theatre. Single honor students, Classical areas of theatre of the courses above take courses in practical theatre making and (Introduction to performing, Introduction to courses run through both of These practical theatre). Technical the Freshman years. In the Junior Freshman (first) year these courses are supplemented for all students by classes in study and writing Senior Freshmen (second-year skills and multimedia technology. TSM) supplement their practical students, both single honor and experience of theatre in a full year-end ensemble production in Theatre. the Samuel Beckett
445-540 TR001 (TSM) 24 455 B.A. See page 27 TR025 16 See also: Acting, page 57 page 58 Stage management and technical theatre, be submitted by 1 February 2013. be submitted by 1 February be submitted by 1 February of Applications MUST a Applicants will receive entry. the proposed year of to be completed and returned. On questionnaire in March some applicants the basis of the completed questionnaire, (during will be called to attend a workshop and interview made. April and May), before final selections are honor TR025 – Drama and theatre studies is a single is read almost course where Drama and theatre studies exclusively for four years. studied as a TR001 – Drama studies (TSM) cannot be with one other single honor course. It must be combined (TSM) subject within the two-subject moderatorship An honors TSM is a joint honor programme. programme. degree is awarded in both subjects. For subjects that combine with Drama studies see page 36 This is a restricted entry course. Applications must This is a restricted & Drama studies & Drama CODES: COURSE PLACES 2012: POINTS 2011: AWARDED: DEGREE TSM points: Drama and theatre studies Drama studies (TSM joint honors) – TR001 Drama and theatre studies (single honor) – TR025 The TSM course explores theatre and drama mainly from a The theoretical and historical perspective. It combines library-based courses with training in critical and analytical skills. While it follows a similar format to its single honor equivalent – Drama and theatre studies (TR025) – the practical content is limited in the first two years, but allows for the taking of practical TSM students there are modules in third and fourth years. For approximately 7 hours per week of classes plus rehearsals. Students in this course devote their full time to the history, to the history, Students in this course devote their full time and practice of theatre and performance studies. It is theory, those who already have experience in particularly appropriate for school or youth theatre, and it includes considerable community, work in practical theatre activities. For single honor students there are approximately 14 hours per week of classes plus rehearsals. 56 Arts, Humanities and Social Sciences Holloway College(UniversityofLondon). Glasgow, Goldsmith’s College(UniversityofLondon)andRoyal National KapodistrianUniversityof Athens, theUniversityof de Paris-Nanterre(ParisX),theFreieUniversitätBerlin, University ofCalifornia,theHelsinki,Université programme. Dramahasexchangeagreementswiththe at aEuropeanuniversityaspartoftheErasmusexchange You mayapplytospendtheJuniorSophister(third) year and, inyourfinalyear, adissertation. assignments, classpresentations,writtenandoralexamination Assessment isbyacombinationofessays,journals,practical staff andculminatinginsubmissionofadissertation. undertake anindividualresearchprojectguidedbyamemberof In yourfinalyear, inadditiontocourseoptions,youwill performance studies,acting,andtechnology. directing, theatremanagement,filmtheoryandhistory, and theUSA,stage,costumelightingdesign,devising, includes coursesinthetheatrehistoryofIreland,Europe, Asia, some balanceisrequired. The rangeofoptionsisvastand and theoreticalfieldsorinpracticalaspectsoftheatre,although The rangeofcoursesallowsyoutofavourstudyinhistorical who majorinDrama. curriculum betweensinglehonorstudentsand TSM students In theSeniorSophister(fourth)year, thereisnodifference in half thenumberofcoursesrequiredsinglehonorstudents. (meaning thereisnoprioritisation),with TSM studentstaking students aretreatedequallyintheJuniorSophister(third)year from arangeofoptionalmodules. TSM andsinglehonor the curriculumisconstructedbyeachstudentviaselection Irish theatreincontext”forallstudents. The remainderof courses. There isacompulsorycourseentitled“Contemporary performance historywithmorepracticalworkshop-based the curriculumoffers library-basedcoursesintheatreand In theJuniorandSeniorSophister(thirdfourth)years, The Sophisteryears Study abroad Assessment Tel: +35318962266 www.tcd.ie/Drama beginning withfurtherstudyatpostgraduatelevel. film, ortelevision.Othershavechosenresearchcareers companies, havewonawards,oractivecareersintheatre, number ofrecentgraduateshaveformedtheirowntheatre writing, management,communitydramaandteaching). A of theatre,film,ortelevision(suchasdirecting,acting,design, to takefurthertrainingorapprenticeshipsinspecialistareas seek employmentintheatreorrelatedprofessions.Manyopt Most graduatesofboththesinglehonorand TSM course Career opportunities Further information n n n Did youknow? and severalWest Endtheatres inLondon. roles hehasalsoperformedattheRoyalNational Theatre actor aftergraduation. As wellasmanyfilmandtelevision College, Dominicwentontotrainprofessionallyasan productions. LikemanyotherDramastudentsat Trinity English, havingplayedleadrolesinDramadepartment from Trinity CollegewithaB.A.inDramastudiesand critically acclaimedHBOseries The Wire.Hegraduated Dominic playedleaddetectiveJimmyMcNultyinthe Dominic West Graduate Profile
Contemporary playwrights, directors, actorsand playwrights,directors, Contemporary Drama at Trinity inthepurpose- Collegeishoused Zarrilli. Gunilla Palmstierna-Weiss, Yong LiLan,andPhillip Mason, HaroldPinter, FionaShaw, JimSheridan, Stafford-Clark, GarryHynes,PamelaHoward,Patrick Bogdanov, GabrielByrne,Sue-EllenCase,Max years, visitorshaveincluded Augusto Boal,Michael work andgiveworkshopsorcourses.Inrecent designers oftenvisit Trinity Collegetodiscusstheir offices. a dancestudio/rehearsalspace,seminarroomsand theatre of Trinity College’s studentdramasociety), performance space,thePlayers Theatre (thestudio the SamuelBeckett Theatre, a208-seatblackbox built SamuelBeckettCentre.Withinthecentreis Beckett. theatre, fromCongreveandGoldsmithtoSynge educated someofthegreatestdramatistsinworld in1592, Since itsestablishment Trinity Collegehas Arts, Humanities and Social Sciences 57
Course overview is a crucial part of the student experience. is a crucial part of the a fully committed to pursuing a career as Only students who are consider this course. Students who are professional actor should applying stage should consider this path at their career unsure of TR001 or Drama and theatre studies – for Drama Studies – TR025 (see page 55). The Freshman (first two) years take compulsory Students in the first two years of the course studies. Voice Acting & text, Movement studies and modules in by professional is by practical workshop and delivered Teaching practitioners. In addition there is considerable individual tuition to supplement the workshops in all aspects of the course. Students will also be introduced to the techniques of acting for recorded At the end of the Senior Freshman media (film, radio, television). (second) year students will combine all the skills developed over the two years of training in their first ensemble production to an invited audience. The Sophister (third and final) year Students will be cast in a series of 5 theatre productions, directed by professional theatre directors. Each production will have multiple performances over a 10-day period and will play to invited agents, directors, producers, as well as the general film, directed students will be cast in a short public. Further, by a professional film director and filmed both on set and on The films will receive a public screening. Students will location. also perform an audition showcase before an invited audience of agents and directors. The teaching is intense and offers a high degree of individual a high degree is intense and offers The teaching to maintain a healthy students are expected Acting tuition. and stamina physical demands order to cope with the lifestyle in the training. required by meet theatre the possibility to offers While the course and ongoing basis as well as the practitioners on a regular and recording studios, students are possibility to tour theatres to widen and deepen their knowledge encouraged and expected theatre scene by attending professional of the contemporary events. Being connected to the performances and related right from the beginning of training professional theatre scene professional theatre This course trains students for careers in strong emphasis is placed on training A and related industries. the actor’s body as an instrument, as well as nurturing the actor’s creative imagination. It is physically demanding and take compulsory requires a high level of stamina. Students Acting & text, Movement studies and developmental modules in studies in the first two years of the course. In the third and Voice in 5 productions, 1 final year of the course students will be cast the course of the year short film and an audition showcase over producers and which are performed in front of agents, directors, the general public.
e and www.thelir.i It is not part of 14 Acting (Hons.) Bachelor in Application forms can be Application forms can downloaded now from The Lir website downloaded now from See also: TR001 Drama studies, page 55 TR025 Drama and theatre studies, page 55 page 58 Stage management and technical theatre, be submitted by 1 February 2013. be submitted by 1 February Academy of The Lir – National by This course is taught Dublin. College Trinity Art @ Dramatic system. the CAO application Lir – National The Administrator, The should be mailed to Technology Enterprise and Trinity Art, Academy of Dramatic Campus, Dublin 2, Ireland. will prepare a classical Audition. Students Entry is by audition. Each and a contemporary monologue for first minutes long. monologue should be no more than three be required to Successful applicants at first audition will at which voice, attend at least one more round of auditions date final The assessed. be will skills group and movement Auditions will of applications for receipt is 1 February 2013. April 2013. be held between February and Special Entry Requirements: entry course. Applications must This is a restricted PLACES 2012: AWARDED: DEGREE Acting Is this the right course for you? Acting Being an acting student at The Lir is completely different to The Lir is completely different Being an acting student at being a student on other drama courses. While students of degree courses in English or Drama might be in taught classes The Lir can for approximately 14 hours per week, students at expect to be in classes, workshops and rehearsals on average for 35 hours per week, and sometimes more when in production. on the basic The Lir is founded theatre at for the Training principle of simulating the working environment of a professional theatre. This is a three-year, full-time, intensive honors degree designed This is a three-year, the skills necessary to train students of exceptional talent with and related for a career as an actor in professional theatre Through a series of skills-based modules in acting industries. singing, as well as technique, voice, movement, dance, and text analysis, it seeks complementary classes in dramaturgy and to equip students with the skills necessary to translate or create for performance a wide variety of approaches to theatre. In order The Lir’sto emulate best practice of drama school associate (RADA) the course is taught over nine semesters (three per annum) and over three years. Given the practical nature of the course, and the principal objective of training the actor’s body as an instrument as well as the creative imagination, the intensity of the training for actors means that a student can expect to be in class for 36 weeks per annum (three 12-week semesters). 58 Arts, Humanities and Social Sciences Tel: +35318962559 www.thelir.ie sustain acareerasanactor. will betaughtnotonlyhowtoworkasanactorbutalso emphasis inthetrainingoncareerpreparation,andstudents employment opportunitiesforthestudents. There isastrong the finalyearproductionsandshowcasesaredesignedtoattract dedicated theatreprofessionalswithstrongindustrylinks. All of theatre andrelatedprofessions. All thetrainingisprovidedby The courseisspecificallydesignedtotrainactorsforthe theatre practitioners. young flexible teachingspacestosuitthetrainingof TheLir’s studios, adancestudio,technicalworkshop,andrangeof capacity ofmorethan200,aswell2furtherperformance playwriting. Itfeaturesaflexibleblackboxstudiowithseating lighting design,stagemanagement,technicaltheatreand specifically forarangeofcoursesinacting,design,directing, new buildingatGrandCanalDock(seepage59),designed The trainingoffered by The Lirtakesplaceinanexciting screen. and workshopsfromleadinginternationalfiguresofstage and breadthofthetrainingissupplementedbyguestlectures highest levelofinternationalprofessionalpractice. The depth in aconsciouseffort toteachstudentsfromtheoutset by professionalswithextensiveexperienceoftheindustry, film, television,radioandnewmedia. Thetrainingisprovided Lir hasalsofosteredcloselinkswiththealliedprofessionsof changing needsanddirectionsofthetheatreindustry. The The trainingoffered by The Liriscloselylinkedtotheever- world-renowned Royal Academy ofDramatic Art. students inSeptember2011. Itisformallyassociatedwiththe Trust and Trinity CollegeDublinandopeneditsdoorstothefirst The LirwasdevelopedbythepartnershipofCathalRyan performances. final Sophisteryear, assessmentisbyaseriesofpublic series ofpracticalclasspresentationsinallmodules.Inthe Assessment intheFreshmanyearsisbasedentirelyona Further information Career opportunities Dramatic Art The Lir–National Academy of Assessment
View “TheLir”onFacebook
and onproductionsinsomeofDublin’s leading theatres. Lir. Studentswillworkonin-housetheatreproductionsat The Lir equipment, andoperateallofthespecialistequipmentat The construct setsandcostumes,operaterig,lightingsound students willparticipateinpracticalsessionslearningto Alongside classesintheprincipalsofstagemanagement, purposebuiltfacility.workshops andstudiosat The Lir’s Almost 80%oftheclassestakeplaceinspeciallydesigned and technicaltheatrestudentslearnbyhands-onteaching. a studentonotheruniversitycourses.Stagemanagement Being astudentat The Liriscompletelydifferent tobeing production. skills, professionalpracticesandcreativeapproachestotheatre theatre andrelatedindustriesthroughthedevelopmentof a stagemanagerand/ortechnicalspecialistinprofessional of exceptionaltalentwiththeskillsnecessaryforacareeras This isatwo-yearLevel8coursethataimstoequipstudents Is thistherightcourseforyou? and technicaltheatre management Stage Acting, page57 TR025: Dramaandtheatrestudies,page55 TR001: Dramastudies,page55 See also: will beheldbetweenFebruaryand April 2013. for receiptofapplicationsis1February2013.Interviews highlighting theirtheatreexperiencetodate. The finaldate Entry isbyinterview. Applicants shouldprepareaportfolio Technology Campus,Dublin2,Ireland. National Academy ofDramatic Art, Trinity Enterpriseand ie andshouldbemailedto The Administrator, The Lir– be downloadednowfrom The Lirwebsitewww.thelir. the CAOapplicationsystem. Dramatic Art @ Trinity CollegeDublin. This courseistaughtby The Lir–National Academy of be submittedby1February2013. This isarestrictedentrycourse.Applicationsmust Special EntryRequirements: DEGREE AWARDED: PLACES 2012: management Stage and technical theatre theatre technical and Application formscan Professional Diploma 15 It isnotpartof
Arts, Humanities and Social Sciences 59
Mathematics Mathematics TR001 (TSM) 43 435*-565 B.A. See page 27 Grade B OC3/HD3
Economics CODES: COURSE PLACES 2012: POINTS 2011: AWARDED: DEGREE TSM points: Special Entry Requirements: Leaving Certificate GCSE be studied as a single honor Economics (TSM) cannot with one other subject within course. It must be combined TSM (TSM) programme. the two-subject moderatorship is awarded An honors degree is a joint honor programme. subjects that in both subjects. See page 36 for a list of combine with Economics. studied through the Economics can be Alternatively, TR081) Business, economic and social studies (BESS: political science, economics programme or the Philosophy, TR015) programme. and sociology (PPES: choose Within BESS, after a common first-year students to either 6 courses in the second year and then proceed with specialise in economics or to combine economics or sociology. one of business studies, political science For further details see page 37. economics and political science, Within Philosophy, students choose 3 after a common first-year sociology, year 2 subjects in the third subjects in the second year, For year. and either one or two subjects in the fourth further details see page 99. What is Economics? Many of the problems that dominate our newspaper headlines Many of the problems that dominate our newspaper poor with are economic problems. Why are some countries very low growth rates while a small number of countries enjoy high living standards and high growth rates? What is the role of international trade and finance in explaining these global inequalities? Why are some countries so much more successful at creating employment or reducing unemployment than other countries? Within countries, why do some people earn so much more than others, and what are the best ways to tackle and reduce poverty? Is it possible to pursue economic growth and still protect our natural and physical environments? How should governments try to raise the finance needed to pay for health and education services and income-support programmes? What we be is the proper role for government in the economy? Would with higher taxes but also better social services than better off we presently enjoy? Any society has to address the problem of how and what to services and goods the how and survival, material its for produce that are produced should be distributed among its population. Economists explore how people and institutions behave and function when producing, exchanging and using goods and that mechanisms find to is motivation main Economists’ services. encourage efficiency in the production and use of material goods and resources, while at the same time producing a pattern of income distribution that society finds acceptable.
View “The Lir” on Facebook View
Further information Career opportunities Assessment Course overview Course e www.thelir.i All of the training is provided by dedicated theatre professionals All of the training is provided by dedicated provided in the with strong industry links. Opportunities are skilled specialisms second year to focus on one of the many placements in the area of technical theatre. Professional to the industry and throughout the training introduce students enhance employment prospects. Assessment is based primarily on a series of practical Assessment is based primarily on a series demonstrations in all modules. The course is specifically designed to train technical staff for staff to train technical is specifically designed The course of skills- a series and related professions.Through the theatre & sound, lighting in stagecraft & construction, based courses stage/production/technical management, properties & propping, make-up technical drawing, & safety, film & television, health seeks to equip students with the and scenic art, the course a theatre production. Classes in skills necessary to realise the set & costume design, will complement theatre history, in their analysis of historical periods, styles, skills-based courses practices with a view to developing the forms, conventions and A of a reflective practitioner. intellect and the encouragement through research and its practical spirit of enquiry and discovery to encourage the life-long learning presentation further seeks for sustaining a career in the theatre and processes necessary by dedicated and All teaching will be provided allied professions. managers, and will experienced theatre technicians and stage reflect best practices in professional theatre. Tel: +353 1 896 2559 Tel: 60 Arts, Humanities and Social Sciences Economics asadegreeoption. engineering orphysics,forexample,youshouldalsoconsider stimulating. Ifyouenjoyabstractthinkingandareconsidering assisting the Third World, youwillfindtheEconomics curriculum goals suchasloweringunemployment,reducingpovertyor government actionmightbeusedtopursueeconomicandsocial affairs, bothnationalandinternational,inunderstandinghow range ofinterests.Ifyouareinterestedincurrenteconomic Economics at Trinity Collegeappealstostudentswithawide living standardsofoursociety. recommendations thathopefullywillimprovethewelfareand new understandingofeconomicproblemsortomakepolicy together theory, dataandstatisticaltechniquestoarriveata employment, costs,etc. The artoftheeconomististoblend and analysingdataabouteconomicphenomena–prices, An importantpartoftheworkaneconomistiscollecting in economicmodelsthatbestexplaintheeventsweobserve. test themagainstthefacts. These theoriesaresummarised Economists aimtodeveloptheoriesofhumanbehaviourand or jointhonorsdegree, youcanputtogethera package thatbest of coursesonoffer and,withintheframework ofeitherasingle programme ineconomicsisits flexibility. Thereisawiderange The greatstrengthoftheSophister (thirdandfourthyear) The Sophisteryears amount oflecturesandtutorials intheirothersubject. economics. Studentswill,ofcourse,haveasomewhatsimilar 6 hoursoflecturesand3tutorialsperweekin in thelate1990sandearly2000s.Studentshaveapproximately performance andassociatedpolicyissuesoftheIrisheconomy Senior Freshmanyearstudentsalsostudythemainfeatures, of lecturesand3hourstutorialsperweekineconomics.Inthe the JuniorFreshmanyear, studentshaveapproximately7hours mathematics andstatisticsnecessaryformorein-depthstudy. In economics andtheacquisitionofquantitativeskillsin emphasises theunderstandingofbasicprinciples Economics teachingintheFreshman(firsttwo)years The Freshmanyears Course content Is thistherightcourseforyou? chosen topic. Sophister yearmaychoosetocompleteadissertationon students specialisingexclusivelyineconomicstheSenior students whensettingoutontheircareerpaths.Inaddition, expertise inanumberofspecificareasandgreatlyfacilitates project workallowsstudentstoachieveaveryhighlevelof of almostallcourseswithintheSeniorSophisteryear;this independent work.Projectworkisaveryimportantcomponent in theSeniorSophisteryearsoastofacilitatetimeformore the formalend-of-yearexamination.Fewercoursesarerequired combination ofcontinuousassessment(testsoressays)and All coursesinthefirstthreeyearsareassessedbya per weekintheSeniorSophisteryear. have approximately8hoursoflecturesand2tutorials subject. Those studentsspecialisingexclusivelyineconomics somewhat similaramountoflecturesandtutorialsintheirother tutorials perweekineconomics.Studentswill,ofcourse,havea students haveapproximately4hoursoflecturesand1hour week ineconomics.WithintheSeniorSophister(fourth)year, approximately 6hoursoflecturesand2tutorialsper Within theJuniorSophister(third)yearstudentshave wish tochoosethemorequantitativeandanalyticalcourses. those wishingtopursuearesearchoracademiccareermight while organisation; courses inindustrialeconomicsand or apositioninindustrycanoptforpackageemphasising integrate analysisandpolicy;thoseintentonabusinesscareer journalism orthepublicsectorwillfindarangeofcoursesthat orientated setofoptions;thoseinterestedinacareerpolitics, in banking,financeoraccountancycanchooseafinance- reflects yourinterestsandfuturecareergoals. Thoseinterested leading universities. finance, journalism,law, politics,thepublicservice,andin made distinguishedcareersallovertheworldinbusiness, or abroad.Overtheyears Trinity College’s economistshave About athirdofgraduatesgoontofurtherstudyeitherinIreland students goabroadforhalfanacademicyear. year orforhalfanacademicyear;themajorityofoutgoing Belgium, GermanyandtheNetherlandsforeitheranacademic third yearstudyinginpartnerinstitutions Australia, France, Students havetheopportunitytospendsometimeintheir Assessment Career opportunities Study abroad n Did youknow? history, andthehistoryofeconomicthought. macroeconomics, appliedeconomics, economic and publication,particularlyininternational Department reflectitsexcellent recordofresearch offeredThe coursesandprogrammes bythe Arts, Humanities and Social Sciences 61
CE001 Ireland Church Of (CICE) College Of Education Mhuire, Coláiste CM001/002 Marino B.Ed. Candidates must satisfy the
Education CODES: COURSE AWARDED: DEGREE is a restricted entry course. CE001 (CICE): This submitted by 1 February 2013. Applications must be requirements of the Department Candidates must satisfy and the requirements of the of Education and Science, (see below for contact details). College of Education CM001/002 (Marino): Education and Science, Department of the requirements of (see and the requirements of the College of Education below for contact details). See also: TR009: Music education, page 97. Coláiste Mhuire, Marino Further information Church of Ireland College of Church of Ireland College Education (CICE) The degree of Bachelor in Education (B.Ed.) is a professional The degree of Bachelor in Education (B.Ed.) academic and degree which is intended to provide for the The teachers. professional requirements of primary school University of Dublin. degree is accredited and awarded by the College Trinity of Students of CICE are also registered students available directly from Dublin. Details of the course structure are e. CICE: www.cice.i B.Ed. (Bachelor in Education) B.Sc. (Education Studies) These degrees are accredited and awarded by the University of is delivered in its entirety by on both courses Teaching Dublin. Coláiste Mhuire, Marino. Church of Ireland College of Education 96 Upper Rathmines Road, Dublin 6. e www.cice.i + 353 1 497 0033 Tel: Coláiste Mhuire Marino Avenue, Dublin 9. Griffith e www.mie.i + 353 1 805 7700 Tel: debating in the Hist, or writing for one (BESS Graduate) of the College newspapers. years, there With all that has occurred over the last four economics.” couldn’t be a more interesting time to study “At the time I was filling out my CAO form, the vast I was filling out my “At the time in the media were promising majority of commentators housing bubble, while politicians a “soft landing” to the to continue increasing expenditure of all creeds pledged Studying economics will change whilst lowering taxes. world, giving you the confidence the way you look at the to challenge the consensus, and and analytical ability supported by empirical put forward sound arguments evidence. into economics is through BESS The most common entry year you will be exposed to a (TR081), where in first and ideas beyond the purely broad range of disciplines education. commercial, leaving you with a well rounded concepts at the Both first and second year introduce the have studied heart of economics, so there is no need to The final two years of the degree it at secondary school. discipline allow you develop specific interests in the issues etc.), while (finance, international economics, policy theories and gaining an in depth understanding of the core methods of economics. as promising career There are few subjects which offer will gain unique insights You prospect as economics. life. which can be applied to public, civic, or commercial friendships while taking you’ll develop lifelong Trinity, At University has advantage of the unique society culture the (or editing) the Student be it through writing for to offer, Economic Review, Barra Roantree Barra Roantree Student Profile Student Further information s www.tcd.ie/Economic +353 1 896 1043 Tel: 62 Arts, Humanities and Social Sciences before 1400. they alsocoveralongerhistoricalrange,includingliteraturefrom developing genres(Poetry, theNovel, Theatre, theEssay)and students, Englishstudiesstudentsstudyliteratureintermsof critical andculturaltheory. ComparedtoEnglishliterature(TSM) a sophisticatedcriticalconsciousnessandanawarenessof history oftheseliteratureswhilealsoenablingyoutodevelop cultures. Itaimstodevelopathoroughknowledgeofthe English, Anglo-Irish, American andemergingpost-colonial of writinginEnglishandencompassesliteraryworksspanning The studyofEnglishisconcernedwiththehistoryandpractices genres, andaconcentrationon themodernperiod(post1400). honor programme,withlessemphasis onthedevelopmentof in English,thecourseislessextensive thanthatofthesingle While TSM studentscover alltheprincipalareasofliteratures critical andculturaltheory. a sophisticatedcriticalconsciousnessandanawarenessof history ofdiffering literatures whilealsoenablingyoutodevelop of thecourseistohelpyouacquireathoroughknowledge the Englishlanguage,fromChaucertopresentday. The aim English literaturecoversabroadrangeofliteratureswrittenin (TSM jointhonors)–TR001 literature English (Single honor)–TR023 studies English combine withEnglishliteratureseepage36. degree isawardedinbothsubjects.Forsubjectsthat programme. TSM isajointhonorprogramme. An honors other subjectwithinthetwo-subjectmoderatorship(TSM) a singlehonorcourse.Itmustbecombinedwithone TR001 –Englishliterature(TSM)cannotbestudiedas English isreadalmostexclusivelyforfouryears. TR023 –Englishstudiesisasinglehonorcoursewhere Advanced GCE(A-Level) Leaving Certificate Special EntryRequirements: TSM points: DEGREE AWARDED: POINTS 2011: PLACES 2012: COURSE CODES: literature English and Englishstudies
Grade C HC3 See page27 B.A. 495* 40 TR023
English literature English language (A or B (A orB)English 520*-560* 85 TR001 (TSM) studying Englishat Trinity Collegeisexcitingandintense. writing byundergraduates.Inthiswayweensurethatyourtime The Schoolactivelysupportsseveraljournalsofcreative School. satirist andfantasywriter, areboth Adjunct Professorsinthe prizewinning author, and Sir Terry Pratchett,thebestselling Chair ofPoetry)andvisitingwriters.RichardFord,thePulitzer Man BookerPrize,andProfessorHarryClifton, The Ireland guest lecturers(suchas Anne Enright,winnerofthe2007 activities, suchaslectureseries,conferencesandsymposia, The SchoolofEnglishalsocoordinatesmanynon-syllabus resources ofaworld-famouslibrary. undertaken independently, andyouwillhaveatyourdisposalthe discussion, bothoralandwritten.Muchofyourworkwillbe independence ofcriticalthoughtandthearticulationinformed Our Englishcourseshavebeendesignedtodevelop There isamaximumofaround22studentsineachseminar. available options,mostaretaughtthroughseminardiscussion. of yourEnglishmodulesarechosenbyyoufromawiderange 10-12 students.IntheSophister(thirdandfourth)years,most that moduleonly, andthenumbersfortutorialsarearound modules aresupportedbysmall-groupteachingdedicatedto of around50. All Freshman(firstandsecondyear)lecture single honorsonlylectureswilltypicallyhaveamaximum will typicallyhaveamaximumofaround150students,while of lecturesandrelatedtutorials.For TSM students,lectures teaching. Inthefirsttwoyearsteachingisbyacombination The SchoolofEnglishisstronglycommittedto English literatureorstudies. contemporary studiesinthelanguageyouwouldenjoyeither and relatedliteratures,fromtheirearliestbeginningsthroughto If youwanttostudythewholerangeofdevelopmentsinEnglish the libraryandwriting essays. high proportionofyourtimewill betakenuppreparingworkin independent studyandresearch areencouraged,andquitea independent researchprojects of upto12,000words.Individual words, youwillbyyourfinalyear bepreparedtotacklemajor means thatfromshortfirst-year essaysofaround1,500 and discussionskillswilldevelop. The modelofassessment benefit fromclosepersonalstaff supervision, sothatyourwriting Our commitmenttosmall-groupteachingmeansthatyouwill their degree. construct theirowncourseintheadvancedworkthatwilllead to in thefirstyear. Afterthefirsttwoyears,studentsarefreeto nationality, and Theories ofliteratureisonethemajormodules a varietyofmodules,basedonperiod,genre,themeand through acombinationoflecturesandtutorials.Studentstake consist ofalmostentirelycompulsorymodules,taughtmainly The Englishcoursesaredesignedsothatthefirsttwoyears English atTrinity College Is thistherightcourseforyou? Course content small-group Arts, Humanities and Social Sciences 63 e
h
Further information Study abroad Study Career opportunities Darryl Jones +353 1 896 1878 Tel: E-mail: [email protected] www.tcd.ie/Englis +353 1 896 1111 Tel: Head of School: The School of English has strong international links with many international links of English has strong The School in active participation abroad, including English departments Austria, in with universities exchange programme the Erasmus also have an Spain, Switzerland and the UK. We France, Italy, College in the US, and there are agreement with Dartmouth which allow students to spend a year scholarship opportunities College, Boston notably Berkeley, at prominent US universities, and Georgetown. to study abroad, our exchange In addition to the opportunity international students, ensure that the links, which attract many is vibrant and cosmopolitan. student body in English in demand from The skills of English graduates are much marketing, employers, especially in journalism, broadcasting, and teaching, and retail and business management, publishing qualifications in graduates from English often gain professional public relations and accountancy, disciplines as diverse as law, clinical speech. platform for The four-year degree provides an outstanding about 30% of our postgraduate study in English, and usually in English (Master’sgraduates go on to read for a higher degree writers are degree, PhD degree). Many well-known creative College English graduates, including Eavan Boland, Trinity Derek Mahon, Brendan Deirdre Madden, Michael Longley, Kennelly and Eiléan Ní Chuilleanáin. Trinity College Dublin is ranked 14th in the world Trinity in English Language & Literature (by the QS World University Rankings 2011). Contemporary Irish literature Creative writing Dissertation Shakespeare and sexuality Modernism American letters literature Children’s Popular literature Ulysses in contexts African and Caribbean literature Irish writer and society Post-war British fiction 20th century women novelists Literature of the American South Literature of the Introduction to postcolonial literature Victorianism Introduction to Modernism Enlightenment Romanticism novel The Genre: Medieval and romance Renaissance stage, screen Text, Shakespeare: Theories of literature Irish writing Did you know? n Assessment Assessment is by a combination of submitted essays or The weighting is dissertation and end-of-year examinations. approximately 50% submitted work and 50% exams. n n n n n n n n n n n n n n Examples of Sophister modules may include: The Sophister years fourth) years, you In the Junior and Senior Sophister (third and range of specialist will choose most of your modules from a wide modules are taught at an advanced level options. By fourth year, by seminar only. n n n n n n n n n n Examples of Freshman modules include: Examples of Freshman The Freshman years The Freshman a range (first two) years and Senior Freshman Over the Junior of introduction to a variety provides you with an of modules will You to literature. practices and approaches critical theories, prescribed texts. on selected primarily concentrate 64 Arts, Humanities and Social Sciences continent-wide basis. and examinescontemporaryEuropeinallitscomplexityona studies theEuropeanpastinordertounderstandpresent, history, culture,languages andpoliticsofEuropeannations.It integrated multidisciplinaryprogrammewhichencompassesthe At Trinity CollegeEuropeanstudiesisabroad-ranging,fully What isEuropeanstudies? TR001: TSM, page36 See also: language asabeginner. Seenote8onpage31. beginner level.Nostudentmaystudymorethanone Italian, Polish,RussianandSpanishareavailablefrom Italian, Polish,RussianandSpanish. Students studytwolanguagesfromFrench,German, Advanced GCE(A-Level) Leaving Certificate must attainatleastthefollowinggrades: If candidatesarepresentingtwoormorelanguages,they English orIrish),theymustattainagradeofHB3higher If candidatesarepresentingonelanguage(otherthan Certificate (orequivalent). language (otherthanEnglishandIrish)intheLeaving Applicants mustpresentwithatleastoneEuropean Special EntryRequirements: DEGREE AWARDED: POINTS 2011: PLACES 2012: COURSE CODE: European studies
Grade B HC Grade C Or HC3 HC2 HC1 in onelanguage In twoofFrench, above) or Irish(aslisted other thanEnglish or Irish other thanEnglish other language a non-beginner taking Spanishas Spanish and French orGerman Spanish Polish, Russian, Italian, Latin, German, Greek, In twolanguages If presentingany If presenting If presenting B.A. 530 45 TR024 component inthefirst,secondandfourthyears. from theRenaissancetopresentandiscompulsorycore of ideasteachestheevolutionEuropeanthoughtandculture social sciences(politics,economicsandsociology). The history present throughthreedisciplines–history, historyofideasand As wellaslanguagesyouwillstudytheEuropeanpastand studied inthefinalyear. specialising inthesocialandpoliticalsciences.Literatureis and languagestudyisdesignedtomeettheneedsofstudents and cultureofthecountriesinwhichlanguageisspoken Language learningisembeddedinthestudyofsociety one becomesyourmajor, andtheotheryourminorlanguage. languages arestudiedequallyinthefirsttwoyears,afterwhich Spanish andRussiancanbestudiedfrombeginnerlevel).Both German, Italian,Polish,RussianorSpanish(Italian, You willstudytwooutofsixEuropeanlanguages:French, range ofdisciplinaryapproaches. with abroadintellectualappetiteandwhoareinterestedin this course.Europeanstudiesisexplicitlydesignedforstudents politics andtheworkingsofcontemporarysocietyyouwillenjoy If youenjoystudyinglanguagesandhaveaninterestinhistory, your specificstrengthsandinterests. the disciplinesthatinterestyoumost,andsotailordegreeto compulsory andyouwillbeabletochooseothermodulesfrom year onwardsthehistoryofideas,orculturalhistory, is In firstyearallcomponentsarecompulsory. Fromthesecond Course overview Is thistherightcourseforyou? Course content Arts, Humanities and Social Sciences 65
Social, economic and political history are given equal emphasis in this course, Social, economic and political history are France and Russia, as well as looking at Italy which concentrates on Germany, and Spain. This module is an introduction to the study of comparative politics. We will be be will We politics. comparative of study the to introduction an is module This authoritarian and democratic countries, developed and developing both studying economic and political of midst the in are that countries as well as regimes like countries why (i) about learn will we things, other Among transitions. (ii) two, only has States United the while parties, of multitude a have Israel what determines why some countries are capable of making the transition to prevail regimes authoritarian countries other in while Chile), (e.g. democracy and Zimbabwe), (e.g. time long a for power onto hold to manage autocrats and others while growth, economic tremendous seen have countries some why (iii) African countries). We have struggled to spur economic development (e.g. most will begin the course by discussing the micro foundations of political decision- we will study the role of preferences and beliefs, which making. Specifically, Next, culture. and conflict cleavages, political understanding for essential are politics, group and decision-making collective of study the to move will we covering a variety of topics ranging from political parties and interest groups to movement in the 1960s andAmerican civil rights social movements (e.g. the political of study the to shift then will We 1989). in revolution European East the in individual as well as collective institutions as a key source for differences micro the at studied be will institutions political of effects The decision-making. plurality in behaviour voting (e.g. decision-making political at looking by level the at and Italy) like systems proportional versus States United the like systems macro level by looking at political and economic development. History of Continental Europe since 1870 History of Continental Europe Comparative politics
n n Culture and politics in Europe 1700-1815 Culture and politics since culture and society modern of development and emergence the Studies by culture political with itself concerns course the of core The Enlightenment. the French the to, opposition in and from, created ideologies political the analysing the defined who figures and texts central the to introduced be will You Revolution. the forward carried that changes cultural and social the to and modernity of meaning project of a modern society. The making of Modernity 1750-1820 themselves constituted they as modernity of concepts key to students Introduces cultural and philosophical main the covers It 1800. around epoch saddle the during cultural how elucidates and Romanticism and Enlightenment European the in trends the of elements identifies It society. and politics with interact discourses aesthetic and of Enlightenment trends with counterDialectics of Enlightenment and the interaction movements and cross-currents. ‘Culture and Politics in Europe 1700-1815’. It follows and builds on the History module Select one of: Languages 1 & 2: expression and of the languages, written and spoken Grammar and structures comprehension Senior Freshman (second) year Senior Freshman of classes per week. approximately 22 hours There are metropolis War the First World Culture and politics in the inter war years The idea of Europe after 1945 The pre-war crisis of values (Nietzsche) Social Darwinism Socialist ideologies The upsurge of right-wing thought after The role of new media The Fin-de-Siècle mood around 1900 The urban culture of the European
Europe, c. 1500-1700: Power and belief Examines the political, social and cultural history of sixteenth and seventeenth-century Europe. By the end of this module, students will have been introduced to a variety of primary methods sources and some of the different and approaches that can be used in their analysis. This module addresses key themes of the period including intellectual changes during the Renaissance and Reformation, the emergence of rival churches across most of the Continent, the impact of the printing revolution, the increasing power of territorial states, the expansion of states into new colonial spaces, and military and political rivalry between states. Introduction to the history of ideas Introduction to the of European Introduction to the evolution and the 20th century, thought and culture in texts in their to the techniques of analysing historical context. the intellectual and This module examines before and after the cultural climate in Europe In particular you will examine Wars. two World or how intellectual and cultural trends reacted contributed to the threat of war and how they dealt with catastrophes in their aftermath. covered include: Topics n n n n n n n n n comprehension Junior Freshman (first) year Junior Freshman of classes approximately 22 hours There are per week. Languages 1 & 2: of the languages, Grammar and structures and written and spoken expression The Freshman years The Freshman 66 Arts, Humanities and Social Sciences where theErasmusschemedoesnotapply). offsets thisadditionalexpense (withtheexceptionofRussia, funding undertheEuropeanUnion’s Erasmusscheme partially abroad mayentailadditionalexpensesforstudentsbutsupport (Moscow) andSpain(Seville,Salamanca, Alcalá). The year Italy (Pavia,Siena,Florence),Poland(Krakow),Russia Grenoble, Bordeaux),Germany(Hamburg, Tübingen, Freiburg), departments inuniversitiesFrance(Paris,Strasbourg, have beenestablishedwithhistoryandpoliticalscience language andthisisanintegralpartofthecourse.Exchanges studying throughthelanguageyouchooseasyourmajor The JuniorSophisteryearisspentatauniversityabroad Junior Sophister(third)year supervision ofa memberofstaff. one oftheoptions) onasubjectoftheirownchoice underthe encouraged towriteatenthousand worddissertation(replacing from thelanguagedepartments. Studentswhosowishare sociology, andanumberofcultureliteratureoptions from awiderangeofmodules history, politicalscience, since 1890. Additionally, youwillchooseoneortwooptions ideas course:Modernismandmass society–ideasandculture textual analysis. The core courseinyourfinalyearisahistoryof minor languageconcentratesmainlyoncomprehensionand predominantly onyourmajorlanguage.Courseworkfor In theSeniorSophisteryear, languageworkfocuses Senior Sophister(fourth)year per week. There areapproximately22hoursofclasses Junior Freshman(first)year surrounding theeconomicsofEU. sections bypayingattentiontoissues The thirdsectionbuildsonthefirsttwo significance tostudentsofEuropeanpolitics. to mainissuesinpoliticalscienceof The secondsectionprovidesanintroduction structure. debates insociologyaboutEuropeansocial The firstsectionofthecourseintroduceskey sociology. of socialscience:politics,economicsand the significantissuesinthreemainfields This moduleoffers studentsanintroductionto Introduction tosocialscience There areapproximately22hoursofclassesperweek. Senior Freshman(second)year n n n (first) year, beforedeclaringtheirSeniorFreshman(secondyear)subjectchoice. Department ofEconomicsduringthe Trinity (third) Term oftheirJuniorFreshman * StudentswhowishtotakethiscoursemustseekpermissionfromtheHeadof
Intermediate economics* European societies International relations and theUK. society. The courseusescasestudiesfromFrance,Germany, Italy, Sweden cohesion –aparticularlyEuropeanwayofcounteringthedivisionsmarket extent towhichtheEuropeanUnioninvolvesasocialmodelof the divisionsofclass,region,gender, ethnicityandlifecycle.Itconsidersthe This moduleexaminesdifferent formsofsocialinequalityinWestern Europe, Union, andinternationalenvironmentalhumanrightsregimes. including theUnitedNations,World Trade Organisation,theEuropean relations andaselectionoftopicsinhistoricalcontemporarypolitics, questions bylookingatdiffering theoreticalapproachestointernational organisations onrelationsbetweenstates? This moduleconsidersthese of cross-bordertradeandfinance?Whatistheimpactinternational relations. Whydostatesmakewar?Whataretheconditionsforgrowth This moduleisanintroductiontothepositive,descriptivestudyofinternational general equilibrium. markets (inperfectlycompetitiveandimperfectlysettings) monopoly; monopolisticcompetitionandoligopoly);gametheory;factor (isoquant curvesandisocostlines);marketstructure(perfectcompetition; consumer theory(indifference curvesandbudgetconstraints);producertheory applications ofmicroeconomicsatanintermediatelevel. The modulecovers prosperity. The microeconomicmoduleofthecourse studiesthetheoryand different countrieshavedifferent long-rungrowthratesanddifferent levelsof that helpmitigatesuchfluctuations. Thethirdstepaimstounderstandwhy study thesourcesoffluctuationsineconomicactivityandpolicyresponses The macroeconomicmoduleofthecourseshasthreesteps. The firsttwosteps E-mail: [email protected] Tel: +35318961808 www.tcd.ie/European_Studie relatingtoEurope. focus orspecifically more applied,specialised Many studentsgoontodopostgraduatecourses,oftenwitha and tourism. and abroad),translatinginterpreting,journalism popular careerpathsareinlaw, consultancy, teaching(inIreland the diplomaticcorps,inbusiness,financeandmarketing.Other both inIrelandandabroad,theEU,civilservice Recent graduatesareemployedininternationalorganisations assessment, essaysandend-of-yearexaminations. Written, oralandauralexamsarecombinedwithcontinuous Further information Career opportunities Assessment
s e Arts, Humanities and Social Sciences 67
Cinema and Ireland American cinema from the 1890s to the 1960s American cinema from cinemas European and world Film theory and criticism 1 and 2 criticism 1 and Film theory Assessment This module moves from the earliest films made about Ireland, This module moves from the earliest films and censorship, through issues of production, representation, This module introduces aspects of American cinema in the aspects of This module introduces century by considering classical narrative first half of the 20th and key generic structures, important industrial developments module introduces the student to The second part of this texts. films from American influential examples of film criticism that may include this period have generated. Film genres examined the melodrama, the musical, the gangster film and the Western, science fiction films of the 1950s. a variety of These modules serve as an introduction to They will examine the national cinemas from around the world. that they produce, relationship between nations and the cinemas and cultures or through which their national identities, societies degree, students will are projected. In their second year of the consideration of be given the opportunity for a more detailed some of the issues raised. up to recent Irish filmmaking. of screenings per There are six hours of classes and six hours week. These modules begin by studying the evolution of film as a These modules begin its own specific codes and conventions. visual language with will build upon the issues raised In the second-year students 1 and further strengthen their by Film theory and criticism subject by examining the various engagement with the understanding and evaluating films approaches to reading, over the course of film history. that have developed Film studies is assessed by coursework and examinations. In the Freshman years, students will also be assessed on class presentations. n The Sophister years In the final two years of the degree course students can choose from the wide range of optional modules available covered may include aspects of Hollywood Topics to them. cinema, avant-garde and experimental cinema, documentary film, European cinemas, film music, world cinemas, genre studies, gender and film, film theory and criticism, film style and performance, digital filmmaking, editing and other aspects of film practice. In addition, all Junior Sophister (third year) students are introduced to digital video production, and will participate in joint short film exercises. Students may wish to build on this process Completed student films with further modules in their final year. will shortly be made available for viewing on our website. The Freshman years The Freshman and Senior Freshman during the Junior Courses taught n n n (first two) years may include: (first two) TR001 (TSM) 30 445*-540 B.A. See page 27 COURSE CODE: COURSE PLACES 2012: POINTS 2011: AWARDED: DEGREE Film studies Film TSM points: studied as a single honor course. Film studies cannot be with one other subject within the two- It must be combined TSM is a joint (TSM) programme. subject moderatorship degree is awarded in both An honors honor programme. subjects. with Film studies, see page 36. For subjects that combine Course content Is this the right course for you? Is this the right course for Overview Film studies covers the history and critical framework of film production and consumption from the 1890s to the present In the Freshman (first two) years, you will be introduced day. to film theory and criticism and to a very broad range of American, European and world cinemas. In the Sophister (final two) years, students choose from a wide range of options. transnational may include various national cinemas, Topics cinemas, classical and contemporary Hollywood cinema, genre studies, documentary theory and practice, avant-garde, experimental, and cult cinema, film theory and criticism, cinema and censorship, and editing. In addition, Sophister students will complete modules in scriptwriting and digital video production. If you enjoy watching a wide range of films and if you are If you enjoy watching a wide range of films analyse them in interested in acquiring the critical tools to and industry, society, relation to questions of style, technology, This course will examine film then this is the course for you. beginnings in 1895 right styles and movements from cinema’s While you will learn about practical issues up to the present day. involved in film production, including how to write a script and how to produce short videos, this course is primarily academic and geared toward critical engagement with film. Since 2003 Trinity College has pioneered the Republic of College has pioneered the Trinity Since 2003 Film studies course first specialist undergraduate Ireland’s The four years of the course allow leading to an honors degree. movements and film students to sample a wide range of film filmmaking. styles and to gain some experience of practical courses, Through lectures, class discussions and practical as art, as industry, students will gain a wide knowledge of film in the Department of Film The staff and as creative practice. widely on areas Studies are experts in their fields and publish Irish cinema, such as European cinemas, Hollywood cinema, film stardom, and film theory and history. 68 Arts, Humanities and Social Sciences E-mail: [email protected] Tel: +35318962617 www.tcd.ie/fil public service,etc. to artsgraduates,suchasadministration,teaching,civiland degree alsooffers opportunitiesin the manygeneralareasopen gone ontofurtherstudyinfilmandassociatedareas. This production andadministration. A numberofourgraduateshave ways, fromdirectingfeaturelengthfilmstoediting,scriptwriting, have goneontobeinvolvedinthefilmindustryanumberof advertising; marketing.RecentgraduatesofFilmstudiesat TCD media; filmreviewingandcriticism;artsadministration; areas suchasthefilmindustry;television;journalism;digital A degree inFilmstudiesoffers careeropportunitiesinmany workshops withLenny Abrahamson duringtheyear. Garage. TheDepartmentofFilmStudieswillholdanumber Filmmaker-in-residence, Lenny Abrahamson, onthesetof Career opportunities Further information m include French linguistics, literature,ideas andpolitics. optional subjects availableoverthecourseof fouryears on thewaylanguage isusedandstructured. Examplesof and stylesofwritten andspokenFrenchto reflectcritically This includesnurturinganability tocopewithdifferent registers basic linguisticskillsoflistening, speaking,readingandwriting. expected toprogressahigh level ofcompetenceinthefour forms thebackboneofteaching programme.Studentsare Language instruction–including computer-basedelements– written exercises,formsanintegralpartofthiscourse. analytical, andcriticalskills,intheformofbothoraltasks literature, cultureandsociety. The developmentofreading, spoken, andwithawideknowledgeofmajoraspectsFrench with ahighstandardoffluencyinthelanguage,bothwrittenand language andculture. The resultis thatyouleaveuniversity provide youwithathoroughgroundinginallaspectsofFrench French, readincombinationwithanothersubject,isdesignedto the world,Frenchat Trinity Collegewillappealtoyou. other cultureswhereFrenchisspoken,inEuropeandthroughout exploring thisdynamicsocietyandinfindingoutmoreabout distinguished history. Ifyouareinterestedinthepossibilityof French literature,cultureandcivilisationhavealong Course content Course overview Is thistherightcourseforyou? TR085: BusinessstudiesandFrench,page41 Polish/Russian orSpanish,page64 TR024: Europeanstudies–FrenchwithGerman/Italian/ TR018: LawandFrench,page90 TR011: Computerscienceandlanguage,page120 See also: or theLawandalanguagedegreeprogrammes. science and language, the Business studies and a language, or studiedasthechosenlanguageofeitherComputer languages studiedintheEuropeanstudiesprogramme Alternatively, Frenchmaybeselectedasoneofthetwo For subjectsthatcombinewithFrenchseepage36. programme. An honorsdegreeisawardedinbothsubjects. subject moderatorship (TSM) programme. TSMIt mustbecombinedwithoneothersubjectwithinthetwo- is a joint honor French (TSM)cannotbestudiedasasinglehonorcourse. Advanced GCE(A-Level) Leaving Certificate Special EntryRequirements: TSM points: DEGREE AWARDED: POINTS 2011: PLACES 2012: COURSE CODE: French
HC1 Grade C See page27 B.A. 400*-560* 84 TR001 (TSM) French French
Arts, Humanities and Social Sciences 69
TR001 (TSM) 45 415-565 B.A. See page 27 Human – environment: introduces key concepts relating to nature, culture and the environment, and interactions between humans and their environment, using case studies from the fields of conservation, environmental degradation and environmental hazards. Physical geography: provides a basic introduction to the large-scale controls and processes that have influenced the physical landscape of the earth, and that have provided the conditions for the evolution of a variety of life forms, species, habitats and ecological systems including those that led to and subsequently influenced human existence. Geography CODE: COURSE PLACES 2012: POINTS 2011: AWARDED: DEGREE TSM points: be studied as a single honor Geography (TSM) cannot with one other subject within course. It must be combined is TSM (TSM) programme. the two-subject moderatorship An honors degree is awarded in a joint honor programme. both subjects. with Geography see page 36. For subjects that combine general- the through studied be can Geography Alternatively, After two years of TR071. entry Science programme – may opt to specialise in students general science study, For special Geography for their third and fourth years. TR071 – Science see page 140. entry requirements to science, Geography may also be studied with Political course Earth see page 102, or as part of the single honor sciences (TR077), see page 161. Course content Why study Geography? n Geography is truly interdisciplinary as it spans a broad spectrum Geography is truly interdisciplinary as it spans As physical sciences. of the social, biological, informational and are well placed the world becomes interconnected geographers on social and to bring their understanding and skills to bear geographers, An important attribute of environmental issues. is their ability and one that is highly regarded in the workplace, a wide range of to combine multidisciplinary knowledge with report-writing, transferable skills, including critical thinking, These can be applied to careers numeracy and IT-literacy. such as which directly incorporate a geographic dimension, environmental consultancy or urban planning, and to wider to aim modules Geography TSM year) (first Freshman Junior The materials on focusing subject, the of breadth the of flavour a provide challenging while years, later in depth greater in with dealt are that approaches and forms of students to integrate the different knowledge that characterise the modern discipline of geography. students take three introductory In the Junior Freshman year, modules in geography: n areas such as business and public service.
French grammar and grammaticalFrench grammar analysis Comprehension and spoken language of the written Contemporary novels, theatre, films and a short stories, of French poetry specially prepared anthology Further information Career opportunities Study abroad Assessment In the Senior Freshman (second) year, you will build on this (second) year, In the Senior Freshman courses in the history of French ideas foundation by following French linguistics and in the and politics, French literature, practice of the French language itself. You will spend approximately five hours each week working on will spend approximately five hours You and approximately two hours each week language and grammar other course-work. studying literature and h www.tcd.ie/Frenc +353 1 896 1553 Tel: to be highly attractive to prospective employers. Recent graduates in French have gone on to work in areas as administration, arts teaching, university and secondary as diverse tourism, publishing, and translation and interpreting, diplomacy, investment banking. Increasing numbers of graduates go on to marketing take further postgraduate courses in areas such as law, The combination of an arts degree and a more and business. vocational or professional programme of studies has proved A minimum stay of two months in a French-speaking country is minimum stay of two months in a French-speaking A required over the duration of your course. Some students opt to spend their second or part of their third year at a university in France within the framework of an Erasmus exchange Trinity There are exchange agreements between programme. College and universities in Orléans and Paris. Written, oral and aural examinations, in addition to essays and Written, all contribute to continuous assessment of your coursework, students) will also assessment. Senior Sophisters (fourth-year research and write a final-year dissertation. The Sophister years wide a years, fourth) and (third Sophister Senior and Junior the In courses previously variety of optional subjects leading on from available. are years second) and (first Freshman the in undertaken Romantic to writing Enlightenment and classical from range These politics, society and and contemporary French literature, from travel writing. identity in France to French theory and French n n you will research If you elect to study French in your final year on a subject of your and write a dissertation in English or French choice in consultation with a supervisor. n The Freshman years The Freshman includes (first) year in the Junior Freshman The programme the French France, to aspects of contemporary an introduction subject areas include: literature. First year language and 70 Arts, Humanities and Social Sciences development. insurance), foreignaffairs, leisureand tourismandoverseas as wellpositionsinsuchareasfinancialservices(including planning, environmentalconsultancyandresearchteaching Geography studentsinrecentyearsincludeurbanandregional are widelyregardedasassets.Careerstakenupbygraduating valued intoday’s jobmarket,whereadaptabilityandflexibility discipline andtraininginhighlyrelevanttransferableskillsis Geography graduates. The combinationofabroad-based A wide rangeofcareeroptionsispotentiallyavailableto Stockholm universities. third yearstudyingabroadatExeter, Bordeaux,Paris,Utrechtor There areopportunitiesforstudentstospendallorpartofthe examination isused. A combination ofcontinuousassessmentandend-of-year number ofmodulesoutsideGeographyintheirSophisteryears. and fourth) years, see page 149. Students may also opt to take a For detailsofmodulesintheJuniorandSeniorSophister(third The Sophisteryears n Tel: +3531896 1576 www.tcd.ie/Geograph includes afieldworkcomponent. the collectionandanalysisofgeographicaldatamodulewhich and systems.Researchskillsaredevelopedfurtherthrough and tonaturalhuman-modifiedenvironmentalprocesses issues relatingtocultural,economicandhistoricalgeography, The SeniorFreshman(secondyear)geographymodulescover allocated classtime. subjects. Certainpracticalexercisesarecompletedoutsidethe Participation inlecturesandseminarsislinewithother TSM Further information Career opportunities Study abroad Assessment n Did youknow? considering thenatureofdevelopment. the emergent‘blackholesofglobalisation’,aswell including therealitiesoflivingina‘shrinkingworld’ and human well-being.Italsoexaminesaspectsofglobalisation processes generatingvariationsandchangesinlevelsof the socio-spatialstructureofworldeconomyand Human: introducesthesubjectsofglobalurbanisation, documentaries aspartoftheirassessed work. Mallorca andZambia,inmakingdigitalvideo students havebeeninvolvedinfieldworkIceland, Geography In recentyears,Sophisteryear y a theatregroup, debating,andfilmevenings. department withawideextra-curricular programmeincluding optional subjects. All thisinasmall,friendly, award-winning to developspecialistinterestsby choosingfromawiderangeof countries andthelinguisticsof German. You willbe encouraged as literature,history, cultureandsocietyoftheGerman-speaking and methodsofresearch,description andanalysisinsuchareas and fluencyinGermanlanguagetodevelopreadingskills course you have the opportunity to acquire advanced competence When studyingGermanwithinthetwo-subjectmoderatorship exciting andchallenging. very muchsotoday. All thesefactorsmakestudyingGerman German writingandthoughtsincetheearliesttimes,remain engagement withtheseexperienceshavebeencentralto society andcultureincountlessways.Reflectiononcritical dynamic andtroubled,thishistoryshapesthecontemporary in Europeandtheworld.Germany’s historyhasbeenrich, past andaboutitspolitical,socialeconomicresponsibilities ethnically diverse,andengagedinlivelydebateaboutitsown Modern Germanyisasocietyintransition,moreand and islikelytomakeyouhighlyemployable. level is,therefore,anexcellentpreparationfortheworldofwork increasingly integratedEurope.StudyingGermanatanin-depth link betweeneastandwestthelargesteconomyinan Contemporary Germanyisthegeographicalandcultural German isspokenbysome100 millionEuropeans. Is thistherightcourseforyou? Why studyGerman? TR086: BusinessstudiesandGerman,page41 TR039: Computerscienceandlanguage,page120 Polish/Russian orSpanish,page64 TR024: Europeanstudies–GermanwithFrench/Italian/ TR019: LawandGerman,page90 See also: page 36. both subjects.ForsubjectsthatcombinewithGermansee a jointhonorprogramme. An honorsdegreeisawardedin the two-subjectmoderatorship(TSM)programme. TSM is course. Itmustbecombinedwithoneothersubjectwithin German (TSM)cannotbestudiedasasinglehonor Advanced GCE(A-Level) Leaving Certificate Special EntryRequirements: TSM points: DEGREE AWARDED: POINTS 2011: PLACES 2012: COURSE CODE: German
HC1 Grade C See page27 B.A. 415-535* 32 TR001 (TSM) German German
Arts, Humanities and Social Sciences 71 TSM German and Economics; Associate Associate Economics; and German TSM Trinity College’s Department of Germanic Studies College’s Trinity has won four prestigious awards in recent years: for Languages (2005, 2010), Award The European the Kuratorium award of German-Irish Chamber of Industry and Commerce (2007) and the Ireland Fund of Germany Prize (2008). Peer tutoring and a networking website offer We graduates our with up link can you where ‘GradLink’ from all over the world and learn from their experiences. If you are considering studyingwant to be German, but sure, you are welcome to sample some lectures in may also You the department during teaching terms. discuss your options with a member of the teaching Contact us by e-mail or phone (see below). staff. Did you know? n n n Graduate Profile Susan O’Malley, Ireland Advertiser Operations with Google Global Manager, College since I had always Trinity “I chose German at and history been fascinated by German cultural studies which would and wanted to take a broad range of courses was also staff stretch my thinking; the excellence of the The critical thinking, an important factor in my decision. TSM degree the research and communication skills which invaluable in my helped me to develop have since proven I attended the University of Potsdam during my career. in media, year abroad and because of my strong interest internship technology and advertising, I completed an After graduating, I joined with KPMG prior to graduating. online advertising Google and worked in the company’s on industry solutions. From this, my role moved to focus operations. analysis and business planning for the Dublin policy and communications I currently work in a strategy, the company’s role. I’ve also spent some time working at global headquarters in California.” Further information Career opportunities Career s www.tcd.ie/Germanic_Studie E-mail: [email protected] + 353 1 896 1373 Tel: People with languages degrees are found up to senior level in are found up to senior languages degrees People with the only not value Employers careers. rewarding of kinds all le but also their ‘transferab of German graduates, language skills and confidence and creativity, skills’: the mix of accuracy maturity, the and linguist, advanced the marks which sensitivity understanding that comes from engagingflexibility and broadened abroad. gained experience the from and culture another with working for employers such as Google,Recent graduates are IT, telecoms, in as well as Ireland Enterprise and Bank Deutsche Ireland, in universities and media, the service, public education, Germany is a major export destinationAmerica. Europe and North as being the second most important sourcefor Irish goods as well in competence Therefore, Ireland. for Investment Direct Foreign of a competitive advantage in the job market. German can give you M www.tcd.ie/Germanic_ advanced options that link undergraduate Literature and textual studies introduces you to key to reading and aspects of modern German literature and German. analysing literary and non-literary texts in provides an introduction to society, political Area studies provides an introduction to society, in modern Germany, current affairs and cultural issues and Austria and Switzerland. this builds on the written, oral this builds on the written, Language programme: at school and develops both and aural skills you acquired Your language learning in expression. fluency and accuracy developed e-learning programme is supported by a specially at it try website: departmental the on Studies/jfgermanlanguagewebsite/INDEX.HT Study abroad Assessment Course content Course In addition to your on-going language classes, the Senior In addition to your on-going language classes, German cultural Freshman (second) year introduces you to of the history (exploring topics such as the development militarism nation, the role of religion and religious difference, key thinkers of and pacifism, and Nietzsche and Freud as own special can also begin to develop your You modernity). from a range of fields of interest within the programme, choosing cultural or historical focus. linguistics, seminars with a literary, As a TSM German student, you must spend at least two months As a but in practice you are likely in a German speaking country, Options include typically an academic year. to spend longer, studying at a German university within an Erasmus or similar exchange programme in your second year or between third and fourth year (our links include Cologne, Göttingen and Konstanz, but you can also make individual or taking a year arrangements), out to work in a company or as a language assistant in a school. At all levels, you will be assessed by a combination of project and and project of combination a by assessed be will you levels, all At examinations. aural and oral written, end-of-year and work essay Senior Sophister students also write a dissertation. If you elect to study German in your Senior Sophister (fourth) If you elect to study German in your Senior interests is year the scope for developing these specialist extended through study to the research expertise of staff. In the Senior you will also research and write a dissertation Sophister year, This can be drawn from literature, on a topic of your own choice. intercultural communication or some other aspect of the course that you have particularly enjoyed and is an exciting opportunity to develop your interests in depth. The Sophister years language alongside your In the Junior Sophister (third) year, history of German classes, you will follow a module in the social in specialist literature and choose from a number of seminars historical studies. areas of literature, linguistics, cultural and n n n The Freshman years The Freshman in the of classes per week approximately 10 hours There are key areas: The course covers three year. Junior Freshman (first) 72 Arts, Humanities and Social Sciences studying withus. the latesttechniquesandmethodsofhistoricalresearchwhile possible criticalindependenceamongstudents–whoencounter you. Historyat Trinity Collegeaimstoencouragethegreatest the developmentofnewideasaboutourpast,thiscourseisfor perspectives onhistoricalinterpretationsandinworkingtoward critical If ourpast,indeveloping you areinterestedindiscovering researched dissertationisakeyelementofthefinalyear. in researchontopicstaught. An independentlyconceivedand available. Teaching isledbyaworld-class staff activelyengaged (the Sophisteryears)averywidedegreeofchoiceismade small grouptutorials.Inthesecondpartofprogramme of relevanceandwedosoinlecturesourrenowned introduce youtosocial,political,economicandculturalthemes Irish history, withoptions in American and Asian historytoo.We we provideyouwithasystematicknowledgeofEuropeanand pedagogical andintellectualprinciples.Inthefirsttwoyears The Historyprogrammeat Trinity hasbeenconstructedonclear Course content Is thistherightcourseforyou? TR028: Ancient andmedievalhistoryculture,page74 TR027: Irishstudies,page82 TR012: Historyandpoliticalscience,page75 TR009: Musiceducation,page97 TR001: TSM, page36 See also: intense thanthatofthesinglehonorprogramme– TR003. cover alltheprincipalareasofhistory, theworkloadisless but while TSM, andHistoryPoliticalsciencestudents All Historystudentsselectmodulesfromthesamelists For subjectsthatcombinewithHistoryseepage36. programme. An honorsdegreeisawardedinbothsubjects. moderatorship (TSM)programme. TSM isajointhonor combined withoneothersubjectwithinthetwo-subject TR001 –History(TSM)Inthiscourseis for fouryears. depth History isstudied,analysedandwritteninincreasing TR003 (singlehonorHistory)– This isacoursewhere TSM points: DEGREE AWARDED: POINTS 2011: PLACES 2012: COURSE CODE: History See page27 B.A. 445* 38 TR003 485*-540 40 TR001 (TSM) n n n n n n n n n n n n n study requirementfortheacademicyear: options fromtheareasoutlinedbelow, amountingtohalftheir Students inthe TSM (jointhonor)programmetakehalf-year for theiracademicyear: areas outlinedbelow, amountingtothewholestudyrequirement Single honor(TR003)studentstakehalf-yearoptionsfromthe The JuniorFreshman(first)year n n n n n n n n n n n n n n equivalent). Moderatorship (TSM)studentsselectthreemodules(or students selectsixmodules(orequivalent),while Two Subject Each modulerunsforhalfoftheacademicyear. Singlehonor You maychoosefromawidevarietyofmodules, listedbelow. The SeniorFreshman(second)year: www.tcd.ie/history andwww.tcd.ie/Broad_Curriculum For furtherinformationaboutthese modulesseeourwebsite for oneoftheirhistorymodules: Students maysubstituteoneofthefollowingyear-longmodules Broad_Curriculum must enrollontheBroadCurriculumwebsite: electives–Studentschoosingthisoption Modern language South Asian history: An introduction American history: A survey Politicaltraditions Britain since1815: belief Europe, c.1500-1700:Powerand kingship Britain, c.1296-1603:Nationsand GaelicrevivalandtheEnglishPale Ireland, 1250-1500: Conflictofchurchandstate Europe, 1000-1250: anddomination Britain, c.1066-1296:Conquest BrianBorutotheEnglishinvasion Ireland, 1000-1250: Crusades WarEurope, 1000-1250: andsocietyintheageof Interpreting history Doing history The economy ofIrelandThe economy History ofpoliticalthought Themes inmodern American history The riseandfalloftheBritishEmpire Ireland inthe Twentieth century Europe since1914:Cataclysmandrebirth Grandeuranddecline Europe, 1870-1930: Ireland andtheunion,1801-1922 politics Cultureand Europe, 1700-1815: Ireland transformed,1641-1815 1534-1641 Ireland andtheearlymodernage, The Hundred Years War, c.1337-1453 deathandculture Europe, c.1215-1517:Religion, Ireland, c.400-1000 VikingsAnglo-Saxons, impactonBritainand andtheir www.tcd.ie/ Arts, Humanities and Social Sciences 73 Trinity College teaches political, military, social, College political, teaches military, Trinity economic, cultural and intellectual history; it specialises in the histories of several countries – America; and it Ireland, Britain, France, Germany and Areas topics too. Asian African and modules in offers of study range in chronological breadth from the Ages to the contemporary period. Middle College Dublin is ranked 38th in the world in Trinity University Rankings 2011). History (by the QS World Writing the history of the Irish revolution the history Writing Literature and politics in modern Ireland 1920s and 1930s Ireland in the Ireland in twentieth-century Popular culture American politics and culture, 1939-1989 Asia since 1947 South and duringAmerica the Cold War Ireland, Britain and beyond, 1948-1998 1968-1998 Troubles, The Did you know? n n Career opportunities Further information Assessment Study abroad Over many decades History graduates (single honors and Over many decades History graduates (single a wide range of TSM) have pursued successful careers in advertising, banking, These include: accountancy, areas. human broadcasting, cultural, arts and heritage administration, public relations, public administration, resources, journalism, law, management, marketing, publishing and teaching. y www.tcd.ie/histor +353 1 896 1791 / 1020 Tel: n n n n n n n n Assessment of essay- and exam-based. Assessment is primarily accounts for one third of the final-year the final-year dissertation mark. agreements The Department of History has Erasmus exchange Italy and the United with universities in France, Germany, American and with Kingdom, as well as exchange programmes Australian universities.
these are broader thematic and analytical these are broader thematic these are primarily historiographically-based these are primarily historiographically-based these are primary source-based specialist primary source-based these are France since 1880: Society and culture American thought since 1880 Race and ethnicity in 1 on Ireland and Britain War The impact of World 1912-1920 War, France and the First World Republic The Weimar Eighteenth-century Dublin Ireland and Empire History writing in Britain and Ireland, 1820-1920 American history Slavery in Africa since 1875 Sub-Saharan From rebellion Cromwellian to restoration: Confederate and Ireland The nobility in early modern Ireland Revolutionary Britain, 1678-1715 Ireland in the age of O’Connell, 1775-1847 The French Revolution Medieval religion, c.1215-1517 Renaissance Florence, c.1347-1527 Europe reformed, 1540-1610 The Elizabethans and their world, 1550-1610 The fall and rise of France, 1550-1700 Viking raiders to crusader warriors: Scandinavia, 800-1200 Viking The archaeology of medieval warfare, 1000-1300 Empire and papacy in the eleventh century The English in medieval Ireland 1286-1328 Edward I, Edward II and the conquest of Britain, The reign of Charlemagne Dublin Viking n n n n n n n n n n n n n n n n n n n List I, II and III modules arise from the specialisations of the List I, II and III modules arise from the specialisations Current options and vary from year to year. teaching staff include: n n and II, plus ‘Thinking history’, in their Junior Sophister (third) and II, plus ‘Thinking history’, in their Junior the same pattern as single TSM students normally follow year. honor students in the Senior Sophister year. n n n n n n Those studying TSM History choose one module from Lists I Those studying the Senior Sophister (fourth) year. The research dissertation the Senior Sophister (fourth) year. is undertaken in the Senior Sophister year. List II modules – List III modules – honor History choose one module from Those studying single plus the module Sophister (third) year, each list in their Junior choices follow from List I and III in ‘Thinking history’. Further modules which involve intensive research and writing. involve intensive modules which relate to the concepts, methods and special subjects which historians. debates of modern-day a combination of primary materials and modules based upon secondary commentaries. List I modules – List I modules The Sophister (third and fourth) years (third The Sophister categories: within three different a range of subjects offer We 74 Arts, Humanities and Social Sciences then thistooisthecourseforyou. political issueshavebeenconfrontedbysocietiesinthepast, a particularcuriosityaboutthewayinwhichcultural,socialand it istoday, thenthiscoursewillbeofinterest. Also, ifyouhave If youwanttounderstandhowEuropebeganbecomewhat the documentarysourcesintranslation. appraise criticallytheartandmaterialcultureofperiod an interdisciplinaryapproachtoyourstudies,aswell events, issuesandmentalities. You willbeencouragedtopursue the ancientandmedievalworlds,familiarisingyourselfwithkey intensive studyoftheart,archaeology, cultureandhistoryof you willbeabletotracethisextraordinaryprocessthroughan to themedievalworld(2000B.C.-1500 A.D.). Inthiscourse Europe byfocusingonthefascinatingtransitionfromancient opportunity toinvestigatetheculturalandpoliticalgenesisof Ancient andmedievalhistorycultureoffers youaunique week dependingontheoptions chosen. there areapproximatelytwelve hours oftimetabledstudyper dividing yourtimeequallybetweenthethreedisciplines.Intotal, courses in Ancient history, Art historyandMedievalhistory, In theJuniorFreshman(first)yearyouwilltakeamixtureof The JuniorFreshmanyear hope lively)discussionandindependentresearch. specialised, withanincreasingemphasisonintensive(butwe studies progress,yourcoursesbecomemorethematically by amixtureoflecturesandtutorialdiscussiongroups. As your disciplines willbeintroducedtoyouinfirst-yearcourses,taught their art,architecture,archaeology, cultureandhistory. These of theancientandmedievalworldsthroughananalysis Over thefouryearsyouwilldevelopabroadunderstanding Course content Is thistherightcourseforyou? Course overview TR012: Historyandpoliticalscience,page75 TR003: History, page72 TR001: TSM, page36 See also: DEGREE AWARDED: POINTS 2011: PLACES 2012: COURSE CODE: history andculture medieval and Ancient B.A. 415 15 TR028 the possibilityoftakingafieldtripmodule. Renaissance; andMedievalreligion,c.1215-1517. There isalso Florence, c.1348-c.1527;PaintingandsculptureintheItalian Art inthe Age ofChivalry; The Hundred Years War; Renaissance Charlemagne; The Crusades;Romanesqueartandarchitecture; Roman archaeology;Britain;Viking raiders; The reignof offered includes: The Aegean Bronze Age; Greekarchaeology; each ofthethreemainsubjectareas. The selectioncurrently The remainingmodulesmustincludeatleastonemodulefrom on Rome, which is taught by specialists from all three disciplines. In theirthirdyearallstudentstaketheinterdisciplinarymodule medieval history, Latin,architecturalhistoryandarchaeology. disciplines –includingpossibilitiesinIrish,BritishandEuropean The remainingmodulesmaybetakenfromanyofthethree culture; GreekhistoryorRomanimperialhistory;Medievalart. compulsory modules:Europe,1250-1500:Religion,deathand In thesecondyearallstudentsarerequiredtotakethree The secondandthirdyears n n n 1048-1169; Medievalwarfare;and the Art ofSanctity. Empire andpapacyintheeleventhcentury;NormanConquests spectacle intheancientworld;HellenisticKingsandCities; Hellenistic andRomanEgypt;Cyprus:Entertainment of coursesacrossthedisciplines.Offerings currentlyinclude that particularlyintereststhemortomaintainabroadbase modules taken,studentsarefreetospecialiseinanarea you andtodevelopindependentresearchskills.Oftwofurther both toinvestigatethoroughlyanareathatparticularlyinterests dissertation onatopicoftheirchoice. This givesyouachance In theirfourthyearallstudentsarerequiredtowritea The SeniorSophister Year of themedievalworld–includingCrusades. importance ofkingsandkingdoms,themanyconflicts cultural developmentsoftheperiod,includinggrowing 1000 and1250,coveringthekeypolitical,social a surveyofEuropebetween Medieval historybeginswith Book ofKellsin TCD itself. cathedral ofChartresinFrance–butnotforgettingtoo The from themosaicsinItaliancityofRavennatogreat and architecture. You willbeintroducedtotopicsranging sculpture Art historysurveyskeydevelopmentsinpainting, language optionforthosewhowishtolearnLatin. the mythsandreligionsofancientworld. There isalsoa colonisation; thesocialcontextofartandarchitecture; Rome’s emergenceasanimperialpower;war, conflictand Topics coveredincludethe Athenian inventionofdemocracy; Roman art,archaeology, architecture,historyandmythology. Ancient history introduces key aspectsofGreekand introduceskey
Arts, Humanities and Social Sciences 75 e TR012 24 505* B.A.
History and political science CODE: COURSE PLACES 2012: POINTS 2011: AWARDED: DEGREE of the following can also study history through one You to the degree of B.A: programmes, all leading (joint honor programme) History in TSM TR001: other subject. For subjects that combination with one see page 36. combine with History page 72. course in history, TR003: Single honor political science through several other can also study You programmes, see page 101. See also: Ancient and medieval history and culture, page 74 TR028: Further information Assessment Study abroad Career opportunities Course overview www.tcd.ie/Political_Science/undergraduat +353 1 896 1651 Tel: y www.tcd.ie/histor +353 1 896 1020 Tel: A combination of essays, assignments and end-of-year A examinations make up the assessment process. Both the Political science and History departments have arrangements allowing students to study abroad in another Participating in university for a semester or a full academic year. these opportunities is dependent upon the exchange fulfilling the course requirements of both departments. Recent graduates are pursuing careers in government and the media, accountancy and business to name a few. public sector, Some graduates each year progress to further study in areas as business, and design graphic production, film medicine, as diverse as well as areas more closely related to history and political science. History and political science have a close affinity and the History and political science have a close interests. provides a combination of the two in a joint honor programme interdisciplinary of development the for framework coherent subjects both take will you programme, the of years three first the In choose to you may on an equal basis. In the fourth year, or to continue with concentrate exclusively on either subject There are approximately 10-12 hours of classes per week both. for course details. in the Freshman (first two) years. See below l Further information Career opportunities Study abroad Assessment www.histories-humanities.tcd.ie/undergraduate/ancient-medieva Graduates in the disciplines studied on the course have entered including an exciting variety of fields after leaving university, art restoration, business, advertising, archaeology, accountancy, civil service, diplomatic corps, heritage and museum work, human resources, journalism, management, publishing and teaching. Several others have progressed to postgraduate study America. at universities across Ireland, Europe and +353 1 896 8589 Tel: Trinity College maintains a wide range of international links College Trinity with universities across Europe – from France to Cyprus. Many foreign universities now teach courses in English too, and through the Erasmus exchange programme it may be possible to spend the Senior Freshman (second) year abroad. A combination of end-of-year examination and continuous A and team assessment (e.g. essays, seminar presentations a dissertation is projects and commentaries on texts), and written in the final year. 76 Arts, Humanities and Social Sciences n n n n n n n n n n n n n n n n including: More than35modulesareavailableintheSophisteryears(threeandfour) fourth yearchoosethreespecialmodules,andwriteadissertation. particular attentiontooriginalsources.StudentstakingHistoryalonein and choosespecialmodules,whicharestudiedingreatdetailwith In thefinaltwoyearsyouwilltakeashortlecturemoduleonhistoriography n n n n n n n n n n n Senior Freshmen(second-yearstudents)selectfromcoursessuchas: n n n n n n n n n n History modules Junior Freshmen(first-yearstudents)selectfrommodulessuchas: their secondyearstudentsmaysubstituteelectivesforoneofthehistorymodules(seeBroadCurriculum,page14). their first-yearstudentsmaysubstitutemodernlanguageelectives(twocourses)foroneofthesecourses,whilein In eachofthefirsttwoyearsstudentstake3Politicalsciencemodulesandequivalentnumberterm-longinHistory of different ways. overall characterofyourstudies,andpermityoutospecialiseinanumber Modules aredesignedtoallowyourindividualpreferencesshapethe
The Troubles, 1968-1998 Britain, theNearEastandWorld War 2 Society Stalinism and Sub-Saharan Africa since1875 The FrenchRevolution Britain,1678-1715 Revolutionary The impactofWorld War 1onIrelandandBritain FirstWorldFrance andthe War, 1912-1920 1775-1847 age ofO’Connell, Ireland inthe Britain,1678-1715 Revolutionary Ireland Cromwellian Confederate and 1550-1610 andtheirworld, The Elizabethans 1540-1610 Europe reformed, Edward I,IIandtheconquestofBritain,1286-1328 The crusades ofmedievalwarfare The archaeology VikingsAnglo-Saxons, impactonBritainandIreland,c.400- andtheir Themes inmodern American history The riseandfalloftheBritishEmpire Twentieth-century Ireland andrebirth 1914: Cataclysm Europe since and decline Grandeur Europe, 1870-1930: politics Cultureand Europe, 1700-1815: deathandculture Religion, Europe, c.1215-1517: widerworld,1641-1815 Ireland andthe widerworld,1534-1641 Ireland andthe union,1801-1922 Ireland andthe South Asian history: An introduction American history: A survey Britain since1800 belief Powerand Europe, c.1500-1700: kingship Nationsand Britain, c.1296-1603: andtheEnglishPale Gaelicrevival Ireland, 1250-1500: churchandstate Conflictof Europe, 1000-1250: anddomination Conquest Britain, c.1066-1296: totheEnglishinvasion BrianBoru Ireland, 1000-1250: WarEurope, 1000-1250: andsocietyintheageofCrusades 1000 n n n n n n Junior Freshmen(first-yearstudents)take: you withasystematicfoundationinthesubject. The workofthefirsttwoyearsisdesignedtoprovide Political sciencemodules n n n n n n n n n n n n subject, including: choose toconcentrateonparticularaspectsofthe In theSophister(thirdandfourth)years,youmay Senior Freshmen(second-yearstudents)take:
Comparative politics Comparative International relations History ofpoliticalthought economicpolicy Introduction to sociology Introduction to politicalscience Introduction to Globalisation and the post-cold warorder and thepost-cold Globalisation inequality The politicsof UnitedStates politicsofthe Government and African politics internationalrelations Contemporary politics European Union Democracy anddevelopment Issues incontemporarypolitics Political parties politicaltheories Contemporary political institutions Comparative Irish politics . In Arts, Humanities and Social Sciences 77 Sources and evidence in history and archaeology – an Sources and evidence in history and theories introduction to the materials, methodologies This course employed by historians and archaeologists. analytical is specially designed to develop the practical, The evidence. and critical skills required to assess ancient which focus on course mixes lectures with smaller seminars discussion and hands-on work with artefacts. – an introductory survey of the – an introductory survey Greek and Roman history Archaic age to the from the Greek Greek and Roman world as The course covers topics such early Roman Empire. invention of democracy, Athenian the politics and power, of Rome as a major the emergence Alexander, the rise of war and conflict. colonisation, imperial power, and architecture – an introductory Greek and Roman art and major artistic achievements survey of the development art The course places and painting. in architecture, sculpture social and political context; it focuses and architecture in its use of narrative and mythology in art, on themes such as the forms urbanisation, and on the development of architectural such as temples, theatres and Roman baths. The second and third years the opportunity Courses in the second and third years offer the history and to focus on specific themes and periods in a deeper awareness archaeology of the Mediterranean, develop discuss key themes of relevance to both of methods and theory, with artefacts. Over the ancient and modern world, and to work archaeology and the two years you will study topics in: Greek Roman archaeology Age archaeology, Aegean Bronze history, and History and archaeology of Roman Britain. and history, work or an There are also options to do practical archaeological approved study tour to the Mediterranean in place of a taught by lectures and All the courses are taught course in these years. small-group seminars. In the Greek archaeology and history courses you explore major themes such as colonisation, empire, the emergence of literacy, religion, and social issues such as war and ideology, slavery, These courses range in time from gender and death. sexuality, Athens and the development of the Greek city-states, such as Sparta, to the Hellenistic kingdoms founded in the wake of Age course takes you back in time to the The Bronze Alexander. early palatial civilisations of the Minoans and Mycenaeans. Augustus to In Roman history you will study imperial history from the emperor Constantine, examining the period from a number of perspectives, from the emperors themselves to the lowliest of slaves, and ranging from imperial politics and military strategy, to economics and social concerns such as religion and rebellion. Roman archaeology takes you the length and breadth of the Roman world, exploring cities and urban life, frontiers and the In the Roman Britain trade, transport and technology. army, course you will assess the impact of Roman culture on Britain as a remote Roman province and consider issues such as imperialism, acculturation and identity. The Junior Freshman year Freshman The Junior courses – you will take three Freshman (first) year In the Junior of classes in the six hours There are approximately see below. year. Junior Freshman n n n TR001 (TSM) 23 390*-535* B.A. See page 27 archaeology CODE: COURSE PLACES 2012: POINTS 2011: AWARDED: DEGREE Ancient history and and history Ancient See also: page 72 TR003: History, 75 TR012: History and political science, page Ancient and medieval history and culture, page 74 TR028: TSM points: cannot be studied as a Ancient history and archaeology single honor course. with one other subject within the two- It must be combined TSM is a joint (TSM) programme. subject moderatorship in both An honors degree is awarded honor programme. subjects. Ancient history and For subjects that combine with archaeology see page 36. Course content Is this the right course for you? Course overview Over your four years you will develop a broad understanding of moving the ancient world through its history and archaeology, to more focused from introductory courses in the first year, thematic topics in the second and third years, and choosing from The course is a range of specialised options in your final year. taught through a mixture of lectures, practical classes and small- group seminars, which encourage lively discussion and the development of independent thinking. You will enjoy this course if you are interested in studying You the history and culture of the Greeks and Romans – their achievements and their profound influence on the modern world – through the complementary study of history and archaeology. Ancient history and archaeology are both concerned with Ancient history and archaeology are both experience in understanding social, political and cultural you the opportunity to range This course offers the past. Greek will study the You across these two broad disciplines. and literary and Roman worlds by working with historical of ancient sites and documents alongside the material remains relationships also explore Greek and Roman You artefacts. and the Near East, with neighbouring cultures, such as Egypt There are opportunities within the Mediterranean and beyond. to participate in archaeological fieldwork and in study tours and no All material is studied in translation to classical sites. knowledge of Greek or Latin is required. 78 Arts, Humanities and Social Sciences used andathesisiswritteninthe finalyear. projects, artefactstudiesandshort commentariesontexts)is assessment (e.g.essays,seminar presentationsandteam A combinationofend-of-yearexamination andcontinuous great depthanareathatparticularlyinterestsyou. ideas andacquirecriticalskillswhileinvestigatingin independent an opportunitytodoresearchwhichwillallowyoudevelop You willalsowriteathesisonsubjectofyourchoice. This is Mediterranean; Anthropology andtheGreeks. in theGreekandRomanworlds;Goddessesofancient Jews ofPalestine; Ancient Cyprus;Entertainmentandspectacle the ancientworld; The cityofRome; Athens and Attica; The a rangeonoffer. Coursesoffered recentlyincludeEthnicityin final yearyouwillbeabletochoosetwospecialsubjectsfrom If youdecidetostudyancienthistoryandarchaeologyinthe The SeniorSophisteryear Assessment Ireland orabroad. in historyorarchaeologybeginningwithpostgraduatestudy year someofourgraduatesalsoopttopursuearesearchcareer museum work,business,accountancyandsocialwork.Each teaching andhighereducationpolicy, publishing,heritageand archaeology, heritageandmuseumwork,artrestoration, Recent graduateshaveenteredmanyfieldsincluding Freshman (second)yearabroad. Cyprus. This allowsstudentstheoptionofspendingtheirSenior programme withuniversitiesinFrance,Switzerlandand abroad, includingactiveparticipationintheErasmusexchange Trinity Collegehasstronglinkswithmany Classicsdepartments Tel: +35318961208 E-mail: [email protected] www.tcd.ie/Classics Career opportunities Study abroad Further information Graduate Profile n Did youknow? their subjectsandpassedontous.” professionalism andenthusiasmdisplayedbythestaff for this yearwithinourundergraduatedegreebutalsotothe give creditforthisnotonlytotheopportunityofhaving ever thoughtwhenleavingsecondaryschool.Iwould personal researchforthethesismorefunthanIprobably based aroundseminarsinsteadoflecturesandmyown of learningresearchtechniquesIhavefoundthisyear been withoutdoubtmyfavouriteyear;afterthreeyears year forbothmycoursesandthesis.Fourthhas me forthemorethoroughresearchnecessaryinfourth my ownresearch,inhindsighttheycertainlyprepared were someweeksImaynothaveenjoyedhavingtodo to sitanddiscussideasmoreinformally, andwhilethere second andthirdyearparticularlyenjoyableforbeingable daily lifeoftheancientworld.Ifoundseminarsin understanding ofnotonlythelargerhistorybutalso archaeology, allowingus,asstudents,tohaveafuller a goodbalancebetweentheliterarysourcesand found thecoursecontentof AHA programmetohave department seemedtobeexactlywhatIwanted.have Trinity College’s campusandthecoursesoffered bythe particularly attractivetomebecauseIhavealwaysadored “The DepartmentofClassicsin Trinity Collegewas Aoife Condit, course in Ancient historyandarchaeology. Trinity inIrelandtooffer istheonlyuniversity College a postgraduate inClassics, TCD Arts, Humanities and Social Sciences 79
The art and architecture of the medieval church, c.100-1220 The art and architecture of the medieval church, Age of Chivalry c. 1150-1350 Art in the Painting and sculpture in 17th-century Europe Painting and sculpture in the Italian Renaissance early modern City court & Campagna: the foundations of architecture Architecture in the 19th and 20th centuries 18th century painting in Britain and Ireland Art in France 1850-1900 Themes in Northern painting Modernism and post-modernism The arts of Japan Approaches to art history and criticism Asia History and culture of South Art in Ireland: making and meaning These courses comprise a weekly lecture and a seminar in alternate weeks. n n n n n n n n n n n n n n The special subject If you elect to study History of art and architecture in the Senior dealing with you will select a subject Sophister (fourth) year, art-historical issues at a more specialised level. Where possible, you will be given the opportunity of studying primary sources and particular emphasis is placed on personal observation and interpretation of original works of art, whether painting, sculpture or architecture. Examples of special subject topics include Saints and sanctity in Medieval Europe, Irish architecture and Art and religion in the Hispanic World, ornament 1700-1830, Painting in Ireland and Britain c1800-1900: artists, institutions and audiences, and Irish modern and contemporary art. The Junior Freshman year Freshman The Junior you will take modules Freshman (first) year In the Junior art and aspects of Western introduction to various providing an Art history. of and to the practice architecture, periods covering major a historical survey, As well as providing and French Impressionism, the such as the Italian Renaissance you to the methods and techniques of art course will introduce of paintings, sculpture, These include the critical analysis history. artefacts, the importance of iconography, manuscripts and other from the technical methods used by artists and the different day. Book of Kells to the present you with the knowledge and skills The course also provides and appreciate architecture. It includes needed to understand building materials and architectural an examination of different of buildings. drawings as well as training in the visual analysis of Western These topics are part of a historical survey to modernist architecture, which ranges from Greek temples building types structures. Special attention is given to important house. such as the medieval monastery or the country two, three and four Years Junior and Senior Over the course of the Senior Freshman, to take courses Sophister years, you will have the opportunity in the following areas: TR001 (TSM) 40 390*-540 B.A. See page 27 architecture CODE: COURSE PLACES 2012: POINTS 2011: AWARDED: DEGREE History of art and See also: page 72 TR003: History, 75 TR012: History and political science, page Ancient and medieval history and culture, page 74 TR028: TSM points: (TSM) cannot be studied History of art and architecture It must be combined with one as a single honor course. two-subject moderatorship (TSM) other subject within the An honors TSM is a joint honor programme. programme. both subjects. degree is awarded in art and For subjects that combine with History of architecture see page 36. Course content Is this the right course for you? Is this the right course for Trinity College offers excellent facilities for the study of history offers College Trinity of art and architecture and its own distinguished buildings and The National Gallery collections are integral to the programme. of Ireland and National Museum are located nearby and provide the venues for group and teaching activities. Other institutions the Chester Beatty Art and such as the Irish Museum of Modern As a student, you will be expected to Library are also used. become familiar with various collections and buildings in Dublin. You will take a broad range of modules covering the history of You painting, sculpture and architecture from antiquity to modern available include Irish art, the art of the Italian Topics times. the architectural Renaissance, art in the age of chivalry, splendours of the Georgian era and the artistic achievements of There are also modules on non-Western the twentieth century. art, such as the arts of Japan and India. This course teaches you how to analyse works of art and how to understand their historical significance. It will enable you to develop an awareness of the environment while also providing you with a deeper sensitivity to the culture and ideals of other regions. History of art and architecture appeals to a wide range of History of art and architecture appeals to in visual art, students, as well as those with special interests way provide you with an effective It will archaeology and history. the critical and of developing intellectual rigour and of acquiring with an arts degree. communication skills traditionally associated any previous knowledge of art history or any do not need You practical skill in art to take this course. 80 Arts, Humanities and Social Sciences Tel: +35318961995 www.douglashydegallery.com www.tcd.ie/History_of_Ar architectural history. and media-basedemploymentoutsidethefieldofart as wellinabroadrangeofadministrative,commercial architectural heritageandjournalisminIrelandabroad, galleries, museums,publishinghouses,artsalesrooms, In recentyearsgraduateshavebeenemployedinuniversities, final-year dissertation. Assessment isbycoursework,end-of-yearexaminations,anda institution, youmustpossessthenecessarylinguisticfluency. be requiredtoattendlecturesinthelanguageofyourhost (second) yearaspartoftheErasmusprogramme. As youwill in France,Germany, ItalyorSpainduringtheSeniorFreshman and Florence.Inaddition,youmayapplytostudyatauniversity Cities visitedinthepastincludeParis,Madrid,Vienna, Rome Students havethechancetoparticipateinastudyweekabroad. Further information Career opportunities Assessment Study abroad n Did youknow? assists thecuratorinmanagingthiscollection. paintings andsculpture,astudentcommittee College. The Collegeitselfhasamajorcollectionof contemporary artgalleries,issituatedin Trinity Hyde Gallery,The Douglas oneofIreland’s leading t Medieval andModernWelsh inWales inyourthirdyear. publishing inthefieldandmayavailofoptiontostudy small classsizesandafriendlyatmosphere,workwithscholars manuscripts waswritten,thisisthecourseforyou. You willenjoy Medieval Irish,inwhichthegreatsagaliteratureofour If youareinterestedinacquiringareadingknowledgeof programme. programme orinthesinglehonorEarlyandModernIrish other subjectaspartofatwo-subjectmoderatorship(TSM) Early Irishcanbestudiedeitherincombinationwithone Is thistherightcourseforyou? Early Irishcomponent Leaving Certificate Special EntryRequirements: TSM points: TR027: Irishstudies,page82 TR013: Computerscienceandlanguage,page120 See also: Irish seepage36. For subjectsthatcombinewithEarlyIrishandModern subjects. programme. An honorsdegreeisawardedinboth moderatorship (TSM)programme. TSM isajointhonor studied withoneothersubjectwithinthetwo-subject In TR001 (TSM)EarlyIrishorModerncanbe TR022 –EarlyandModernIrishisasinglehonorcourse. (TR001/TSM) Modern Irish(MI)incombinationwithoneothersubject OR (TR001/TSM) Early Irish(EI)incombinationwithoneothersubject OR EITHER EarlyandModernIrish(TR022) Students maystudy: Advanced GCE(A-Level) DEGREE AWARDED: POINTS 2011: PLACES 2012: COURSE CODE: Irish (Early and ModernIrish)
B.A. 350 15 TR022 See page27 HC3 Grade C
465-505* 10 (TSM-EI) TR001 Irish Irish
390*-540 30 (TSM-MI) TR001 Arts, Humanities and Social Sciences 81 An Nua-Ghaeilge Ábhar an chúrsa Assessment Career opportunities An é seo an cúrsa duitse? Má bhaineann tú taitneamh as Gaeilge a labhairt, a scríobh Má bhaineann tú taitneamh as Gaeilge a a chur ar do is a léamh, agus más mian leat barr feabhais oiriúnach duit. Is í chumas sna réimsí sin, beidh an cúrsa seo Tá an-cháil ar an an Ghaeilge teanga oibre Roinn na Gaeilge. na mac léinn beag Roinn seo as a bheith cairdiúil. Bíonn líon léinn aithne a chur go leor le nach mbíonn sé deacair ag na mic Tá Cumann Gaelach na mac léinn an-ghníomhach ar a chéile. bhfuil an-tóir uirthi ar fad; tá scéim chónaithe lánGhaelach a i lár na sa Choláiste. San iomlán, is geall le mionGhaelacht príomhchathrach sinn. Is trí mheán na Gaeilge a mhúinfear do chúrsa. Foghlaimeoidh tú faoi gach gné den Nua-Ghaeilge: ón bhFiannaíocht sa 13ú haois go Máirtín Ó Cadhain agus Nuala Ní Dhomhnaill sa lá atá inniu ann. Cuirfidh tú go mór le do chumas i labhairt agus scríobh na Gaeilge, agus déanfaidh tú staidéar foirmiúil ar cheartúsáid na teanga. Beidh deis agat freastal ar léachtaí faoi: scéalaíocht na seanré, stair shóisialta na teanga, an béaloideas, filíocht na scol, an Fhiannaíocht agus an nualitríocht ar fad, .i. gearrscéalta, drámaíocht, úrscéalta, dírbheathaisnéisí agus filíocht. Caithfidh tú dhá mhí sa Ghaeltacht in Éirinn mar chuid de do chúrsa. Sainghné speisialta de chúrsa na Nua-Ghaeilge ná gur anseo amháin a bheidh seans Tríonóide i gColáiste na Ghàidhlig). agat trí bliana a chaitheamh le Gaeilge na hAlban (a’ Beidh seans agat, más mian leat, tréimhse a chaitheamh i nGaeltacht na hAlban freisin. Assessment is by exercises and essays submitted during the essays submitted during is by exercises and Assessment year you In the final as end-of-year examinations. as well year, and write a dissertation. will also research Irish pursue independent research in Some students of Early to teaching at third-level. Most follow the subject with a view journalism, especially Irish-language a career in teaching or archiving, the public service, marketing, related media. Library of and translation all figure in the profiles business, interpreting past students. le hábhar eile sa Is féidir Nua-Ghaeilge a dhéanamh i dteannta dteannta le Luath- Mhodhnóireacht Dhá Ábhar (TR001) nó i TR022). Sa dá Ghaeilge sa Mhodhnóireacht aon-onóra (EMI ar feadh trí bliana chóras seo déantar staidéar ar an dá ábhar don cheathrú agus roghnaítear ceann amháin den dá ábhar bliain. Bronntar céim onóra sa dá ábhar. Course content Course In the Sophister (third and fourth) years the horizons are In the Sophister (third and fourth) years the language will take expanded; your study of the history of the to the dawn of Modern you back to its Celtic origins and forward At this stage you will be reading prose and poetry as well Irish. and a special course as law and history in the original language, the manuscripts in palaeography will teach you how to read students may opt to themselves. Junior Sophister (third year) Aberystwyth learning Medieval and Modern spend a term in Welsh. The Sophister years The Freshman years of Old Irish. In the first two years you will study the basics but you will At this stage most literature is read in translation and you will see be introduced to the original texts gradually through the early how the language emerged and developed Christian period. The Early Irish course, which is taught through the medium taught through the medium Irish course, which is The Early its the Irish language from covers the history of of English, of the inscriptions at the dawn on the Ogam first appearance language to the highly polished century, Christian era in the fifth texts preserved in the medieval manuscript of the sagas and law Academy TCD, the Royal Irish libraries of collections held in the of the all within a five-minute walk and the National Library, of Irish will The Celtic and Indo-European origins Arts building. to know the great characters of will come You be investigated. including the tragic Deirdre, the doomed Early Irish literature, but irritable Cú Chulainn, the hopelessly Conaire, the irresistible and/ The Pagan and many more. infatuated Muirchertach of the literature will be investigated as or Christian character the heroic biography and the will topics such as kingship, sovereignty goddess. 82 Arts, Humanities and Social Sciences tseirbhís phoiblí,margaíochtagusgnófreisin. le gairmeachaéagsúlacosúilleisanleabharlannaíocht, agus lehaistriú. Tá iarmhicléinnleNua-Ghaeilgetaréisdul meáin Ghaeilgeachgoháirithe),cuiddíobhlehateangaireacht na macléinnlemúinteoireachtagushiriseoireacht(sna teagaisc agantríúleibhéalabhaintamach. Téann tromlach Déanann micléinnáirithetaighdesaNua-Ghaeilgechunpost déanamh agustráchtaslescríobh. ag deireadhnabliana.Sacheathrúbliain,bíonntaighdele scríobh gotráthrialta,agusbéaltriailscrúduithescríofa seachtain marchuiddenmheasúnúleanúnach;bíonnaistíle Bíonn argachmacléinncleachtaíscríofaadhéanamh nó nualitríochtGhaeilgenahAlban. Ghaeilge Mhoch,salitríochtbhéil,inualitríochtnaGaeilgeagus/ seanré. Inatheanntasin,déanfaidhtúroghacúrsaísaNua- léirmheastóireacht chriticiuiladhéanamharscéalaiochtna lámhscríbhinní aléamh(cúrsasabpailéagrafaíocht)agus níos airde,agusGaeilgenahAlban.Foghlaimeoidhtúconas scríofa, ancheapadóireachtagust-aistriúchánagleibhéal hábhair seoaleanas:ardscileannateanga,idirlabharthaagus Sa tríúbliainagussacheathrúbliain,díríonnancúrsaarna hAlban. Gaeilge, anGhaeilgeChlasaiceach,nualitríocht,Gaeilgena scríofa, ancheapadóireacht,t-aistriúchán,stairshóisialtana hábhair seoaleanas:scileannateanga,idirlabharthaagus Sa chéadbhliainagussadarabliain,díríonnancúrsaarna Tel: +35318961450 www.tcd.ie/Irish Further information Postanna Measúnú An tríúbliainagusanceathrú An chéadbhliainagusandarabliain n Did youknow? medieval period. Irish literatureandlearningtohavesurvivedfromthe of Leinster, oneofthemostimportantmanuscripts Trinity ishometothetwelfth-centuryBook College Strand B:IrishandHistory OR Strand A: English andHistory Teaching Councilforthefollowingsubjects: Irish Studiesisanaccredited degreeprogrammewiththe to theIrishstudiesprogramme. Students chooseonestrandonly(A orB)afteradmission A-level Irish. at leastagradeHC3inLeavingCertificateIrishorC modules. Applicants whowishtochoosethisstrandmustattain Strand B– This strandcontainsanumber ofIrishlanguage OR for Strand A. the mediumofEnglish. There arenospecialentryrequirements Strand A – All of thecoursesinthisstrandaretaughtthrough programme: Studentschooseonestrandonly(A orB) There aretwodistinct,separatestrandsintheIrishstudies demanding increasingflexibility. you ingoodsteadacompetitiveemploymentmarketthatis rich andrewardingeducationalexperience,whichwillstand you withaverydiverserangeofoptions,thusguaranteeing and American historyandliterature.Irishstudiesprovides the widerworld,includingspecificcoursesinBritish,European emphasis throughoutisontheinteractionbetweenIrelandand established subjectssuchasHistory, EnglishandIrish. The with aninterdisciplinaryeducationwhilestilltakingcoursesin experience theintegration,creativityandfreedomassociated study outsidethetraditionalacademicdisciplinesandto Drama. This programmeoffers auniqueopportunity to with thedepartmentsofGeography, Historyof Art andFilm/ the English,HistoryandIrishdepartmentsincollaboration This isanexcitinginterdisciplinaryprogramme,devisedby Course overview in Irishcivilisation An interdisciplinarycourse 62 TR023/001: Englishliteratureandstudies,page TR022/001: EarlyandmodernIrish,page80 TR003/001: History, page72 See also: See ‘StrandB’ intheCourseoverview, below. Special EntryRequirements: DEGREE AWARDED: POINTS 2011: PLACES 2012: COURSE CODE: Irish studies:
B.A. 375 20 TR027
Arts, Humanities and Social Sciences 83
in British, European and American history and literature. American history and in British, European and of English and History courses, including specific modules of English and History courses, including A Broad Curriculum course (see page 14) A An Ghaeilge: Ceart na teanga II Nuafhilíocht Nualitríocht Imagining Ireland I An Ghaeilge: Ceart na teanga I Cleachtadh teanglainne Nualitríocht Doing history/Interpreting history Ireland, c.1250-1500: Gaelic revival and the English Pale Ireland and the wider world, 1534-1815 Theorising Ireland Imagining Ireland II Imagining IrelandImagining III Broad Curriculum module (see 14) page A cartography History of Irish Nineteenth-century writing Irish Irish writing, 1890-1945 American literature History of the USA 20th century Europe Imagining Ireland IV Dissertation Students choose Sophister modules from an approved list OR 2. Irish: 3. 4. 5. Strand B (Irish-language strand) Strand B (Irish-language language modules. This strand contains a number of Irish 1) Junior Freshman (Year Interdisciplinary: 1. Irish: 2. 3. 4. History: 5. 6. 7. English: 8. 2) Senior Freshman (Year Interdisciplinary: 1. 1. 2. 3. English: 4. 5. 6. History: 7. 8. 4) Senior Sophister (Year Interdisciplinary: 1. 2. 3. Junior Sophister (Year 3) (Year Junior Sophister Interdisciplinary:
www.tcd.ie/courses/ of English) of English) Ireland Irish language the medium and literature II (taught through Ireland and the union, 1801-1922 Change & expectation: Socio-cultural history of 20th-century Irish writing in English 1590-1800 Theories of literature Introduction to postcolonial literature literature Victorian Irish language the medium and literature I (taught through Imagining Ireland II Doing history/Interpreting history Ireland, c.1250-1500: Gaelic revival Pale and the English Ireland and the wider world, 1534-1815 Imagining Ireland I Theorising Ireland Romanticism The novel Genre: Course content Is this the right course for you? the right course Is this Senior Freshman (Year 2) Senior Freshman (Year Interdisciplinary: Irish Dept: 8. History: 6. 7. 4. 5. English: 2. 3. 1. 8. 7. Irish Dept: History: 5. 6. 3. 4. 1. English: 2. Strand A (English-language strand) (English-language A Strand the medium All courses in this strand are taught through 1) Junior Freshman (Year Interdisciplinary: . Assessment throughout the four years consists Assessment throughout the four years irishstudies. will also You of both continuous assessment and examination. include: Courses write a dissertation in your final year. of English. There will be a mixture of compulsory courses in years 1-3 and of compulsory courses in years 1-3 and There will be a mixture allowing you to specialise in final year, optional courses in the developed particular interests. Course areas where you have on our website at details are available If you have an interest in the history, literature, and culture of and culture literature, an interest in the history, If you have this then context comparative interdisciplinary, broad, a in Ireland the of avail to encouraged are Students you. for programme the is College. Trinity opportunities provided by full range of academic on this programme have successfully For example, students chosen to TCD Foundation scholarship, and competed for the Erasmus programme in their third year. study abroad on the 84 Arts, Humanities and Social Sciences 4. Options: 3. Irish: 2. 1. Interdisciplinary: Senior Sophister(Year 4) 7. English: 6. 5. History: 4. 3. 2. Irish: 1. Interdisciplinary: Junior Sophister(Year 3) 8. 7. 6. History: Tel: +35318962626 E-mail: [email protected] www.tcd.ie/courses/irishstudies Durham, Queen’s University, Belfastandelsewhere. been acceptedontopostgraduateprogrammesin TCD, Oxford, of furthereducation,graduatesfromthiscoursehavealready media work,translationservices,publicrelationsetc.Interms administration, thecivilservice,diplomaticcorps,publishing, and History(StrandB)–aswelljournalism,artsheritage the Teaching CouncilforEnglish andHistory(Strand A), orIrish teaching –Irishstudiesisanaccrediteddegreeprogrammewith of theprogrammewillprovideadistinctadvantage;inparticular, range ofcareerdestinations,wheretheinterdisciplinarynature Graduates inIrishstudiescanexpecttoarriveatadiverse English: Further information Career opportunities Students choose Sophistermodulesfromanapprovedlist Students choose Ceapadóireacht Dissertation IV Imagining Ireland Irishwriting Nineteenth-century 20th centuryEurope History oftheUSA Prós naLinne An FhilíochtChomhaimseartha Ceapadóireacht An Ghaeilge: III Imagining Ireland English1590-1800 Irish writingin historyof20th-century Socio-cultural Change &expectation: Union,1801-1922 Ireland andthe British, Europeanand American history. of IrishandHistorycoursesincludingspecificmodulesin Ireland e in supportofthiscoursemakesIrishstudiesexceptional.” book aquestion. The expertisethatisavailableat Trinity undergraduate, torunupstairsandasktheauthorofthat read abookinthelibraryandtohaveoption,asan and areoftencourselecturers.Itistrulyremarkableto the leadingscholarsofIrishstudiesareonstaff at Trinity course, whichIbelieveisuniqueto Trinity, isthatmanyof academic challenge.Oneofmyfavouriteaspectsthis studied intandem.Itisanexcellentandrewarding thereby heighteningyourappreciationofmultiplesubjects on awiderangeoftopicswhileyoupursueyourstudies, Instead oflimitingyourselftoonesubject,youcanfocus and poetry, historyandlinguistics,geographyculture. study simultaneouslyacrossdifferent disciplines–politics of IrishStudies,asyoucanexploreseveralavenues nature ofthecourseisonemostamazingaspects you arestudyinginthelecturehall. The interdisciplinary significance, enablingyoutoexperiencefirst-handwhat allows easyaccesstositesofhistoricalandliterary language andcultureisauniqueexperience. The location in thecentreofDublinandstudyIrishhistory, literature, “Being abletoattendthepremieruniversityinIreland Jordan Followwill Student Profile Arts, Humanities and Social Sciences 85
e Study abroad Career opportunities Further information Assessment n www.tcd.ie/Italia +353 1 896 2062 Tel: E-mail: [email protected] a substantial dissertation on an agreed theme. minimum two-month stay in Italy will be required at some A This can be broken into time over the duration of your course. can also apply to spend your You convenient shorter visits. the Erasmus second year at a European university through have links with the Universities of Bologna, programme. We and Pavia. Trieste job Advanced language skills are sought after in today’s market – even here in Ireland, where many companies sell their products and services into Europe. Our graduates end up in all public administration, import-export, kinds of jobs: business, law, corporate writing, journalism, translation, theatre, PR, diplomacy, recruitment, finance, football management, teaching of all kinds, and even banking. Some have opted to live and work in Italy. selecting postgraduate courses in arts, Many do further study, social sciences, and European studies, while others have opted marketing, journalism, teaching, for professional training in law, acting, translation, interpreting and business. In the Senior Freshman (second) year you continue with year you continue Freshman (second) In the Senior Inferno including Dante’s Italian literature language courses, with Italian together texts from the Renaissance, and other key cultural studies. cinema and years The Sophister Sophister (third and fourth) years focus The Junior and Senior medieval, Renaissance and later on major authors of the perspectives on Italy and its periods, including contemporary in literature, language, film, history culture. Options are available on strengthening There is a continuing emphasis and society. and developing higher-level skills in your language proficiency and writing. translation, text editing programme includes courses on Italian In your final year the works by Dante, Boccaccio, Machiavelli language varieties, key modern period. and others, with a thematic approach to the you will research Optional topics can be studied in depth, and aural examinations, There is a combination of written, oral and of coursework in addition to essays and continuous assessment and assignments. language other than English language other than English In Italian or in a In Italian or in a TR001 (TSM) 30 390*-565 B.A. See page 27 HC3 Grade C
COURSE CODE: COURSE PLACES 2012: POINTS 2011: AWARDED: DEGREE Italian TSM points: Special Entry Requirements: Leaving Certificate Advanced GCE (A-Level) other subject Italian (TSM) must be combined with one programme. from the two-subject moderatorship (TSM) is An honors degree TSM is a joint honor programme. combine with awarded in both subjects. For subjects that Italian, see page 36. as one of the two Italian may be selected Alternatively, programme languages studied in the European studies (TR023). level) within Italian can be studied ab initio (from beginner TSM and European studies. both Course content Is this the right course for you? Course overview We provide about eight classroom hours per week, mostly We conversation devoted to language learning including grammar, and other activities, together with assignments to be carried out will be introduced to modern Italian history, You independently. drama and fiction. poetry, In the Junior Freshman (first) year, you will follow an intensive you will In the Junior Freshman (first) year, translation, conversation, audio/video and course in grammar, computer-based language learning. The Freshman years Italian is an excellent subject choice if you have a natural flair for languages, and enjoy exploring foreign countries and their cultures, or if you want to follow a career in the multilingual Europe of today. Having played a leading role in shaping European civilisation, Having played a leading role in shaping European dynamic economies, most Italy today is one of the world’s you want to develop famous for style, design and innovation. If Trinity people and culture, the an in-depth knowledge of Italy’s your interest in course gives you the opportunity to develop of also help you meet the challenge We a systematic way. mastering a new language; you can start Italian here as a contact between students of There is close complete beginner. you will receive individual attention and will be Italian and staff; encouraged to discuss your progress at all times. 86 Arts, Humanities and Social Sciences museum forthoseinterestedingainingskillsandexperience. to contributethecourses.We alsooffer internshipsinour and MiddleEasternarchaeologycometotheDepartment working inareassuchasHumanRights,Holocauststudies, Poland, Berlin, Andalusia). Eachyearinternationalfigures and weorganisevariousactivitiesthatincludestudytours(e.g., Encountering thesecivilisationsisnotconfinedtotheclassroom extraordinary societieswithus. Cracow toCordoba,fromNew York toJerusalem,explorethese and diversesocietiescultures.FromBabylontoBerlin,from find inthisdegreeawaytodeepenyourappreciationofcomplex study ofliterature,religion,history, languagesorpolitics,youwill find yourselfdrawntotheancientormodernworldsfavour multiculturalism inanincreasinglyglobalisedworld.Whetheryou cultures providesaninsightintothechallengesofdiversityand and North American societies.Studyingtheiroriginsand development ofEuropean,MiddleEastern,North African, Judaism andIslamhavebeendeeplyinfluentialinthe professional schools insuchfieldsaslaw, journalism,orarein Graduates goon toworkinmanycareers:some haveentered these helpyoutodevelopthekind ofskillsemployerslookfor. A rangeofstudentactivitieswillbeavailable toyouandmanyof of humanhistory. they dosooverthecourseofsome ofthemostexcitingperiods their valuesandperspectives,youwillbeabletoexplorehow interest toyou.Ifyoufindyourselfaskinghowsocietiesdevelop modern culturesandvalues,thiscoursewouldbeofgreat Near EastshapedtheBibleorhowancientsocietiesinfluence If youwanttounderstandhowthecivilisationsof Ancient Is thistherightcourseforyou? civilisations? What isJewishandIslamic TR030: Catholictheologicalstudies,page106 TR001/008: World religionsandtheology, page107 See also: civilisations seepage36. For subjectsthatcombinewithJewishandIslamic degree isawardedinbothsubjects. programme. TSM isajointhonorsprogramme. An honors subject withinthetwo-subjectmoderatorship(TSM) single honorcourse.Itmustbecombinedwithoneother Jewish andIslamiccivilisationscannotbestudiedasa TSM points: DEGREE AWARDED: POINTS 2011: PLACES 2012: COURSE CODES: civilisations Islamic and Jewish See page27 B.A. 425-565 10 TR001 (TSM) n n and archaeologicalevidence. Islamic civilisationsexploredthroughliterature,inscriptions, of Ancient NearEastern,medievalandmodernJewish In thefirstyearweoffer introductorycoursesintheorigins The JuniorFreshmanyear pathway. rewarding experienceandanimportantaspectoftheircareer have foundthedegreetobeanintellectuallyandpersonally business, NGOs,internationalhumanrights,andthearts. All in Jewish,IslamicandNearEasternStudieswithcareers communal orsocialwork.Othershavecombinedtheirinterest topic ofinteresttoyou. addition tothesecourses,youwill beabletowriteathesison Holocaust representation; The Bibleinpopularculture.In The JewsofEgypt;IslamandHumanRights;gender; from arangeonoffer. Courses offered inrecentyearsinclude: In yourfinalyearyouwillbeabletochoosespecialsubjects The SeniorSophister Year Curriculum programme(seepage14). In secondyearyoumaytakeacoursein Trinity College’s Broad In additionyouhavetheoptiontotake Arabic, GreekorHebrew. Europe, andGreatJewishbooks. the NearEast, Arabs in Antiquity, JewsandMuslimsinModern film. Topics include AncientEmpiresoftheMediterraneanand political, religiousandliterarytexts,materialculture,blogs cultures intheancient,medievalandmodernworldsthrough developed inyourfirstyear. You willbeabletostudydiverse of coursesdependingontheindividualinterestsyouhave From thesecondyearon,youmaychoosefromarange The secondandthirdyears n Course content and architecture,literatureoftheMiddleEast. Islamicart present. SourcesexaminedincludetheQur’an, civilisation fromitsoriginsinthe Arabian peninsulatothe texts andculturalcontextsforthedevelopmentofIslamic Introduction to Islamic civilisationintroduceshistory, early Christianmovementisexplored. worlds. The originofdifferent Jewishgroupsincluding the in Babylonia,Persia,EgyptandtheHellenisticRoman Israelites andtheirneighboursinthelandofPalestine Particular attentionispaidtotheworldviewsofancient Judah usingbothliteraryandarchaeologicalevidence. explores theenvironmentofworldancientIsraeland The World of the Ancient NearEastandtheBible the modernexperience. through themedievalMuslimandChristiansocietiesupto Jewish historyfromtheirancientoriginsintheNearEast Modern Period Introduction to JewishCivilisation from Antiquity tothe outlinesthemajorculturalmovementsin
Arts, Humanities and Social Sciences 87 TR004 90 505* LL.B. you are most Law and business, page 92 Law and business, page page 90 Law and French/German, page 94 Law and political science, welcome to attend lectures. If you would like to avail to come in and discuss your options of this opportunity, or to visit the Law School we with a member of staff, would be happy to meet you. Please contact us by e-mail (see below) to arrange a visit. If you are considering studying at for a Law degree but want to be sure, College Trinity Visit the Law School Visit n Law CODE: COURSE PLACES 2012: POINTS 2011: AWARDED: DEGREE See also: TR017: TR018/019: TR020: Why study Law at Trinity College? at Trinity Why study Law Trinity College Dublin’s School of Law, is Ireland’s oldest and is Ireland’s School of Law, College Dublin’s Trinity The School, ranked most internationally renowned law school. QS World in the 2011 1st in Ireland and 51st in the World students of the University rankings of law schools, attracts highest calibre. we are small in size, By national and international comparisons relationship an advantage that fosters a friendly and vibrant and students, one inspired by mutual respect and between staff are widely recognised for providing a liberal co-operation. We the promotion of the environment where independent thinking, encouraged. ideals of social inclusion and equality is strongly educate people to be the leaders of the legal profession, We public service and society. College Trinity sizes, In addition to our favourable smaller class an unrivalled number of optional law degrees offer Dublin’s students thus affording modules in the final two years of study, advantage the opportunity to specialise and gain a competitive Students reading over graduates from many other universities. will have any of our five undergraduate degree programmes, for entry to the Irish available to them all of the modules required and UK professional bodies. leading legal periodicals, The School is home to one of Ireland’s College the ‘Dublin University Law Journal’, and the ‘Trinity The latter is published by the student members Law Review’. Law Society and now enjoys international of the College’s dissemination on HeinOnline. LL.B. degrees prepare students not only Dublin’s College Trinity for life as ‘lawyers’, but also enable them to enter many career fields such as business, journalism, financial services, politics, The skills and diplomacy and public services. foreign affairs College Dublin are useful Trinity learned through studying law in in all walks of life. Trinity Collegethe only university is in Ireland that Trinity a course in Jewish and Islamic civilisations. offers n Did you know? Further information Career opportunities Study Abroad Study Assessment s See: www.tcd.ie/nme Our graduates have followed careers in areas such as law, Our graduates have followed careers in areas such as law, They also have NGOs, journalism and media, and teaching. and PhD been very successful in gaining places in MA programmes. The course in Jewish and Islamic civilisations is an arts degree and graduates have skills that are highly valued by potential employers and they pursue the same kinds of careers as other Advisory Service Careers College’s Trinity arts graduates. recently surveyed employers about what they looked for in arts graduates and top of the list came: enthusiasm for the position, personal qualities and transferable skills such as good oral communication, written communication, team work and problem solving. Students of Jewish and Islamic civilisations have ample opportunity to develop all of these skills within a department that knowledge of the A is relatively small and very student centered. societies in the global cultures, values and histories of different community is an advantage for many types of careers. You may have the opportunity to avail of a semester abroad may have the You programme. A combination of end of year examination and continuous A presentations, assessment, e.g. essays, book reviews, seminar and digital projects. 88 Arts, Humanities and Social Sciences chosen fromarangeofapproximately30modules. (third andfourth)yearsyoucanfocusonparticularareasoflaw body withexperienceofprivatepractice.InyourSophister programmes, andassistedinpartbymembersofouracademic through theintroductionoflegalskillsandmooting(mocktrials) between theacademicandpracticalaspectsoflaw, achieved bodies). There isanappropriatebalanceintheFreshmanyears modules (manyofwhicharerequiredbythelegalprofessional two (Freshman)yearsaregivenovertothestudyofcorelegal Law at Trinity Collegeisafour-yeardegreeprogramme. The first articulate expressionareimportant. use oflanguage,thereforegoodwritingskillsandafacilityfor and politicalcontext.Legaltrainingrequiresprecisecareful cannot befullyappreciatedwithoutreferencetotheirhistorical developments willbeanadvantageasmanylegalmodules degrees maybeforyou. A generalinterestinhistoryandpolitical challenged andintellectuallystimulatedthenoneofourLaw in society, governanceandcurrentaffairs. Ifyouliketobe and crime. The studyoflawappealstopeopleinterested of ourlives,fromfoodlabellingandfootballtransferstoelections evolving andreactingtosocialchange.Itgovernseveryaspect Law isanexciting,dynamicdisciplinewhichconstantly Course overview Is thiscourserightforyou? n n n n n n n n Junior Freshman(firstyear) Modules n n n n seminars andworkshops. years, seebelow)andmodulesmayalsobesupplementedby eight modules(modulesareweighteddifferently inthefinaltwo the Sophisteryearsstudentstakegenerallybetweensixand hours oflecturesperweekandfourseminarssemester. In seminars andworkshops.Eachmoduleistaughtbythree modules persemesterandaseriesoflegalskillsormooting terms (semesters).IntheFreshmanyears,studentstakethree between 12-15students). The academicyearisdividedintotwo supplemented withseminars(smallgroupteachinginclassesof Most oftheteachingtakesplaceatlecturelevelandis Senior Freshman(secondyear) Constitutional lawII Constitutional law Administrative regulation Legislation and Criminal law Contract law Legalskills) system(including The Irishlegal lawI Constitutional Torts Private law remedies (including Mooting) Private lawremedies(including Land law law European Union Equity Arts, Humanities and Social Sciences 89 e www.kingsinns.i e g). www.lawsoc-ni.or
e m), while prospective www.barlibrary.co Further information Study abroad Study Career opportunities Law degrees and professional qualifications www.tcd.ie/law/undergraduat / 1278 +353 1 896 1125 Tel: E-mail: [email protected] Prospective solicitors must undertake the professional training programme for solicitors delivered by the Law Society of Ireland e). (www.lawsociety.i Separate requirements apply in Northern Ireland. Prospective The Inns Court Treasurer, barristers should consult the Under of Northern Ireland ( the Incorporated Law solicitors should consult the Secretary, Society of Northern Ireland ( In view of rapid changes relating to the rules of entry into all students are advised to maintain regular professional study, contact with the relevant professional bodies so that they are aware of any new requirements coming on-stream. In the Junior Sophister (third) year, students have the Sophister (third) year, In the Junior European in a prestigious to apply to study abroad opportunity In addition programme. the EU funded Erasmus university with in Europe, the School of Law also to exchange programmes America and leading universities in North has bilateral links with Australia. the ideal foundation for the aspiring law degree provides A wider opportunities law offers However, solicitor or barrister. alone, with many graduates finding than professional practice administration, business, journalism, employment in public affairs, banking, insurance, politics, foreign accountancy, diplomacy and international financial services. law as a solicitor No law degree entitles a person to practise If you wish to go on to obtain a professional or barrister. profession require that qualification, the governing bodies for the primary law degree. you study certain specific modules in your modules during the These modules are taught as compulsory The modules. Freshman years and/or as optional Sophister law degree programmes five undergraduate School of Law’s all modules required enables students the opportunity to study by the Irish and English professional bodies. will need to Students contemplating a career as a barrister Society of the King’s continue their studies with the Honorable graduates must complete the law qualify as a barrister, To Inns. Inns before ‘devilling’ one-year degree course with the King’s on Further information with a qualified barrister for a year. becoming a barrister is available from Restitution law Tax contract law Transnational Sport and the law Media law Penology Public interest law Public international law Refugee and immigration law Intellectual property law International family law International human rights law International trade law Jurisprudence Legal philosophy Environmental law European human rights EU food law Evidence Family law Criminology Critical perspectives on law Economic and legal aspects of competition policy Employment law English land law Collective labour law Commercial law Company law Comparative law Corporate governance Advanced European Union law Advanced European Advanced evidence Child law Broad Curriculum programme In the Senior Sophister year, students may opt to write a In the Senior Sophister year, research dissertation on a topic of their choice in place of a taught module. The School of Law is committed to making available to students the option of taking a module from outside its discipline, under the Broad Curriculum programme. Students may choose to study modules from a variety of disciplines, not just from the (see page 14 Arts, Humanities and Social Sciences Faculty of for further information). n n n n n n n n n n n n n n n n n n n n n n n n n n n n n n n n n The Sophister years (third and fourth year) years (third and The Sophister must take modules students the four years of study, Throughout The each year. Transfers) (European Credit worth 60 ECTs in the Sophister however, modules bear 10 ECTs; majority of The modules available. are also 5 credit modules years there to study are as follows: which may be available 90 Arts, Humanities and Social Sciences of greatbenefit tomeinmypracticeatthebar.” lecturers encouragedustotake tolegalissueshasbeen that thequestioningapproachwhich Yvonne andother in planningandenvironmentallaw. Ihavenodoubtbut Yvonne Scannell,andsubsequently decidedtospecialise the EnvironmentalLawcourse taught byProfessor cases weretheleadersintheir field. Iparticularlyenjoyed atmosphere. Mylecturerswereexcellent,andinmany School isrelativelysmall,andthushasaveryfriendly fairer basisofassessmentthaninmostcolleges. The Law your performanceinthirdandfourthyear, whichisamuch subjects indepth. Your degreeisawardedonthebasisof subjects, butalsoaffords an opportunitytostudythose four-year coursenotonlyallowsforagreaterchoiceof fact thatitoffered afour-yearhonorsdegreecourse. A excellent reputationoftheSchool,and,secondly, the “My reasonsforchoosing Trinity Collegewere,first,the (Thomson RoundHall,Dublin). law, and theauthorof“PlanningandDevelopmentLaw” Senior Counselspecialisinginplanningandenvironmental with afirstclasshonoursdegreein1992.Garrettis Garrett Simons,S.C.graduatedfromtheSchoolofLaw Garrett Simons Graduate Profile in theprocess,then Trinity Collegeistheplacetobe.” the law from outstanding teachers, and make a lot of friends that. If you are looking to have a great four years, learn about world class standards and the Law School is a testament to Trinity College is an internationally recognised university of have aninquisitorialapproachtowhatyouarelearning. to have a wide and practical knowledge of the subject and to years, are not just aimed at making you pass an exam, but willing to help. The lectures, especially in the third and fourthbook on what they are teaching, they are friendly and always Aside fromthefactthatmostoflecturershavewritten The teaching in the Law School here is second to none. country thatwilllastalifetime. also tosetupconnectionsandfriendshipsinanother chance tobroadenmyperspectivesonlegalissuesand universities. StudyingintheUnitedStatesgaveme abroad forthethirdyearofdegreeinotherworldclass are alsogiventheinvaluableopportunityofstudying law thattheyareparticularlyinterestedin.Lawstudents subjects butalsotodelveintomorespecificareasofthe degree allowsstudentsnotonlytostudythecorelegal environment betweenthestaff andstudents. The four-year leading universitiesanditallowsforafriendlyclose-knit The LawSchoolisrelativelysmallcomparedwithother Trinity College. so gladthatIdecidedtogoagainstthegrainandcome and Iverynearlydidthesame.canhonestlysayam school friendsweregoingtocollegethereorinEngland a bitofwhim.ComingfromNorthernIreland,mostmy “If Iamhonest,chosetostudyLawat Trinity Collegeon Grainne McAnaney Student Profile taught overfouryearswithacompulsoryyearabroad. legal, cultureofthecountryconcerned.Eachprogrammeis in thecontextofstudyinggeneral,aswellspecifically each programmeis integrated and language skillsaredeveloped through therelevantlanguage. The languagecomponentof their firsttwoyears. Thesemodulesaretaughtandexamined study FrenchorGermanlaw, bothconstitutionalandcivil,in attaching alanguagecomponenttolawdegree.Students up ofFranceorGermany. Farmoreisinvolvedthansimply of thegeneralculture,political,economicandsociologicalmake- system ofFranceorGermanyandarealinsightknowledge European language,withathoroughknowledgeofthelegal graduate withagroundinginIrishlaw, fluentinasecond and Germandegreecoursessatisfytheseneedsasstudents a trans-nationaleducation. The LawandFrench, globalisation oflegalmatters,thereisaneedforlawyerswith With continuingEuropeanintegrationandanincreasing language. should alsohavetheabilitytobecomefluentinrelevant and sociologicalmake-upofeitherFranceorGermany. You strong interestinthegeneralculture,legal,political,economic In additiontoadesirestudylaw, youwillneedaspecificand Overview Is thistherightcourseforyou? TR020: Lawandpoliticalscience,page94 TR017: Lawandbusiness,page92 TR004: Law, page87 See also: Advanced GCE(A-Level) Leaving Certificate Special EntryRequirements: DEGREE AWARDED: POINTS 2011: PLACES 2012: COURSE CODES: Law andFrench/German n Visit theLawSchool e-mail (seebelow) toarrangeavisit. would behappytomeetyou.Please contactusby with amemberofstaff, ortovisittheLawSchoolwe of thisopportunity, tocomeinanddiscussyouroptions welcome toattendlectures.Ifyouwouldlikeavail Trinity College butwanttobesure, foraLaw degreeat If youareconsideringstudying
HC1 Grade C Grade C HC1 LL.B. (Ling.Germ) LL.B. (Ling.Franc) 550* 15 (French) TR018 you aremost French (TR018) French (TR018) German (TR019) German (TR019) 495 15 (German) TR019 Arts, Humanities and Social Sciences 91
e Assessment Career opportunities Further information w www.tcd.ie/La / 1278 +353 1 896 1125 Tel: E-mail: [email protected] A combination of assignments and aural, oral and written A strong element of continuous There is a examinations is used. law subjects. assessment in language and French or German The increasing Europeanisation of legal practice means that graduates of the law and a language degree programme have much to contribute to the legal and other professions in Ireland, as well as enjoying career opportunities in Europe. In addition to careers in the legal profession, Law and French, and Law and German graduates also find employment in business, banking, insurance, politics, foreign journalism, accountancy, and diplomacy and public services. affairs Also, see “Law degrees and professional qualifications” on page 89. Senior Freshman Law and German students take modules in students take modules Law and German Senior Freshman to introduction an and translation legal including language, German history; cultural German texts; legal in used language specialist the law. and German criminal law and jurisprudence German civil years The Sophister (third) year is spent studying legal or The Junior Sophister The results French or German university. related subjects in a constitute a substantial part of your obtained studying abroad final degree grades. you select 40 ECTS (fourth) year, In the Senior Sophister from approximately thirty options. See (credits) worth of modules possible modules. Students who wish to page 89 for details of with the professional bodies may also take continue their studies place of a Sophister module if required Freshman modules in In addition, you will engage by the particular professional body. writing. Students in language and oral work and project/report the place of a may choose from a number of options to take module (see page law module, including a Broad Curriculum by the relevant 14), a research dissertation or a module offered language department. study French Senior Sophister Law and French students in addition to their translation, Report writing and Oral French advanced oral and law modules. Law and German students take rhetoric, and Translation written language modules, including their law as well as taking attend a seminar on German Law, modules. Trinity College’s School of Law 1st in Ireland is ranked College’s Trinity University QS World in the 2011 the World and 51st in law schools. rankings of French or German civil law Land law Private law remedies (including Mooting programme) Equity French or German language French civilisation or German cultural history Law of tort French constitutional law or German legal system Contract law Constitutional law 1 Criminal law French or German language French civilisation and legal methods area or German studies The Irish legal system (including Legal skills) n Did you know? Did you Course content Senior Freshman Law and French students study French civil tort) through French. In contract and law (including property, their integrated French language and civilisation modules, they focus on French politics and the integration of the themes studied in the first two years. Junior Freshman Law and German students study, alongside Junior Freshman Law and German students study, German language and textual analysis, the political institutions and aspects of society and economy in the German speaking The course involves an introduction to German countries. constitutional law and the German legal system, German legal history and legal philosophy. Junior Freshman Law and French students study French Junior Freshman Law and French students through French constitutional law and French legal methods These two as well as French language and civilisation. tutorials, and listening integrated modules comprise of lectures, language, French society and They cover comprehension work. the French legal system. n n n n n n n Senior Freshman modules n n n n n n n Junior Freshman modules In the Freshman (first two) years you will study a variety of legal legal of variety a study will you years two) (first Freshman the In you will have two Irish law each semester, In modules, see below. These of lectures in each per week. modules, with three hours per (4 seminars law compulsory by complemented are lectures t) in legal skills in the Junior Freshman (firs module) and modules (second) Freshman Senior the in trials) (mock mooting and year students also study the constitutional and Law and language year. integrated take also Students jurisdiction. chosen their of law civil of aspects covering civilisation, and language on modules legal systems and politics. sociology, 92 Arts, Humanities and Social Sciences range ofcareeropportunitiesorfurtherstudy. management skills,enablingstudentstochoosefromawide provide studentswithafirmgroundinginlawalongstrong legal principlesandmanagementpractices. The programme will at individualsseekingacareerdefinedbytheapplicationof graduates haveblendedinmanyaspects. This courseisaimed and taxation,theworkoflegalgraduatesbusiness work ofthelegalprofessionintoareasmergers,acquisitions the growthinsizeoflegalpracticesandexpansion evolving commercialorganisationsandbusinesspractices.With policies. Conversely, thelawhashadtograpplewithconstantly concerning governmentregulationsandinternationaltrade global economy, businessesnowdealwithmorecomplexissues closely associatedinboththepublicandprivatesector. Inour Historically, thedisciplinesofbusinessandlawhavebeen international perspectivesonlawandbusiness. markets, taxation,theprotectionofintellectualpropertyand of markets,consumerlaw, labourlaw, financeandfinancial forms ofbusinessorganisation,competitionlawandregulation disciplines; forexample,thestructureofcompaniesandother upon themanyareasofoverlappinginterestbetweentwo law operates.Studentswillhavetheopportunitytofocus activity andtheeconomiccommercialcontextinwhich understanding ofboththelegalframeworkbusiness the disciplinesoflawandbusinesstodevelopacritical This jointdegreeaimstogivestudentsafirmgroundingin Introduction toorganisation andmanagement, and Introduction Law oftort.Students taketwomandatorybusiness modules: law modules: The Irishlegalsystem,Lawofcontract,and each equalto10ECTScredits. Studentstakethreemandatory In theJuniorFreshman(first)year studentstakesixmodules, Course content Is thistherightcourseforyou? Course overview TR034: TR020: TR018/019: TR004: See also: GCSE Leaving Certificate Special EntryRequirements: DEGREE AWARDED: POINTS 2011: PLACES 2012: COURSE CODES: Law andbusiness
systems studies(MSISS),page124 Management scienceandinformation Law andpoliticalscience,page94 Law andFrench/German,page90 Law, page87
OC3/HD3 Grade B Business) LL.B. (Lawand 555* 25 TR017 Mathematics Mathematics Criminology, Environmental law, Equity, Evidence, Familylaw, international law), ConstitutionallawII,Corporate governance, law, Companylaw, Comparativelaw, Conflictoflaws(private Administrative law, Advanced European Union law, Commercial Law: Entrepreneurship: A commercialandsocialperspective. corporate sector;Internationalfinanceandriskmanagement; new productdevelopment;Financialmarketsandthe practices; Managingnon-profitorganisations; reporting andanalysis; Advances inmarketingtheoryand business; Exploringorganisationalexperiences;Financial Strategic management: Theory and practice;International Business: options include: specialise entirelyineitherlaworbusinessmodules.Module business andlawmodulesinthisyear, oralternatively, to a rangeofmoduleoptionsandmaychoosetoeithercombine In theSeniorSophister(fourth)yearstudentsmaychoosefrom International tradelaw, Privateinternationalfamilylaw. Critical perspectivesonlaw, EuropeanUnionfoodlaw, Child law, Contemporaryissuesinthephilosophyoflaw, contract law, Medialaw, BroadCurriculum(seepage14), law, Research dissertation,Sportslaw, Tax law, Transnational remedies, Publicinterestlaw, Publicinternationallaw, Refugee law II,Legislationandregulation,Planninglaw, Privatelaw International practiceinlaw, Jurisprudence,Labourlaw, Land law, Intellectual propertylaw, Internationalhumanrightslaw, competition policy, Employmentlaw, Europeanhumanrights Equity, Evidence,Familylaw, Economicandlegalaspectsof law II,Corporategovernance,Criminology, Environmentallaw, law, Conflict oflaws(privateinternationallaw),Constitutional Administrative law, Commerciallaw, Companylaw, Comparative modules asfollows: The remainingLawmodulesmaybedrawnfromalistofoptional and society Applied finance;Organisationaltheoryandchange;Business Financial andmanagementaccounting;Marketingmanagement; Human resourcemanagement;Operations drawn fromalistofoptionalmodulesasfollows: European Unionlaw. The remainingbusinessmodulesmaybe and 1/3fromtheLawSchool.Oneoflawmodulesmustbe of modules,which1/3mustbefromtheBusinessSchool In theJuniorSophister(third)yearstudentstakeacombination operations management). and Management3(Introductiontofinance,Introduction Management 2(Introductiontoaccounting,Financialanalysis), 1 (Organisationalbehaviour, Marketingmanagement), modules arethecorebusinessdisciplinemodules:Management Constitutional lawIandLandlaw. The threemandatorybusiness modules. The threemandatorylawmodulesare:Criminallaw, In theSeniorFreshman(second)yearstudentstakesix German, Russian,SpanishorPolish). Mathematics andstatisticsoralanguagemodule(French, to economicpolicy. Inaddition,studentscanchoosebetween
Arts, Humanities and Social Sciences 93
you are most you are most e . If you would like . If you would attend some lectures welcome to to come in and discuss to avail of this opportunity, or to visit the of staff, your options with a member be happy to meet you. Please Law School we would (see below) to arrange a visit. contact us by e-mail If you are considering studyingIf you are considering a Law degree at for to be sure, College but want Trinity Visit the Law School the Law Visit n Further information w s and www.tcd.ie/la www.tcd.ie/busines / 1278; or +353 1 896 1125 +353 1 896 1840 Tel: E-mail: [email protected]
http://lawlibrary. e (solicitors). www.lawsociety.i Why study at the Law School College Dublin? of Trinity Why choose the Trinity College Why choose the Trinity School of Business? Career opportunities Languages and study abroad Assessment See page 87. See page 39. The programme will provide students with strong management The programme will provide students with well be will Graduates law. in specialisation in-depth an and skills in both the legal prepared for demanding and rewarding careers where the two and business professions, particularly in areas expect graduates to accept positions disciplines coincide. We general business, taxation, finance and accounting, in law, management, employment relations and the civil service. In students will have the option of studying all the law particular, subjects required for a qualifying law degree, which will enable them to apply for entrance to the professional legal institutions The post-degree training to qualify as barristers and solicitors. for barristers and solicitors varies from time to time, and current details can be found on the following websites: ie (barristers) and Also, see “Law degrees and professional qualifications” on First and second-year students have the option to study French, First and second-year students have the option who have the German, Spanish, Russian or Polish. Students the opportunity to prerequisite language proficiency will have the Erasmus exchange study abroad in their third year as part of This will mean spending all or part of the Junior programme. in Belgium, France, Sophister (third) year abroad at a university Russia or Spain. Law and Business students Italy, Germany, part in English- also have the opportunity of applying to take in Europe, North speaking international exchange programmes Australia and Singapore. America, page 89. Modules are examined by a combination of continuous Modules are examined examination. assessment and formal Economic and legal aspects of competition policy, Employment competition policy, and legal aspects of Economic property law, Intellectual human rights law, European law, practice in law, International human rights law, International Legislation and Land law II, Labour law, Jurisprudence, Public interest Private law remedies, Planning law, regulation, dissertation, Research law, Refugee law, international Public law, Media law, contract law, Transnational law, Tax Sports law, Contemporary page 14), Child law, Broad Curriculum (see Critical perspectives on law, of law, issues in the philosophy Private trade law, International law, European Union food international family law. 94 Arts, Humanities and Social Sciences would bestrengthenedbyaknowledgeofthelaw. if your intellectual or career interests in politics and public service study of law to be informed by a wider political understanding, or Yes, if you are interested in pursuing a legal career and want your subjects requiredbythelegalprofessionalbodies. studies, studentswillhavetheopportunitytostudyallofcore either subject,orcontinuewithboth.Duringthefouryearsof year youwillhavetheoptiontoconcentrateexclusivelyon will takebothsubjectsforthefirstthreeyears.Inyourfourth relation toeachother. As astudentonthisprogramme,you the opportunitytolearnaboutbothandbetterunderstandtheir Law andpoliticsaredeeplyconnectedthiscourseprovides totalling 30credits fromeachdiscipline.Students maychoose In theJuniorSophister (third)year, studentstakemodules six 10creditmodules(threefrom eachdiscipline). Transfer System) peryear. Inthefirsttwoyearsstudentstake All studentstakemodulesworth 60ECTS(EuropeanCredit Is thistherightcourseforyou? Course overview Course content n Did youknow? n Visit theLawSchool TR081: TR015: TR012: TR017: TR018/019: TR004: See also: DEGREE AWARDED: POINTS 2011: PLACES 2012: COURSE CODES: Law andpoliticalscience e-mail (seebelow)toarrangeavisit. would behappytomeetyou.Pleasecontactusby with amemberofstaff, ortovisittheLawSchoolwe of thisopportunity, tocomeinanddiscussyouroptions welcome toattendlectures.Ifyouwouldlikeavail Trinity Collegebutwanttobesure, foraLawdegreeat If youareconsideringstudying rankings oflawschools. and 51stintheWorld inthe 2011 QSWorld University Trinity College’s isranked1stinIreland SchoolofLaw BESS, page37 Philosophy, politicalscience,economics History andpoliticalscience,page75 Law andbusiness,page92 Law andFrench/German,page90 Law, page87 and sociology, page99 LL.B. (Pol.Sc.) 560 20 TR020 you aremost
politics, andInternationalrelations. Political Science:Historyofpoliticalthought,Comparative Law: Criminallaw, ConstitutionallawIandLandlaw. Senior Freshman(second)year to economicpolicy, andIntroductiontosociology. Political science:Introductiontopoliticalscience, Law: The IrishlegalsystemandLegalskills,Contract, Torts law. Junior Freshman(first) Year philosophy; Media law;Penology;Publicinterest law;Public law; Jurisprudence; Labourlaw;Landlaw(English); Legal family law;International HumanRights;International trade law; Evidence;FamilyIntellectual propertylaw;International Environmental law;Equity;European HumanRights;EUfood and legalaspectsofcompetition policy;Employmentlaw; Conflict oflaws;Constitutional Law II;Criminology;Economic Child law;CommercialCompany law;Comparative Law: Administrativelaw; Advanced EUlaw; Advanced evidence; modules fromthefollowinglist: to studyanequalcombinationofLawandPoliticalscience either 60ECTSfromLaworPoliticalsciencecontinue Senior Sophister(fourthyear)studentsmaychoosetotake Democracy anddevelopment. and politicsoftheUSA;EuropeanUnionpolitics; the finalyear),andtwomodulesfrom:Irishpolitics;Government (compulsory ifstudentswishtospecialiseinPoliticalscience Political science:Researchmethodsforpoliticalscientists Tax law, andSportthelaw. international law;RefugeeandimmigrationRestitution; philosophy; Medialaw;Penology;Publicinterest Jurisprudence; Labourlaw;Landlaw(English);Legal law; InternationalHumanRights;trade Family law;IntellectualpropertyInternationalfamily law; Equity;EuropeanHumanRights;EUfoodEvidence; aspects ofcompetitionpolicy;Employmentlaw;Environmental laws; ConstitutionallawII;Criminology;Economicandlegal Commercial law;CompanyComparativeConflictof modules: Administrative law; Advanced evidence;Childlaw; Law: EUlaw(compulsory)and20ECTSfromthefollowing Law andPoliticalsciencefromthefollowingmodules: Junior Sophister(thirdyear)studentstake30ECTSfromboth The Sophisteryears Research methodsforpoliticalscientists. science inthefinalyearofhis/herdegreethenhe/shemusttake is mandatory. IfastudentchoosestospecialiseinPolitical In theJuniorSophister(third)year, onelawmodule,EUlaw, week permodule. at lecturelevelwithtwohoursoflecturesandonetutorialper seminars permodule.Politicalsciencemodulesarealsotaught one semesteronlyandstudentsattendfourcompulsorylaw Law modulesaregenerallytaughtforthreehoursperweek modules frombothsubjects. Sophister (fourth)yearorcontinuetotakeacombinationof to specialiseineitherLaworPoliticalsciencetheirSenior
Arts, Humanities and Social Sciences 95 p TR001 (TSM) 10 540-565 TR002 20 420 B.A. See page 27 Music CODES: COURSE PLACES 2012: POINTS 2011: AWARDED: DEGREE TSM points: entry course. Applications must be This is a restricted 2013. submitted by 1 February submitted by 1 February of the Applications must be to Applicants will be required proposed year of entry. provisionally scheduled attend an entrance examination, for 23 March 2013. for download Specimen examination papers are available from the Music Department website: www.tcd.ie/Music/undergraduate/music/index.ph Special Entry Requirements: for entry, Formal musical training is not a prerequisite the ability to but candidates should have a good ear and The most read and notate music to a rudimentary level. ear. important musical qualification is a good results, On the basis of the entrance examination at the end applicants may be called to attend an interview before final selections are made. April/beginning of May, of to perform at interview. are not required You music is TR002 – Music is a single honor course where read almost exclusively for four years. TR001 – Music (TSM) is a joint honors programme. An honors Music can be combined with one other subject. that degree is awarded in both subjects. For subjects combine with Music see page 36. follow the same courses. TSM students Single honor and TSM students cover all the principal areas of music While studied by single honor students, the workload is less than TSM students have that of the single honor programme. the same range of options as single honor students. See also: TR009 – Music education page 97 Course overview The single honor and two-subject courses provide a thorough grounding in the basic skills of musicianship and academic study (see below for details). From the second year onwards, a and especially in the third and fourth years, both courses offer wide range of options. Students specialise in one of the following and musicology (the areas: composition, music technology, historical and analytical study of music); and in their final year the course they undertake a major project in that area. However, is designed so that students may also take subjects outside their specialisation. e e e. [email protected] e www.tcd.ie/law/undergraduat Law degrees and professional qualifications Further information Career opportunities Study abroad Assessment Please see page 89 for further information on legal professional qualifications. No law degree entitles a person to practise law as a solicitor or throughout the four-year degree programme However, barrister. in Law and political science, students will have the opportunity to study all core modules required by the professional bodies. Tel: +353 1 896 1125 / 1278; E-mail: +353 1 896 1125 Tel: www.tcd.ie/law/undergraduat www.tcd.ie/Political_Science/undergraduat +353 1 896 1651 Tel: Whether students’ career goals lie in public leadership, the legal legal the leadership, public in lie goals career students’ Whether relations, public academia, service, civil the media, the profession, government how knowing requires that business in anything works, positions in international organisations such as the EU or or practice, private enforcement, law organisation, not-for-profit a ideally be will science political and Law in degree the elsewhere, suited as a platform for attaining those goals. A limited number of places are available on EU-funded exchange EU-funded on available are places of number limited A Italy, Germany, Austria, France, programmes at universities in in the Junior the Netherlands, Poland and Spain to students take optional Students are advised to Sophister (third) year. first two years if they language courses (see page 14) within the they must satisfy wish to avail of this opportunity; alternatively of the host university that they have proficiency in the language There are also exchange programmes that they wish to study in. Participating in America. with a number of universities in North exchange fulfilling the these opportunities is dependent upon the course requirements of both departments. Courses are examined by a combination of continuous Courses are examined by a combination of assessment and formal examination. Full details of all law modules (Freshman and Sophister) are and Sophister) of all law modules (Freshman Full details available on international law; Refugee and immigration law; Research immigration law; Research law; Refugee and international and the law. law; and Sport Tax Restitution; dissertation; In both subjects small-group teaching is an important aspect In both subjects small-group and, should you decide to specialise in of the Sophister years you will have the science in the final year, either Law or Political and write up a dissertation on a topic of opportunity to research your choice. Research seminar; Political parties; Issues in Political science: Research seminar; Political Contemporary international relations; and contemporary politics; African politics. 96 Arts, Humanities and Social Sciences collection ofCDs. holdings ofbooksandmusic,it housesanextensivelistening and best-equippedlibraryfor music largest researchlibraryinIreland.Itisalso As astudentat Trinity Collegeyouwillhaveaccesstothe they chosebecausethey, likeyou, loveit. They areheretohelpyouinyourexplorationofasubjectthat expertise incomposition,musictechnologyandmusicology. The staff oftheMusicDepartment haveawiderangeof lending collectionofCDsandvideos. elsewhere), excellentlisteningequipment,andasubstantial a smallmusicstudio(plusmoreextensive,sharedfacilities of computerworkstationsthatareusedforteachingandstudy, practice roomswithpianos,anexcellentandup-to-datesuite The facilitiesintheMusicDepartmentincludearecitalroom, able toemphasisetheareasthatinterestyoumost. Because thecourseincludesawiderangeofoptions,youwillbe conduct ensembles,andgainexperienceofartsadministration. awareness. You willalsohaveplentyofopportunitytoperform, thought, creativity, criticalandanalyticalskills,intellectual As anacademicdiscipline,musicfostersindependenceof greatly improvedindepthandbreadth. or practical,yourexperienceofthisvastandrichsubjectwillbe course foryou.Whetheryourinterestsareprimarilyacademic music, howtobecomeamoreinformedperformer–thisisthe know howitworks,itshistoryanddevelopment,towrite If youlovemusicandwanttounderstandit–forexample, or fewer. large group,manysubjectsaretaughtingroupsoftenstudents subjects, suchasHistoryofmusic,aredeliveredlecturestoa is thecommitmenttosmall-groupteaching. One ofthestrengthsMusiccoursesinTrinity College primarily fromoneofthosenon-classicaltraditions. traditional music.Manystudentscurrentlyinthedepartmentcome other musicaltraditions,includingjazz,popularmusicandIrish day. However, the department regularly presents lectures in of classical(orart)music,fromthemedievalperiodtopresent The majorityofsubjectsarebasedonthetraditionsandpractice and performance. compositions andonprojectsinmusictechnology, musicology professional playersofinternationalstanding offers studentsanunmatchedopportunitytoworkwith The recentlyestablishedEnsemble Avalon (APT)Residency many performanceopportunitiesoffered bystudentsocieties). supervision ofexpertsintheirfields(theseareadditiontothe supports severalperformancegroupsthatworkunderthe skills areavailableineachyear;andtheMusicDepartment the campus.Practicalcoursesinauraltrainingand/orkeyboard curriculum, awiderangeofmusicalactivitiestakesplaceon Although instrumentalorvocalstudiesarenotpartoftheformal Is thistherightcourseforyou? . Inadditiontoitsgeneral by farthelargest Whilesome ontheir n n Subjects include: compositional techniquesandmusictechnology. an introductiontohistoricalandanalyticalmusicology, you arefullycompetentinbasicmusicalskillsandprovides The JuniorFreshman(first)yearisdesignedtoensurethat The Freshmanyears of theircompositions astheirfinal-yearproject. Ifyouspecialise grounding incompositional techniques;theypresent aportfolio Students whospecialiseincomposition willreceiveathorough to takeoptionsfromotherspecialisations. concentrated onyourchosenspecialisation. Itisalwayspossible In theSophister(thirdandfourth) yearsstudybecomesmore The Sophisteryears n n n n n wider rangeofoptionsthatincludesBroadCurriculum. Curriculum course(seepage14),and TSM studentshavea technology. Singlehonorstudents willalsoselectaBroad your specialistarea–eithercomposition,musicology, ormusic above subjectsfromthefirstyearwhilebeginningtoexplore In theSeniorFreshman(second)yearyouwillcontinuewith Course content n Visit theDepartmentofMusic tone orsemitone. to playfour-partharmony, andtotransposeupordowna will enableyoutocreateharmonyoveragivenfiguredbass, training) Keyboard skills–(taughtinconjunctionwithaural such asmusicaldictation,sight-reading,andscore-reading. The coursewillimproveyourbasicmusicalskillsinareas Solfa). Aural trainingDoh(Solfègeor –usingmoveable command ofbasicpolyphoniccomposition. species counterpoint,whichwillenableyoutoacquirea notation andrudiments,leadingtothestudyofFuxian Introduction to counterpoint –theconventionsofmusic based notationandsequencing. introduction toMIDIprotocol,audiosignalsandcomputer- Music technology come togethertoformincreasinglylargeunits. of theelementsamusicaltextandwaysinwhichthey Introduction to musicanalysis–includesre-assessment and topresentationstyleinwritingessays. history), plusanintroductiontoresearchmethodologies, forms partofafour-yearprogrammegeneralmusic and earlyClassicalperiodsinabroadculturalcontext(this tothemusicofBaroque History ofmusic–anintroduction of four-partharmony. Introduction to harmony e-mail orphone(seebelow). with amemberoftheteachingstaff. Contactusby terms. You willalsobeinvitedtodiscussyouroptions lectures atthedepartmentanytimeduringteaching but wanttobesure,youaremostwelcomeattend Musicat If youareconsideringstudying Trinity College – includes computer orientation, and computer orientation,and –includes –anintroductiontothewriting
Arts, Humanities and Social Sciences 97
TR009 10 450 B. Mus. Ed. Music education Music CODES: COURSE PLACES 2012: POINTS 2011: AWARDED: DEGREE entry course. Applications must This is a restricted 2013. be submitted by 1 February be submitted by 1 February of the Applications MUST to Applicants will be required proposed year of entry. provisionally scheduled attend an entrance examination, for 23 March 2013. results, some applicants On the basis of the examination April/May before an interviewattend during will be called to will feature as one final selections are made. Performance element of the interview. Garda Vetting: vetting. See Students will be required to undergo Garda page 26 for further details. See also: TR002: Music, page 95 Education, page 61 Course overview Is this the right course for you? Course content A basic feature of the course is personal development in music, basic feature of the course is personal development A of enthusiasm and interest the arouse to ability the evoking a at work ensemble in engage to encouraged be will You pupils. are perform to Opportunities ability. own your to appropriate level exceptionally the including all, for goals realistic offering provided, is teaching classroom of aspects all in practice Supervised gifted. provided, in addition to instrumental/vocal practice. There are approximately fifteen hours of lectures per week, comprising music and education. The Bachelor in Music education degree is designed to provide The Bachelor in Music education degree is of those wishing for the academic and professional requirements level (including to become music teachers at secondary-school taught in conjunction with The degree is Northern Ireland). Conservatory of Music and Technology, the Dublin Institute of Academy of Music. Drama, and the Royal Irish a high standard This four-year programme will equip you with of performance in your chosen instrument, as well as with an associated competence in related music skills, i.e. conducting, keyboard skills and performance in choral, orchestral and The course also provides for a solid chamber music groups. composition, orchestration, counterpoint, grounding in harmony, analysis and the history of music. If you enjoy music, already have an accomplished standard of performance, and wish to combine these qualities with a then this course will be ideally suited to you. teaching career,
(office hours: 1000-1630, Mondays to Fridays). Sonata structures opera Experimental theatre music and contemporary design Web Handel and the English oratorio of Gerontius The Dream Newman and Elgar, Film music in three parts Counterpoint and Fugue The German Lied 19th century in the Music and language of polyphonyByrd and the politics Further information Career opportunities Assessment Anyone considering studying Music is welcome to visit the the visit to welcome is Music studying considering Anyone of members to speak to lectures, on in sit to order in department, appointment, an make To students. current to speak to and staff, 1120; contact the Music Executive Officer: +353 1 896 [email protected] and of the Full details of the courses in Music, of the staff website: curriculum can be accessed via the Music Department’s c www.tcd.ie/Musi +353 1 896 1120 Tel: The employment record for Trinity College’s graduates in Music College’s Trinity The employment record for successful is excellent. Recent graduates have established for television, radio, careers as composers, as music producers and or recording companies, as performers, administrators recognised institutions teachers, as academics in internationally last few years several worldwide, and as conductors. Within the recent graduates have been commissioned by front-rank to write new works. Graduates organisations such as RTÉ are working in this country and in countries as diverse as the Australia, China and England. Music USA, Canada, Germany, graduates have an outstanding record of obtaining scholarships for further study abroad, from international institutions, as well smaller number have used A Arts Council of Ireland. as from the to the analytical and intellectual skills that these courses offer build successful careers outside music: recent examples include financial investment, and public relations. medicine, law, Most subjects are assessed by a combination of examination Most subjects are assessed by a combination n n n n (at the end of the year) and continuous assessment. n n n n n n All students may opt to present a recital for up to approximately a recital for up to approximately may opt to present All students Sophister students are also In each year, 10% of their degree. of option in either aural training or in the playing an offered either piano or harpsichord). In recent years, figured bass (using other options have included: in music technology you will produce a major project in the final a major project you will produce in music technology courses involves a range of in musicology Specialisation year. in a subjects, and culminates historical and analytical relating to in the fourth year. dissertation 98 Arts, Humanities and Social Sciences and alsoincountriessuchastheUSA,ChinaEngland. and publishing.Recentgraduatesareworkinginthiscountry performance, orinarangeofotherareasincludingcopyrightlaw either inrelatedareassuchasmusiceducation,musicology, music technology. Manystudents takepostgraduatecourses– academia, artsadministration,librarywork,musictherapyand to workinareassuchasorchestralandvocalperformance, some usethedegreeasageneralartsqualificationandgoon teaching –usuallyinschools,butalsotoinstrumentalteaching, education isexcellent.Whilemostofthestudentsgoonto The employmentrecordfor Trinity College’s graduatesinMusic Sophister (third)yearstudyingabroad. There areopportunitiesforstudentstospendpartoftheirJunior examinations andteachingpracticemakesuptheassessment. A combination ofcontinuousassessment,practicalandwritten n n n n n n n n n n n n n n n n n n Modules Include www.riam.ie www.dit.ie www.tcd.ie/Education/courses/b-mus-ed Music Educationco-ordinatorat +35318961145. speak tocurrentstudents. To makeanappointment,contact the the SchoolofEducation,tospeak tomembersofstaff, and to Anyone consideringstudyingMusiceducationiswelcometovisit Further information Career opportunities Study abroad Assessment Research methodsineducation Educational issues History ofeducation education Introduction toassessment&examinationsinpost-primary Sociologies ofeducation: Yesterday &today;Irelandtheworld &theory Educational philosophy ineducation Applied psychology practice Music educationandteaching Sociology ofmusic&education Music technology classformaininstrument Special repertoire Conducting Practical musicianship Irish music History ofmusic Composition skills Aural perceptionandkeyboard –individualtuition Instrumental/vocal performance you willfindthisastimulating and challengingcourse. questions lyingattheheartofour cultureinanarticulatemanner and inanalysingthemoral,political, aestheticandreligious If youareinterestedinquestioning society’s basicassumptions independently. both formalandinformalreasoningwillenableyoutothink influences on Western culture.Studying thefundamentalsof history ofWestern philosophy, andareoneoftheformative a solid,scholarlygroundingintheclassicaltextsthatform In allcasesthepurposeofPhilosophycourseistogiveyou that underliethesciencesandstandatbaseofaworld-view. philosophy remainthemostgeneralandbasic,issues argument andappealtofacts. The questionsaddressedby means “loveofwisdom.”Philosophyisbasedonrational on analogy, revelation,orauthority. InGreek,“philosophy” making nounexaminedassumptionsandleapsbasedpurely are, unlikethoseofreligionorsuperstition,weddedtoreason, than asetofclaims,propositions,ortheories.Itsinvestigations (logic). Itisgenerallyagreedthatphilosophyamethod,rather to be(ontology);andwhatarethecorrectprinciplesofreasoning knowledge (epistemology);whatexistenceisanditmeans their essentialnatures(metaphysics);whatcountsasgenuine one shouldlive(ethics);whatsortsofthingsexistandare Philosophy isthedisciplineconcernedwithquestionsofhow What isPhilosophy? Is thistherightcourseforyou? Course overview page 99. four-year degreeprogrammeorforashorterperiod,see In TR015 itispossibletostudyphilosophyfortheentire may becombined. page 36foralistofthesubjectswithwhichPhilosophy and anhonorsdegreeisawardedinbothsubjects.See within thetwo-subjectmoderatorship(TSM)programme, honor course.Itmustbecombinedwithoneothersubject TR001 (TSM)Philosophycannotbestudiedasasingle In TR005 Philosophyisstudiedforfouryears. Science, EconomicsandSociology(TR015)programme. programme (TSM/TR001)andinthePhilosophy, Political (TR005), withinthe Two SubjectModeratorship Philosophy maybestudiedasasinglehonorcourse TSM points: DEGREE AWARDED: POINTS 2011: PLACES 2012: COURSE CODES: Philosophy See page27 B.A. 430 20 TR005 430*-565 43 TR001 (TSM) Arts, Humanities and Social Sciences 99
Mathematics Mathematics TR015 34 525* B.A. Grade B OC3/HD3
Philosophy, political science, economics and sociology COURSE CODES: PLACES 2012: POINTS 2011: AWARDED: DEGREE Special Entry Requirements: Leaving Certificate GCSE See also: TSM, page 36 TR001: page 98 TR005: Philosophy, 75 TR012: History and political science, page TR020: Law and political science, page 94 page 102 TR029: Political science and geography, TR081: BESS, page 37 page 113 TR083: Sociology and social policy, Course overview Is it the right course for you? The aim of this degree is to provide a coherent and integrated The aim of this degree is to provide a coherent and philosophy. introduction to the study of the social sciences approaches It brings together some of the most important developing to understanding the social and human world, The activities. skills for a whole range of future careers and social idea behind the programme is that, to understand them from and human phenomena, one must approach and analytical several complementary disciplinary directions frameworks. By allowing a gradual specialisation over the course of the four-year degree programme, students are assured of obtaining an excellent grounding in one, or at most two, of the disciplines which make up the degree. In the first three years you take six modules with approximately three teaching hours per week including tutorial classes in each. In the final year there is a reduction in the number of modules taken to recognise the greater commitment to independent work. This course will appeal to students who are excited about the challenges of understanding the way societies are organised, governed and create wealth drawing on the methods and you are puzzled about the If insights of philosophical inquiry. ways our world is structured and have a desire to change it, then this may well be the course for you.
p Trinity College is the only university in Ireland where Trinity philosophy can be taken as a degree course on its own. George Berkeley (1685-1753), who has a permanent place in any list of the great philosophers, attended In addition, the political philosopher, College. Trinity Edmund Burke (1729-1797), inaugurated the College College. Trinity debating society while still a student at n Did you know? n Further information Career opportunities Assessment Course content Course Tel: +353 1 896 1529 Tel: www.tcd.ie/Philosophy/teaching/undergrad.ph In the recent past graduates of Philosophy have worked in areas In the recent past graduates of Philosophy teaching, journalism, law, academic as diverse as accountancy, reporting and research, film making, banking, computing T.V. and advertising. Each year some graduates also opt to pursue a research career beginning with postgraduate study in Ireland or abroad. Assessment is by means of both essays and formal Assessment is by means of both essays and to both. In the Senior examinations with equal importance given you will research and write a dissertation. Sophister year, The Sophister years and Senior In the final two years, called Junior Sophister you are able to set your own syllabus by selecting Sophister, political courses from a reasonably wide choice including religion, and philosophy of ethics, philosophy of philosophy, in the areas mind, among others. In this way you can specialise and most suitable of philosophy you have found most interesting to your skills. In the TSM programmes where philosophy is studied with programmes where philosophy is studied TSM In the are approximately five hours of classes another subject there The Freshman years The Freshman Senior Freshman and two years, called Junior In the first foundation courses in the history Freshman, you will study as well as engage with certain fundamental of philosophy, such as the debates about free will and philosophical problems the nature of language, of morality, determinism, the nature logic, and the scope and limits of human the existence of God, knowledge. per week; with double that for the single honor programme. per week; with double 100 Arts, Humanities and Social Sciences the second,third andfourthyears. The table‘PPES ataglance’ (seeabove) givesyouasenseofthe richnessanddiversityofmodules thatareavailablewithinPPES in PPES ataglance European politics,toanintroductionsocialresearch. from economicprinciples,tothehistoryofphilosophyWest of thesubjectsandcould,forexample,takemodulesranging Senior Freshman(second)yearyouchoosetocontinuethree science) andsociology(introductiontosociology).Inthe history ofphilosophy),politicalscience(introductionto and statistics),philosophy(centralproblemsinphilosophy, subjects: economics(introductiontoeconomics,mathematics In theJuniorFreshman(first)yearyouwilltakeallfour The Freshmanyears Philosophy Sociology Economics science Political Course content n n n n n n n n n n Year 2(6modules) Comparative politics International relations History ofpoliticalthought History ofphilosophy science Logic &philosophyof research Introduction tosocial European societies Gender, cultureandsociety methods Mathematics andstatistical Intermediate economics n n n n n n n n n n n n n n n n n n n n n n n n n n Year 3(6modules) Researching society Researching Globalisation and development Race, ethnicityandidentity inequality Social theoryandsocial Econometrics economics Mathematical Industrial economics Economics ofpolicyissues Investment analysis countries Economics oflessdeveloped economy The European Money andbanking Economic analysis Politics European Union Democracy anddevelopment USA Government andpoliticsofthe Irish politics Research methods philosophy Topics inContinental Logic andphilosophy ofreligion Philosophy Moral philosophy Topics philosophy inanalytic philosophy Topics inpsychological Topics inancientphilosophy Political philosophy enquiry. to helpdevelopresearchskillsandtheofindependent all fourthyearmoduleshaveelementsofprojectworkintended year willbeabletopursueanundergraduatedissertation,and pursuing theequivalentofsinglehonorprogrammesintheirfinal either twosubjectsorchoosetospecialiseinonlyone.Students subjects andintheSeniorSophister(fourth)yearyoumaytake In theJuniorSophister(third)yearyoutaketwooffour The Sophisteryears requirements) Philosophy handbookfor Sociology. Pleaseconsultthe Political science,Economicsor Year 4(4modulesifyouselect n n n n n n n n n n n n n n n n n n n n n n n n n n n n n n n Psychology/philosophy Phenomenology Ethics Ancient philosophy Dissertation Migration Popular cultureanddigitallives Conflict studies ofEurope Economic sociology Economics dissertation competition legalaspectsof Economic and Monetary thoughtandpolicy Quantitative methods International economics Transport economics Economics offinancialmarkets Economic theory inequality The politicsof Comparative politicalreform African politics internationalrelations Contemporary Issues incontemporarypolitics Political parties politicaltheories Contemporary Research seminar General paper dissertation Philosophy Post Kantianphilosophy Epistemology oflanguage Philosophy Metaphysics Arts, Humanities and Social Sciences 101 Political science Political through five degree may be studied Political science programmes: science, page 75 TR012 History and political political science, economics and TR015 Philosophy, 99 sociology (PPES), page science, page 94 TR020 Law and political page 102 and geography, TR029 Political science and social studies (BESS), TR081 Business, economic page 37 Is this the right course for you? What is Political science? What is Political Politics in the modern world touches everybody in nearly every aspect of their life. If you want to raise your knowledge beyond the study of political science will give the level of public affairs, you the necessary tools. Political science is the field concerning the theory and practice Political science is the field concerning the of political systems of politics and the description and analysis us all in our daily lives. Politics affects and political behaviour. easy to think of issues that we all have opinions about. It’s greater Should government tax the rich to try to achieve in order to protect equality? Should it introduce ‘green taxes’ have to pay fees? the environment? Should third-level students amount of money the Should abortion be legalised? Should the back drastically? EU spends on the agricultural sector be cut All of these be? How high a priority should third world aid process. questions will be decided through the political involves, among The study of politics as an academic subject get made. If other things, thinking about how these decisions not possible to keep everyone happy when some issue has it’s If governments to be decided, whose views prevail and why? most ‘rational’ do not always make what seems to be the issue, why not? decision on economic policy or some other policy-making, and How much say do ordinary people have in process more open? is it feasible to make the decision-making want, or are they Can governments do pretty much what they groups, the so constrained by other actors such as interest courts, the European Union, the constitution, and the sheer pressure of events, that in practice they have very little freedom of manoeuvre? Questions such as these are at the heart of the study of politics. And, taking a step back from the debates of contemporary politics, political theorists ponder more fundamental questions, questions – rather to do with normative issues – the ‘should’ These days, pretty than ones that can be resolved by evidence. much everyone is in favour of justice and democracy – but what what would do these terms mean? If a society is to be run justly, this entail? Such topics have been discussed since the time of the ancient Greeks. S This degree programme is unique in Ireland in offering is uniqueThis degree programme in Ireland in offering and a dedicated introduction to the social sciences philosophy. n Did you know? Further information Career opportunities Assessment Tel: +353 1 896 1840 Tel: www.social-phil.tcd.ie/PPE The range of disciplines to which students are exposed in The range of disciplines the insights and competencies to pursue this degree give you areas including public administration, careers in a variety of media, law and management. teaching, journalism, Modules are examined by a combination of continuous of continuous examined by a combination Modules are and formal examination. assessment 102 Arts, Humanities and Social Sciences politics degree,youcouldevengetelectedasa TD! to dofurtherstudybymeansofpostgraduatework. And, witha many typesofcareer. An increasingnumberofgraduatesgoon knowledge ofhowtheworldworksisobviouslyanassetfor profit organisation,allcomeintothiscategory. A demonstrated work ininternationalorganisationssuchastheEUoranot-for- in businessthatrequiresknowinghowgovernmentworks, kinds ofmediawork,thecivilservice,publicrelations,anything a definiteplusandgivesyourealheadstart.Journalism,other There arecareersforwhichademonstratedinterestinpoliticsis Sophister (third)year. have theoptiontogoabroadforallorpartoftheirJunior exchanges withuniversitiesinFranceandSwitzerland.Students The DepartmentofPoliticalScienceisapartnerinErasmus Sophister yeartoallowtimeformoreindependentwork. tutorial perweek.FewerlecturehoursarerequiredintheSenior Normally, eachcoursehastwohoursoflecturesandone dissertation onatopicofyourchoice. year youwillhavetheopportunitytoresearchandwriteupa and formalexamination.IntheSeniorSophister(fourth) Courses areexaminedbyacombinationofassessedessays geography; andBusiness,economicsocialstudies(BESS). (PPES); Lawandpoliticalscience;Politicalscience science; Philosophy, politicalscience,economicsandsociology See theindividualcoursedescriptionsforHistoryandpolitical Tel: +35318961651 www.tcd.ie/Political_Science/undergraduate/index.ph Further information Career opportunities Study abroad Assessment Course content n Did youknow? University Rankings2011). Politics &InternationalStudies(bytheQSWorld Trinity 45thintheworld Dublinisranked College p the developingworldasaresultofclimatechange. the problemsoffuture,suchaspoliticalinstabilityinparts environmental issuesarebecomingincreasinglykeyinsolving of globalisation,interdisciplinaryunderstandingssocio- influence otherpartsoftheplanet.However, inacontext and throughgeo-politics,whichexamineshowthegreatpowers covers geographicaldifferences invotingpatterns,forexample, associated throughthesub-fieldsofpoliticalgeography, which variations andcomplexities. The twodisciplineshavebeen combines analyticalrigourwithanunderstandingofreal-world global problemsandprovidepolicysolutions. This course geography arebecomingincreasinglyimportanttoanalyse and environmentalcontextthetoolsofpoliticalscience In arapidlychanginginternationaleconomic,political,security depth ofstudyandmoreindependentwork. a reductioninthenumberofcoursesrequiredtoallowgreater tutorial perweek.IntheSeniorSophister(fourth)yearthereis require attendance,onaverage,of two hours of lectures andone In thefirstthreeyearsyouwilltaketwelvecoursesthateach phenomena anditspoliticalinstitutionssystems. of therelationshipbetweenEarth’s natural andhuman and geographyyouhopetodevelopacriticalunderstanding Yes, ifyouareinterestedinthedisciplinesofpolitical science Course overview Course content Is thistherightcourseforyou? TR081: BESS,page37 TR071: Science,page140 TR020: Lawandpoliticalscience,page94 sociology, page99 TR015: Philosophy, politicalscience,economicsand TR012: Historyandpoliticalscience,page75 TR001: TSM, page36 See also: TSM points: DEGREE AWARDED: POINTS 2011: PLACES 2012: COURSE CODES: geography and science Political See page27 B.A. 475 20 TR029 Arts, Humanities and Social Sciences 103 p p Assessment Career opportunities Further information Study abroad Courses are examined by a combination of continuous Courses are examined by a combination of assessment and formal examination. Careers for graduates lie in fields such as public and European overseas assistance, resource management and affairs, risk assessment, the supply of environmental-related advice the study and practice of to governments and industry, environmental policymaking, and teaching and higher education. www.tcd.ie/Political_Science/undergraduate/polscigeog.ph +353 1 896 1576 Tel: www.tcd.ie/Political_Science/undergraduate/index.ph +353 1 896 1651 Tel: There are opportunities for students to spend all or part of the There are opportunities for students to spend France, the third year studying abroad in the United Kingdom, in these Netherlands, Sweden, Poland or Spain. Participating fulfilling the opportunities is dependent upon the exchange course requirements of both departments. www. www.tcd. p for those www.tcd.ie/Political_ y for more information). For those students In the Senior Sophister (fourth) year, students may take both In the Senior Sophister (fourth) year, subjects equally or one subject alone. For students taking geography or political science as their sole subject in this year The geography a research thesis or dissertation is compulsory. dissertation will not be required, but may be taken as an option by students continuing to study politics and geography equally in See www.tcd.ie/Geography/undergraduate/ their fourth year. for Senior modules/year4 to view the current courses offered Sophisters (fourth-year students) in geography and The Senior Sophister year tcd.ie/Geograph planning to continue geography in the Senior Sophister (fourth) methods in Advanced research year as their sole subject, the political-science side, On geography is also compulsory. students may take any three options (see Science/undergraduate/timetable.php to view the courses students intending to take political science currently offered); alone in the fourth year must take Research methods for political scientists in their third year. ie/Political_Science/undergraduate/timetable.ph in political science. offered In the Junior Sophister (third) year students take each subject In the Junior Sophister (third) year students two courses are mandatory On the geography side equally. a list of options. with the other four courses being drawn from The mandatory geography courses are Geographic information systems, and History and philosophy of geography (see The Junior Sophister year The Freshman years and Senior In the first two years, called Junior Freshman covering (i) Freshman, you will study foundation courses Introduction to geography I (Physical), II (Human-environment) and analysis of and III (Human); Changing worlds; Collection (ii) Introduction geographical data, and Geography seminars; Introduction to to political science, Introduction to sociology, politics, International relations and Comparative economic policy, the History of political thought. 104 Arts, Humanities and Social Sciences and Socialpsychology. Cognitive, Developmental, Personality and individual differences, There arefivethematicareasinpsychology:Biological, processes, individualdifferences andsocialpsychology. human development,perception,learning,motivation,cognitive addition tothemorefamiliarpsychologicaltopicssuchas physiology ofthehumanbrain,forinstance. These arein description andanalysisofdatacoursesontheunderlying the featuresofasciencecourse–practicalwork,statistical Humanities andSocialSciences,Psychologyhasmanyof mental processes. Although taughtintheFacultyof Arts, Psychology isthescientificstudyofhumanbehaviourand clinical andcounsellinginterventions. provides supportforfamiliesin their sociallifeandwork,though that dealswithhowpeopleact and behaveintherealworld.It different spheresoflife.Psychologyisalsoanappliedscience and ingroups.Suchabilitiesarehighlytransferabletomany influencing humanthinking,feelingandbehaving,asindividuals educates andtrainsstudentstobeawareofthefactors and solveproblemsincomplex,changingsettings.Psychology rigorous thinking,numeracyandtheabilitytodefine,study careers. Psychologyisabranchofsciencethatdemandsclear, psychology, butalsopreparestudents intellectuallyforother that notonlyequipstudentsforthemanycareersexistin levels, andaimstooffer a knowledgebaseandasetofskills is committedtoexcellenceineducationandtrainingatall groups, youwillenjoythiscourse. The SchoolofPsychology human thinking,feelingandbehaviour, asindividualsandin the lifesciences.Ifyouareinterestedinfactorsinfluencing Psychology isarigorous,fascinatinganddemandingfieldof Is thistherightcourseforyou? What isPsychology? the singlehonorprogramme. of psychology, theworkloadislessextensivethanthatof However, while TSM studentscoveralltheprincipalareas Single honorand TSM studentsfollowthesamecourses. combine withPsychologyseepage36. degree isawardedinbothsubjects.Forsubjectsthat programme. TSM isajointhonorprogramme. An honors other subjectwithinthetwo-subjectmoderatorship(TSM) TR001 (TSM)–Psychologymaybecombinedwithone psychology isreadalmostexclusivelyforfouryears. TR006 –Psychologyisasinglehonorcoursewhere TSM points: DEGREE AWARDED: POINTS 2011: PLACES 2012: COURSE CODES: Psychology See page27 B.A. 545* 31 TR006 560*- 565 17 TR001(TSM) in arangeofareassuchas: As aFreshmanstudent,youwilltakefoundation-levelmodules and todevelopindependent,criticalthinking. required towriteessays,developanattitudeofscepticism skills isalsoprovidedwhichenableyoutobuildthe research skillsinasystematicfashion. Training inacademic methodology andstatisticsenablestudentstodeveloptheir the Sophister(thirdandfourth)years.Inaddition,modulesin foundation onwhichmoreadvancedcourseworkisbuiltin both thesinglehonorand TSM programmesprovideabroad The JuniorandSeniorFreshman(firstsecond)yearsof The Freshmanyears tuition suchaslectures,seminarsandlaboratorypracticals. 10-12 hoursperweek(5-6for TSM students)receiving During lectureterm,singlehonorstudentsspendapproximately or aproductivecareer. directly toadvancedpostgraduatework,professionaltraining and research,enablingthesuccessfulgraduatetoproceed designed tocultivateahighlevelofcompetenceinscholarship presentation skillsandself-assessment. This preparationis to developcompetenceingroupwork,communicationand design, execution,reportingandassessmentofresearch problem-solving andcomputeruse;toprovidepracticeinthe synthesis, researchdesign,statisticaldescriptionandevaluation, contemporary psychology;todevelopskillsofanalysisand the concepts,principles,theoriesandresearchmethodsof The courseisdesignedtodevelopawideknowledgeof literature searching. description and analysis andkeyresearch-related skills,suchas areas ofpsychology. Otherpracticalsconcentrateonstatistical hands-on experienceofcarrying outresearchindifferent the practicalsarerelatedto foundationcoursesandprovide conducting andcommunicating yourownresearch.Someof which psychologyisbasedand willprepareyouforplanning, research methodologies(qualitative andquantitative)upon years. These willenableyou tounderstandthedifferent include laboratorypracticalsareprovidedintheFreshman Modules inresearchmethodsandstatisticalanalysis,which practicals laboratory and statistics methods, Research n n n n n n n n n n from theBroadCurriculumoptions(seepage14). You willalsobegiventheopportunitytotakeamodule/modules Course overview Personality and individualdifferencesPersonality and Evolutionary psychology andbehaviour ofneuroscience Fundamentals Cognition psychology Developmental disorder Psychological History ofpsychology Perception Social psychology Introduction topsychology
Arts, Humanities and Social Sciences 105 Rationality and reasoning Creativity and imagination Cross-modal cognition Development throughout of perception the lifespann Clinical cases Advanced individual differences Embodiment Human sexuality Health psychology Career opportunities Many psychology graduates proceed to a career in professional psychology through professional training or higher education in The School of Psychology offers areas related to psychology. a range of postgraduate programmes including professional doctorates in Clinical psychology and Counselling psychology, Applied behaviour Applied psychology, Masters courses in analysis and Clinical supervision, a postgraduate diploma in Applied behaviour analysis as well as research M.Sc. and the advanced understanding of PhD degrees. However, human behaviour and experience and the wide range of skills developed during the course have allowed students to enter many professions, ranging from management, marketing, broadcast media, to journalism, advertising and accountancy, teaching and recruitment. Seminars about career development will be provided by the School during the course of your degree. n n n n n n n n n COGNITIVE DIFFERENCES AND INDIVIDUAL PERSONALITY Child development in changing family contexts Debates in child psychology Language and language disorders Applied issues in developmental psychology Culture and health Theory and measurement The social self: Organisational psychology Social neuroscience Neurological rehabilitation Behavioural neuroscience synaptic plasticity and the brain Memory, Clinical and experimental neuropsychology SOCIAL DEVELOPMENTAL Study abroad Assessment n n n n n n n n n n n n BIOLOGICAL In the Senior Sophister (fourth) year a large part of your workload involves carrying out an independent research project under the part of your workload involves carrying out an independent research project under In the Senior Sophister (fourth) year a large you choose to investigate will coincide with your supervisor’s the topic research own Typically, supervision of a member of staff. while of an active and accessible research group. Many students report that this project, work, giving you all the benefits and support challenging, is one of the most rewarding parts of the course. As a Junior Sophister (third) year student you will carry out a group research project on an important community-based psychological you will carry out a group research project on an important community-based psychological As a Junior Sophister (third) year student psychology of working with a range of research methodologies in This will give you experience of working as a team member, issue. own talk directly about their staff in which of seminars in the Junior Sophister year, series A and of presenting psychological research. of the research process. research, gives you a first-hand account Second and third-year undergraduates are eligible to apply to study for one or more terms (students usually go for a whole academic year) in certain other European psychology schools, with travel, and where appropriate, some subsistence funding There are no basic course provided by the EU Erasmus fund. Assessment is carried out in the host charges to be paid abroad. TCD as if students (i.e. foreign) institution and is accepted by This School has bilateral agreements with were examined here. several European universities where arrangements have been made for students to study. A combination of end-of-year written examinations and combination of end-of-year written examinations A you will also continuous assessment is used. In your final year, submit a report of your research project. On completion of the Sophister years, students must have taken at least one module from each of the five specified thematic areas. at least one module from each of the five Sophister years, students must have taken On completion of the within each of these areas: offered the kind of modules which have been The following table shows The Sophister years The Sophister you and you will of particular interest to psychology that are areas within you will have identified Sophister (third) year By the Junior modules, you a number of core advanced years. In addition to the Sophister these interests throughout to develop have the opportunity the understanding of you to gain a deeper modules will allow These optional of advanced options. modules from a series will choose help you to you select may also The options is carried out. ways in which research and the different of psychology various branches TSM students majoring in Psychology Single honor students and if it is to be in psychology. your future career, make decisions about in research methods and statistics. also take additional modules 106 Arts, Humanities and Social Sciences Tel: +35318961886 www.psychology.tcd.ie psychology for2yearsandoccupational1year. and counsellingpsychologytypicallylastsfor3years,health further trainingatpostgraduatelevel.Forexample,clinical Progression intotheprofessionofpsychology, however, requires years) arenoteligibleforgraduatemembershipofthesociety. for whom Psychology is the minor subject (studied for only three membership of the Psychological Society of Ireland. TSM students student majors in Psychology) both confer eligibility for graduate The single honor degree and the TSM degree (where the Further information professional qualifications and degree Psychology n Did youknow? See www.psychology.tcd.ie particularly inthethirdandfourthyearsofCollege. become activelyinvolvedinourongoingresearch, College’s campus).Studentsareencouragedto for InnovativeHumanSystems(allbasedon Trinity Institute, CentreforGlobalHealth,andthe the Children’s ResearchCentre,Neuroscience collaborates withanumberofotherdisciplinesthrough high-quality teaching,theSchoolofPsychology World UniversityRankings2011. As wellasoffering the toptenSchoolsofPsychologyinEuropeQS Trinity College’s SchoolofPsychologywasrankedin
of theCatholicintellectualtraditioninaglobalisedworld. understanding toparticipateincurrentdebatesabouttheplace documents. Studentswillbeprovidedwiththeskillsandethical the studyofitsorigins,formativeperiods,andfoundational and culturaltraditionthecriticalissuesthatarisein students withknowledgeoftheCatholictheological,intellectual lives. Catholictheologicalstudiesisdesignedtoprovide existence, theworldweliveinandroleofreligionour those whostudyittothinkcriticallyaboutGod,human Theology isafascinatingandvitalsubjectthatchallenges annual examinations. Assessment will beby1,500wordessays,in-course testsand research dissertation. disciplines andaregivenappropriateguidanceinwritinga students haveoptionsforthestudyofadvancedtopicsinthese studies inLatin,GreekorHebrewisoffered. Inthefourthyear the agesisasignificanttheme. The possibilityoflanguage of theculturalexpressionsCatholicChristianitythrough deeper studyofthesubjectmatterthesedisciplines. A study the secondandthirdyearstudentsengageinaprogressively different academicapproaches tothestudyofreligiontoday. In There isalsoanintroductiontophilosophyandthemany the New Testament), theological ethicsandliturgicaltheology. include, amongstothers,Biblicalstudies(HebrewBibleand disciplines thatmakeupCatholictheologicalstudies. These In thefirstyearstudentsareintroducedtovarietyof stimulating andchallengingcourse. questions lyingattheheartofourculture,youwillfindthisa are interestedinanalysingthemoral,religiousandpolitical other livingfaiths,thisiscertainlythecourseforyou.Ifyou ethical andculturaltraditionsindialoguewithpeoplesof seek asophisticatedengagementwithCatholicintellectual, concerning Godandhumanitythisisthecourseforyou.Ifyou If youhaveinterestinsomeofthemostprofoundquestions Course overview Assessment Course content Is thistherightcourseforyou? TR008/001: TR001: See also: DEGREE AWARDED: POINTS 2011: PLACES 2012: COURSE CODES: studies theological Catholic World religionsandtheology, page107 Jewish andIslamiccivilisations,page86 B.A. n/a 15 TR030 Arts, Humanities and Social Sciences 107 TR001 (TSM) 24 390*-565 TR008 29 345 B.A. See page 27 World religions and and religions World theology CODES: COURSE PLACES 2012: POINTS 2011: AWARDED: DEGREE TSM points: single honor Theology is a Religions and TR008 – World and theology is read almost course where world religions exclusively for four years. must be Theology (TSM) Religions and TR001 – World two-subject combined with one other subject within the TSM is a joint honor moderatorship (TSM) programme. An honors degree is awarded in both programme. religions subjects. For subjects that combine with World and theology see page 36. follow the same principal TSM students Single honor and TSM The range of courses undertaken by subjects. is less extensive. students, however, See also: 86 TR001: Jewish and Islamic civilisations, page 106 TR030: Catholic theological studies, page Course overview Is this the right course for you? This subject studies religion both as a cultural force that influences influences that force cultural a as both religion studies subject This as particular traditions,worldviews, practices, and institutions, and have that religions monotheistic the on focus special a with of their self- The development cultural history. shaped Western helped and encountered they cultures the within understandings of variety The setting. non-denominational a in studied are create and origins their texts, biblical as well as religion to approaches the to antiquity from reception and translation of histories their present age are core areas of inquiry. Major areas of interest continue to be the roots of Western culture and the history of reception of biblical monotheism in eras as a factor in shaping European world views, different practices and institutions. The study of religions, of the origins and reception of biblical monotheism and of theological thinking that linked it to the philosophies of each era has never been more relevant than it globalised world. In taking this arts degree you will is in today’s engage in broad introductions as well as in depth analyses of examine them. approaches used to the religious traditions and of disciplines, will get to know the contributions of different You sociology, philosophy, philology, archaeology, such as history, literary and cultural studies, and be able to trace major culture from its roots in antiquity transformations in Western Contemporary debates on issues such as to the present day. science and religion, ethics, and politics are treated in a non- do not presume that you have any denominational context. We previous knowledge of the subject.
e Further information Career opportunities Career Further information can be found on the Loyola Institute website: Further information can be found on the Loyola If you are considering studying Catholic theology you are If you are considering of the the Director Cornelius Casey, welcome to contact Dr. e Loyola Institute: [email protected] www.tcd.ie/loyola-Institut Graduates in theology find employment in fields such as in fields such in theology find employment Graduates the management, the church, social work, business education, and personal The skills sector. arts and the charity performing over the course of their studies are easily qualities they develop clearly, Thinking of jobs and careers. transferable to all sorts arguments, analysing texts, assessing writing well, presenting organising research: these are all skills evidence, pursuing and of life. well in all walks that serve students’ 108 Arts, Humanities and Social Sciences n n n n n n n n n n n n n n n n n n In yourfirstyearyouwillstudyarangeofintroductorycourses: (three for TSM students). addition theysitendoftheyear examinationsforsixcourses depending onwhethertheychoose alanguagemodule.In Students writebetweenfiveto six essayspersemester n n n excursions abroad. in livelyCollegesocieties(e.g.the Theological society“Theo”)to of extracurricularactivitiesisavailablerangingfromparticipation destination centraltothehistoryofreligioustraditions. A range (e.g. theChesterBeattyLibrary),museums,andothercultural theatre andlibraries,butalsoenjoyexcursionstolocallibraries Students notonlyencounterreligiousculturesinthelecture Senior Sophister(thirdandfourth)years. These include: Students haveavarietyofsubjectchoicesintheJuniorand course (seepage14)foroneofthesehalfyearcourses. Students inthesecondyearmaysubstituteaBroadCurriculum subjects suchas: discovered inyourfirstyear. Studentsmaychoosecourseson of coursesdependingontheindividualinterestsyouhave From thesecondyearon,youmaychoosefromarange Assessment Course content The Bible and art The Bibleand andecology Theological ethics (thetheoryandpracticeofinterpretation) Hermeneutics Reformation andEnlightenment responses Ethics inmodernityandtheological Christology earliest historyofChristianity) The New Testament andEarlyChristianity(origins their Ancient NearEasterncontexts) approachestotextsand (historicalandliterary Hebrew Bible suchashumancloning includingissues Biomedical ethics, toGod andtheologicalapproaches Philosophical histories traditionsandtheir Asian religious thought Key controversiesinWestern andphilosophical religious Islamic thinkersintheMiddle Ages Jewish,Christianand debatesbetween The theological Greek andHebrew especially Ancient languages, Judaism,Christianity,The originsof andIslam. Approaches tothestudyofreligion fromthefirsttotwenty-firstReligions century The faithsintheirhistoryoftradition Abrahamic Introduction totheology Introduction toBiblicalstudies Introduction toWorld religions department whichisrelativelysmallandstudentcentred. have ampleopportunitytodevelopalloftheseskillswithina work andproblemsolving.Studentsofreligionstheology as goodoralcommunication,writtenteam for theposition,personalqualitiesandtransferableskillssuch looked forinartsgraduatesandtopofthelistcame:enthusiasm Advisory Servicerecentlysurveyedemployersaboutwhatthey first tieruniversitiesaroundtheworld. Trinity College’s Careers graduates goonforpostgraduatestudiesat Trinity Collegeand archaeology, tourism,lawandpsychology. Manyofour have includedcareersinpublishing,media,business,education, of careersasotherartsgraduates.Overrecentyearsthese potential employers,andourgraduatespursuethesamekinds and business.Graduateshaveskillswhicharehighlyvaluedby making, humanresourcesandhealthcareprofessions,law those whopursuecareersinmedia,education,publicpolicy societies present. This understandingisofparticularvalueto of thechallengesandopportunitieswhichmulti-cultural types ofcareers.Studentsgraduatewithanunderstanding different societiesintheglobalcommunityisanassetformany College. A knowledgeofthecultures,valuesandhistories and sharesmanyfeaturesofotherartsdegreesin Trinity The courseinWorld religionsandtheologyisanartsdegree TCD students,e.g.intheUSandCanada. University ofGlasgowinScotlandorotheruniversitiesopento spend uptoayearattheUniversityofLeuveninBelgium, A studentexchangeprogrammeoffers youtheopportunityto Tel: +35318961297 www.tcd.ie/Religions_Theolog Career opportunities Study abroad Further information y Arts, Humanities and Social Sciences 109 Trinity College is the only university in Ireland where Trinity you have the opportunity to study Russian to degree level. Russian language: in reading, writing, develops fluency speaking and listening Russian literary studies and cultural and RussianCentral, East European area studies Did you know? n Further information Study abroad Career opportunities Assessment In the first two years there are approximately ten hours of class there are approximately ten hours of class In the first two years between language work and literary, time per week, divided cultural or area studies. n www.tcd.ie/Russia +353 1 896 1896 Tel: Assessment is by a combination of continuous assessment of Assessment is by a combination of continuous in addition to your language work, language tests and essays, each year. written and oral examinations at the end of to spend up to a year studying in Russia will be encouraged You minimum period after second or third year (2 months is the College has close connections with universities Trinity abroad). a number of St. Petersburg and in and institutes in Moscow, provincial towns. Career paths followed by recent graduates include: arts and media; education; business, finance and marketing; civil and public service; international organisations (UN, EU, NGOs) and the diplomatic corps; journalism and tourism. Each year some graduates also opt to pursue a research career beginning with postgraduate study in Ireland or abroad. The Freshman years The Freshman three years, classes cover (first and second) In the Freshman main areas: n n n years The Sophister (third the Sophister language study, In addition to advanced a wider range of subject and fourth) years of your course offer reflect your own choices, allowing you to choose options that These include Russian literature, history of particular interests. and politics, and Russia and the Soviet Union, Russian society Russian in your final the Polish language. If you elect to study on a subject year you will also research and write a dissertation of your own choice. other than English other than English In a language In a language TR001 (TSM) 36 405-535* B.A. See page 27 HC3 Grade C Leaving Certificate Advanced GCE (A-Level) COURSE CODES: COURSE PLACES 2012: POINTS 2011: AWARDED: DEGREE Russian TSM points: Special Entry Requirements: See also: French/German/ TR024: European studies – Russian with Italian/Polish or Spanish, page 64 41 TR087: Business studies and Russian, page 41 TR089: Business studies and Polish, page Russian (TSM) cannot be studied as a single honor Russian (TSM) cannot be studied as a single subject within course. It must be combined with one other TSM is the two-subject moderatorship (TSM) programme. awarded in An honors degree is a joint honor programme. both subjects. page 36. For subjects that combine with Russian see Course content Is this the right course for you? Why study Russian? In addition to language study, you will take courses on aspects In addition to language study, of Russian literature, Russian history and Russian culture, society and politics. In later years, you will also have the option to study the Polish language and other Slavonic languages. Most students start Russian from scratch with an intensive first year language course. Special provisions are made for students with prior knowledge of Russian (heritage speakers, near-native speakers or those who have an entrance qualification in Russian). You will find the Russian programme exciting and rewarding if You in unfamiliar cultures, are interested you enjoy language study, have a sense of adventure and are not afraid of a challenge. million people Russian is the native language of nearly 150 Today languages. most important and is one of Europe’s in which the adoption of Russia is a rapidly changing society, have created a market economy and principles of openness Trinity and travel for unprecedented opportunities for work, study writers, musicians College students and graduates. Russian and artists have made a considerable contribution to European culture; Russian history has helped shape Europe as we know it present helps understand the past and today: exploring Russia’s and western traditions. eastern interaction between Europe’s 110 Arts, Humanities and Social Sciences Russian market.” Total, theFrenchoilmajor, withanincreasingfocusonthe oil andgasindustry. IcurrentlyworkintheLondonofficeof interest inRussiaservedtofocusmycareerchoiceonthe attached totheEuropeanCommission. After this,my additional 18monthswithachamberofcommerce Finishing Trinity IreturnedtoMoscowworkforan of mylife. and itwasoneofthemostinterestingexcitingyears studying inMoscow. Ilearntsomuchwhenwasthere, Russian speakingget-togethers.Ispentmythirdyear different aspectsofRussiansociety, togetherwithinformal to languageclasses,therewereexcellentintroductions means small,oftenquitepersonalisedclasses.Inaddition really knowwhattoexpect.StudyingRussianat Trinity possibly tospendanacademicyearthere.ButIdidn’t would givemetheopportunitytolearnaboutRussiaand only universitytooffer RussianandIknewstudyingthere from studyinghistoryinschool.Iknew Trinity wasthe Additionally, IalwayshadaninterestinRussia,stemming engineering there,whileIwasstilldoingmyLeavingCert. as thefactthatmybrotherreallyenjoyedstudying Trinity foramixofreasons.Someprettyidealistic such “To behonestwhenfillingoutmyCAOformsIchose Nicholas Browne Graduate Profile services. across abroadrangeofstatutory, voluntaryandcommunity proactive socialworkerwhowillmakeasignificantcontribution programme whichaimstohelpyoubecomeareflectiveand Health andSocialCareProfessionalsCouncil).Itisanintensive Registration Board,whichisundertheauspicesofCORU(The professional socialworkqualificationbythenationalSocial Work degree insocialstudies(B.S.S.)whichisalsorecognisedasa This degreeoffers youtheadvantageofachievinganhonors social workqualification. students straightfromLeavingCertificatethroughtoa range ofroutes.ItistheonlydegreeinIrelandthattakes This four-yearprogrammeadmitsstudentsthroughadiverse during firstyeartobuildyourconfidence andhelpyoutoapply we askyoutodo30hours(2-3 hoursperweek)volunteerwork had norelevantpracticeexperience beforestartingthedegree, classes andseveralhoursinthe libraryeachweek.Ifyouhave are approximately12-14hours in lectures,3-4hourstutorial or Germanarealsoavailable(see page14).Infirstyear, there policy andpoliticalscience.OptionalcoursesineitherFrench social work,psychology, social policy, sociology, economic Junior Freshman(firstyear)subjectsincludeintroductionsto The Freshmanyears personal andpracticeexperience. Teaching methodsarevariedandinteractivedrawonyour the numberofsocialworksubjectsinfollowingthreeyears. subjects intheJuniorFreshman(first)year, andthenincreases This courseintroducesyoutoawiderangeofsocialscience they apply. applicants areadvisedtofindoutwhatsocialworkersdobefore qualities andmotivationnecessaryforthislineofwork.Potential one closesttoyourinterests,andbelieveyouhavethepersonal to workinoneofthecaringprofessions,thinksocialis Social studiesistherightcourseforyouifknowwant Course overview Course content Is thistherightcourseforyou? page 26forfurtherdetails. Students willberequiredtoundergoGardavetting.See Garda Vetting: TSM points: DEGREE AWARDED: POINTS 2011: PLACES 2012: COURSE CODES: Social studies(socialwork) See page27 B.S.S. 465 45 TR084 Arts, Humanities and Social Sciences 111 e offering a direct route to social work qualification for offering school-leavers in the Republic of Ireland, each student four placements in practice- offering related settings, each student the individual support of both a offering College tutor and a social work tutor. Did you know? The B.S.S. degree is unique in n n n Further information Career opportunities e www.socialwork-socialpolicy.tcd.i E-mail: [email protected] +353 1 896 2001 Tel: As a social studies graduate of Trinity College Dublin, you are College Trinity As a social studies graduate of qualified social eligible to apply to register as a professionally Care Professionals worker with CORU (The Health and Social qualification will also be recognised in many other Your Council). degree which also have a good social science You countries. media, research or NGO project allows you to move into policy, you can continue your professional As a social worker, work. development through postgraduate courses and can move into management, research or training. placement in a Mental health Equality issues Groupwork Human rights law Social work theory and practice, including counselling skills and practice workshops Family and child care studies Social policy Sociology Professional practice Assessment In each of the four years you will have a Assessment includes essays, case studies, projects, Assessment includes essays, case studies, examinations and placement reports. different social service agency under the supervision of an different These placements provide you with experienced practitioner. practice experience and an opportunity to apply and develop the skills and knowledge that you have acquired in College. Placements are arranged in settings such as health service community care teams, hospital social work departments, child and family centres, probation service, and community They account for approximately 50% of development projects. your course time (215 days) over the four years and take place at the end of each of the Freshman years and mostly in term time in the Sophister years. Overseas placements are possible (but not obligatory) within the course structure for those who are interested in gaining relevant experience in another country (e.g. are supported in your You Africa). America, South Britain, North professional development by an individual social work tutor who meets you regularly and visits you on placement from third year onwards. n n n n n n n n The Sophister years year subjects Junior and Senior Sophister (third and fourth) include: In the Senior Freshman (second) year, core subjects are core subjects are year, Freshman (second) In the Senior practice, law for social workers, social social work theory and you can psychology and social research. In addition, policy, studies or choose one elective either continue your language Freshman politics, or economics. Senior course from sociology, of the opportunity to take a Broad students can also avail work The social this year (see page 14). Curriculum module in trips to relevant organisations and services. courses involve field a ten week placement during this In addition students undertake academic year. what you are learning to a real-world situation. Junior Freshman situation. Junior learning to a real-world what you are a the opportunity to undertake also provided with students are for further course (see below related to the six week placement details). 112 Arts, Humanities and Social Sciences by thosewhocraftpoliciesandcreatepublicprogrammes. expanding field,thepotentialofwhichisincreasinglytappedinto addresses themostchallengingissuesofourtime,itisarapidly students withresearchmethodsskills.Becausesociology facing fast-changingcontemporarysocietiesandequipping committed to the explorationof the social andculturalchallenges more clearlyvisiblethroughthestudyofsociology. Sociologyis determine thepathofanindividual’s lifeinwaysthatbecome recognises thatclass,race,age,gender, cultureandtechnology and howpeopleinteractwithinthesecontexts. The discipline investigate thestructureofgroups,organisations,andsocieties, causes andconsequencesofhumanbehaviour. Sociologists Sociology isthestudyofsociallife,change,and identity, education,popularcultureanddigitallives. post conflictandsocialmovements,family, race,ethnicityand and society, globalisation anddevelopment,gender, conflict, work, employmentandorganisations,innovation,technology may bestudiedcoverarangeofsubjectsincludingmigration, Each ofthefourdegreecoursesthroughwhichsociology Course overview What isSociology? TR083: Sociologyandsocialpolicy, page113 See also: Philosophy replacingBusinessasasubject.Seepage99. (PPES/TR015) hasasimilarstructuretoBESSbutwith Philosophy, politicalscience,economicsandsociology Economics, PoliticalscienceorBusiness.Seepage37. either specialiseinSociologyortocombineitwithoneof choose 6modulesinthesecondyearandthenproceedto Within BESS(TR081),afteracommonfirstyear, students can becombinedwithSociology. both subjects.Seepage36foralistofthesubjectsthat a jointhonorprogramme. An honorsdegreeisawardedin the two-subjectmoderatorship(TSM)programme. TSM is course. Itmustbecombinedwithoneothersubjectwithin Sociology (TR001)cannotbestudiedasasinglehonor policy). (PPES), TR081 (BESS),and TR083 (Sociologyandsocial different degreeprogrammes: TR001 (TSM), TR015 Sociology at Trinity Collegemaybestudiedthroughfour TSM points: DEGREE AWARDED: POINTS 2011: PLACES 2012: COURSE CODES: Sociology See page27 B.A. 390*-565 59 TR001 (TSM) and applyingforjobs. years. They alsofinditagreatassetwhentalkingtoemployers students findthisthemostsatisfyingpartofwholefour lives, andCounter-urbanisationintheIrishcountryside).Many prison system,Unmarriedfathers’ participationintheir children’s of yourchoice(recentprojectsincluded:Immigrationandthe independent researchprojectfromstarttofinishonatopic conflict studies. You havetheopportunitytocarryoutyourown digital lives,theeconomicsociologyofEurope,migration,and in avarietyoftopicareas,includingpopularcultureand and focusgroups. The SeniorSophisteryearoffers modules and verbaldatathataretheoutcomesofrecordedinterviews projects involvinganalysisofbothnumericaldatafromsurveys, development, race,ethnicityandidentity, andcarryoutresearch (third) year, youlearnaboutsocialtheory, globalisationand Sophister (thirdandfourth)years.InyourJunior analysis, researchandpresentationskillsareprovidedinthe Specialisation insociologicaltopicareas,andmoreadvanced The Sophisteryears introduced tosociologicalresearchmethods. and societyindifferent cultures,Europeansocieties,andare Senior Freshman(second)yearyoustudyissuesaroundgender in Sociology, PoliticalscienceandEconomicpolicy. Inthe The JuniorFreshman(first)yearcomprisesfoundationmodules The Freshmanyears social sciencesinitsunderstandingofchange. participate initsdevelopment?Sociologyisforemostamongthe changing, butwhatwillthenewworldbelike,andhowcanwe experiencing rapidprocessesofsocialchange. The oldworldis investigating socialchange.Irelandandtheworldarecurrently numerous waysofdescribingandanalysingsociety Sociology isforyou. As anareaofuniversitystudy, itdiscusses world today, andyou’recuriousaboutpeoplesociety, then If youwanttounderstandthesocialchangestakingplacein of theseuniversitiesoffer theircoursesthroughEnglish. Singapore, China,Canadaand theUSA intheirthirdyear. Some the CzechRepublic,Maltaand Denmark aswell Australia, universities inFrance,Italy, Germany, Sweden,Finland, Turkey, Students mayparticipateinfull-yearorhalf-yearexchangeswith up 6to10hoursaweek,dependingontheyear. assessment andformalexamination.Lecturestutorialstake Modules areexaminedbyacombinationofcontinuous Course content Is ittherightcourseforyou? Study abroad Assessment Arts, Humanities and Social Sciences 113 TR083 28 435 B.A. Sociology and social policy and Sociology CODES: COURSE PLACES 2012: POINTS 2011: AWARDED: DEGREE See also: page 36 TSM, TR001: Course content What is Sociology and social What is Sociology policy? Is this course right for you? This course demands both academic and vocational qualities. It This course demands both academic and to pursue a career is particularly relevant to students intending management in research, social policy analysis and evaluation, voluntary and and planning within the social services, both statutory. science disciplines The subjects studied include general social areas such such as economics and politics, and specialist criminology and the extent of welfare policy, as family policy, The Freshman (first two) years are more poverty and inequality. and Sophister (third while the nature, general and foundational in fourth) years will focus more specifically on sociology and social strength of the course is that it explores these issues A policy. methods include Teaching in a genuinely comparative context. lectures, seminars and group project work. The Freshman years In the first and second years you will take introductory modules political science, social policy and sociology. in economic policy, and psychology along Optional modules include statistics, law, with a range of language modules (French, German, Russian, The Senior Freshman (second) year places greater and Polish). emphasis on social policy and sociology modules, as well as also have the You the introduction to social research methods. choice of taking a complementary subject, such as psychology, or you may continue your language study. In the Freshman years, students take six modules, with typically two lectures and one tutorial per week for each module. Sociology and social policy combines the study of social theory, policy combines the study of social theory, Sociology and social The programme aims to give social policy and social research. study of society and you a thorough training in the systematic countries. different the social and economic policies utilised in developed both At the end of your four years you should have specific expertise in a general sociological understanding and various contemporary policy issues. is ranked 1st in Ireland and for Sociology (QS World University for Sociology (QS World y Trinity College Dublin Trinity 48th in the world Rankings 2011). The Department of Sociology is a leading participant Trinity Immigration Initiative and in the Trinity in the Centre for Post Conflict Justice. It also specialises and on in research on technology and society, Ireland into globalisation, reflecting the integration of the a globalising world and the need to understand processes and implications involved. n n Did you know? Further information Career opportunities Career Tel: +353 1 896 2701 Tel: www.tcd.ie/sociolog Sociologists work in a wide variety of settings. Sociology of settings. Sociology work in a wide variety Sociologists of how training and appreciation find that their broad graduates in they can thrive in careers people work means society and development, social research in the public service, community social-service organisations, the print and statutory or voluntary or as university lecturers. Graduates broadcast media, business as diverse as Goodbody are working for organisations Department Theatre, the Abbey the Stockbrokers, the ESRI, Ireland. Friends of the Earth and Enterprise Affairs, of Foreign relations to fashion and marketing Careers range from industrial tourism. and from teaching to 114 Arts, Humanities and Social Sciences social researchers,policyanalystsandjournalists. sectors. Graduatesoftheprogrammearealsoemployedas public service,communitydevelopmentandvoluntary/non-profit interested inpursuingacareertheformulationofpolicy and socialpolicyisaparticularlyrelevantdegreeforthose public policyisexpandingallthetime. The B.A.inSociology The rangeofemploymentopportunitiesintheareasocialand and writtenexaminationsisgenerallyused. A combination ofcontinuousassessment,classpresentations n n n n n n n n n n n n n n n fourth) yearstypicallyinclude: The choiceofsubjectsavailableintheSophister(thirdand The Sophisteryears policy andsocialwork. postgraduate courses,intheareasofsocialresearch, The courseprovidesasolidfoundationforspecialist dissertation onatopicofyourchoice. European society. Inthefinalyearyouwillresearchandwritea Many ofthesemodulesdealspecificallywithIrelandand Postgraduate opportunities Career opportunities Assessment n n Did youknow? Social theory society Researching Public interestlaw Poverty, inequalityandredistribution Irish politics Government andpoliticsoftheUnitedStates culture Gender andpopular family policy Families and politics European Union policy European public Economics oflessdevelopedcountries ofEurope Economic sociology Crime andsocialpolicy Comparative welfarestates Ageing anddementia Social work. Immigration; Lone parents;Historyofsocialpolicy; security; Housingandhomelessness; Familypolicy; areas: Crimeandsocialpolicy; Poverty andsocial research interestsandexpertise inthefollowing ormoreSchoolmembers have In addition,one Policy. situated withintheSchoolofSocialWork andSocial Intellectual disability, andDrug andalcoholpolicyare Research centresfocussingon Ageing, Children, E-mail: [email protected] Tel: +35318961840 www.social-phil.tcd.ie/socpo Course Office: E-mail: [email protected] Tel: +35318962001 www.socialwork-socialpolicy.tcd.i Further information policy.” discover theirfortewithinthefieldsofSociologyandsocial the focusisnarrowedtoallowstudentsspecialiseand year dissertation. Throughout thefouryearsofdegree, working towardsandshapingtheirchoicesforthefinal interests withinandacrossindividualsubjects–ultimately approach tothelearningprocessandfollowtheirown course enableseachstudenttotakeaverypersonal world, neverfailingtoremainrelevant. The scopeofthe apply ittowhatyouseearoundinsocietyandthe The coursechallengesyoutotakeexistingtheoryand modules onstatistics(SPSS). qualitative andquantitativeresearchmethods,aswell to conductresearch. This involvesmodulescovering An importantpartofthedegreeisteachingstudentshow comparative perspectiveintheSophister(finaltwo)years. social policiesintheFreshmen(firsttwo)years,toawider The socialpolicycoursesrangefromanoverviewofIrish structures ofhowcountriesarerun. politics, society, andlearningabouttheunderlying course foranyonewhoisinterestedincurrentaffairs/ science, Lawandlanguages.Iwouldrecommendthis wide rangeofsubjectchoiceswithinEconomics,Political of Sociologyandsocialpolicy, studentsareoffered a it ishighlyinter-disciplinary;alongsidethecoresubjects “I chosethedegreeinSociology&socialpolicybecause Aoife Ryan-Christensen Student Profile
e l e
and www.tcd.ie/Sociolog y Arts, Humanities and Social Sciences 115
p Introduction to modern Spain Introduction of modern range close study of a different Literature: five literature, based on Spanish-American Spanish and texts Spanish language of SpanishSyntax and vocabulary Spoken Spanish Further information Assessment Study abroad Career opportunities Starting in the Senior Freshman (second) year and extending Starting in the Senior Hispanic in courses follow you year (third) Sophister Junior the into of the Spanish Renaissance, modernlinguistics and the literature course on the history of A America. Spain and modern Spanish also given. Each of these courses in the early-modern Spain is The format courses. second and third years are semester-long week. Students are is one lecture followed by one tutorial per the texts followed. encouraged to give oral presentations on www.tcd.ie/Hispanic_Studies/pages/undergraduate.ph Essays submitted throughout the year are combined with written Essays submitted throughout the year are year. and oral examinations at the end of each Students are encouraged to spend a year in Spain or Spanish America, especially at one of the universities with which we have close associations, such as Granada, León, Salamanca, Seville, At a minimum, you will be required to or the Colegio de México. spend two months in a Spanish-speaking country prior to taking your final exams. The main career opportunities are: teaching, journalism and recent graduates have while some the visual media generally, gained EU placements in Brussels. in further study, substantial proportion of students engage A courses in interpreting and particularly diploma and masters’ universities, both Ample opportunities exist in several translation. new M.Phil. in College’s Trinity in the U.K. and in Ireland, with Literary translation and comparative literature proving popular. chosen to pursue steady stream of undergraduates have also A College. Trinity M.Litt. and PhD research degrees at +353 1 896 1257 Tel: n n three two and Years taking three classes each will continue with language tuition You week: n n n The Senior Sophister year Sophister (fourth) year, If you elect to study Spanish in the Senior significant freedom ofyou will work more independently and with translation of theory language, Spanish studying as well As choice. subjects other two choose will you literature, Spanish medieval and These include contemporary from a range of special subjects. politics, and American cultural prose fiction, Spanish and Latin a course in the literature of exile. You will also research and write will also You a course in the literature of exile. department the of member a of supervision the under dissertation a interest to you. on either a given topic or one that is of special
other than English other than English In a language In a language TR001 (TSM) 41 440*-535* B.A. See page 27 HC3 Grade C beginners attend six per week). These comprise classes in grammar, grammar, in classes comprise These week). per six attend beginners text analysis, practice in speaking and listening to Spanish Introduction to language study Language classes (beginners attend seven per week and non- Leaving Certificate Advanced GCE (A-Level) COURSE CODES: COURSE PLACES 2012: POINTS 2011: AWARDED: DEGREE Spanish TSM points: Special Entry Requirements: See also: 41 TR090: Business studies and Spanish, page Spanish (TSM) cannot be studied as a single honor course. course. honor single a as studied be cannot (TSM) Spanish honor joint a is within the two- It must be combined with one other subject TSM programme. (TSM) moderatorship subject An honors degree is awarded in both subjects. programme. page 36. For subjects that combine with Spanish see as one of the two Spanish may be selected Alternatively, programme, languages studied in the European studies (from see page 64. Spanish can be studied ab initio TSM and European Studies. beginner level) in both Course content Is this the right course for you? Is this the right course for n n The Junior Freshman year The primary focus of the Junior Freshman (first) year is to establish and consolidate your competence in understanding and using the Spanish language. Students studying Spanish ab initio (from beginner level) attend nine hours of classes per week, while non-beginners attend seven hours of classes. The course covers four main areas: Spanish at Trinity College is taught by a variety of methods to College is taught by a variety Trinity Spanish at equip you with a comprehensive range of skills in the accurate, fluent and sensitive understanding and use of the written and spoken language. If you are a beginner the teaching provided a realistic opportunity for you to reach the same standard offers within a year as those who have studied the language previously. and close through analysis textual of skill the of development The of expression and organisation the with together reading, careful ideas in written and verbal form, are integral aims of the department. million people. In terms of the number of countries – hundred million people. In terms of the number of countries spoken, it is second more than twenty – in which it is officially and in the only to English. If you are interested in reading then this is America, language and culture of Spain and Spanish a course you will enjoy. Spain, currently one of Europe’s leading industrial nations, was Spain, currently one of Europe’s the foremost Western in the sixteenth and seventeenth centuries and Spanish is today the native language of over four power, 116 Engineering, Mathematics and Science Science (commonentry),withspecialisationsin: Mathematics andScience Integrated engineeringwithmanagement with specialisationsin: Integrated engineering(commonentry), Engineering studies (MSISS) Management scienceandinformationsystems Information systems(non-CAO) Computer scienceandlanguage Computer scienceandbusiness Computer science Computer science Engineering, MathematicsandScience Chemistry Biochemistry Mechanical andmanufacturingengineering programme) Electronic andcomputerengineering(joint Electronic engineering Computer engineering Civil, structuralandenvironmentalengineering Biomedical engineering
145 144 136 135 133 132 130 129 140 137 125 124 122 120 118 117 Theoretical physics materials Nanoscience, physicsandchemistryofadvanced Medicinal chemistry Mathematics Human genetics Earth sciences Chemistry withmolecularmodelling Zoology Plant sciences Physiology Physics andastrophysics Physics Neuroscience Molecular medicine Microbiology Immunology Geology Geography Genetics Functional biology Environmental sciences 146 159 158 157 155 155 154 153 152 151 150 149 148 147 168 167 165 164 162 161 160 Engineering, Mathematics and Science 117
Course content Is this the right course for you? the right course Is this Why study Computer science College? at Trinity Final years If you decide to study for the honors B.A. Moderatorship in Computer Science degree over four years, you can choose from a range of advanced subjects to study including: artificial intelligence; computer graphics; animation; computer vision; networked applications; mobile telecommunications; and many are reviewed annually to reflect developments in Topics others. the field of computing. Years 1, 2 & 3 Years key develop will you programme, the of years three first the In and programs computer implementing and designing in skills communicating and mathematics using problems, solving systems, range a use to how learn will You writing. in and orally both software large tackle to how and languages programming of hardware computer about learn also will You projects. engineering networks including topics, other of knowledge broad a develop and the and management information telecommunications, and relationship between computers and society. At the end of year 3, you choose to study either for the honors Bachelor’s degree (B.A. Moderatorship in Computers Science or the Master in Computer Science (MCS). course with a focus on innovation and cutting-edge technology that that technology is a challenging and exciting College Trinity at Computer science cutting-edge and innovation on focus a science with Computer course a As students. our from best very the demands and teamwork in to apply your deep computer sciencegraduate you will be able skills professional of range a with along knowledge computational problems in all walks of life. management to solve the course you need to be interested in get the best from To ideas about situations and about how developing clear logical (‘algorithms’) for computers to deal to develop feasible schemes Proficiency in mathematics is required. with these situations. of extent the to already, computers about knowledgeable are you If programs for them, so much the better – butbuilding them or writing science is assumed. bear in mind, no prior knowledge of computer is Trinity at Statistics and Science Computer of School The academic an as science computer establishing for recognised than 50 years, thediscipline in Ireland. Over a period of more has and reputation international strong a earned has School globe. the across industry and research education, in partnerships and fostersThe School collaborates with leading employers – companies start-up successful many its through innovation Quaternion Swrve, Kore, Havok, Technologies, Iona including Haptica, GLANTA, Labs, CipherDocs, Haunted Planet Studios, Ltd, Communications X Health, Cara Treocht, Networks, Tolerant Xcelerit. and Consulting Statistical Insight EmpowerTheUser, This course is accredited by Engineers Ireland. Mathematics Mathematics TR033 80 385 B.A. (Moderatorship), Optional: Master in Computer Science (MCS) HC3 Grade C See also: Electronic and TR032: Computer engineering, page 132; computer engineering, page 135 TR034: MSISS, page 124 page 120 TR039: Computer science and language, page 118 TR082: Computer science and business, Leaving Certificate Advanced GCE (A-Level) COURSE CODES: COURSE PLACES 2012: POINTS 2011: AWARDED: DEGREE Computer science Computer Special Entry Requirements: What is Computer science? Computer science at Trinity is an integrated programme: Trinity Computer science at students study for an honors Bachelor’s degree over four years and have the option to study for a fifth year leading to a Master in Computer Science (MCS) degree. Computer scientists are critical to the efficient running of modern Computer scientists are critical to the efficient banking and finance, societies, dealing with health, security, through transportation, and now increasingly our interaction like their counterparts social networks. Computing professionals, finance, deal engineering, accountancy and in medicine, law, with theoretical issues, solve complex problems, deal with Theoretical issues in matters of ethics and with society at large. computer science relate to the abstract notions of computation The study of these issues leads, for example, and information. to efficient and robust algorithms and to new programming Applications of computer science range from artificial languages. intelligence to health informatics, from computer animation and and from social network sites to graphics to information security, educational and training systems. Computer science is a professional subject concerned with the Computer science is a professional subject our relationship study of everything to do with computers and The field began with the pioneering theoretical with them. nineteenth century discoveries on logic and calculation in the computers in the and continued with the development of early where day, middle of the last century right up to the present daily life. computers have become an integral part of 118 Engineering, Mathematics and Science academic successofitsgraduates. and beyond. The Schoolisproudof theentrepreneurialand as CTO andCIO.Others pursue careersinresearchtoPhD management. Manygraduatesholdseniorpositionssuch systems, researchanddevelopment,operations manufacturing, supportandimplementation,information many more.Positionscanbefoundwithin:design,testing, transportation, government,healthcare,educationand communications andentertainmenttomanufacturing Graduates findemploymentinalmostanysectorfrom informally regardingtheircareeropportunities. and Statisticswhichaffords studentsanopportunitytochat recruitment fairheldattheSchoolofComputerScience Each yearleadingemployersinthesectorattendaspecial to sourceenoughgraduateswhoarehighlyskilledinthisfield. top tenICT companiesarelocatedinIrelandandfinditdifficult expect tofindemploymentanywhereintheworld.Nineof Graduates fromthisprogrammearehighlysoughtafterandcan abroad aspartoftheErasmusexchangeprogramme. You mayapplytospendyourthirdyearstudying atauniversity and MasterinComputerSciencewillbeawarded. Moderatorship On successfulcompletionofthefiveyears,bothaB.A. dissertation inanareaofyourchoice. working withanacademicsupervisoron advanced subjects,youwillspendthesecondhalfofyear In yourfifthandfinalyear, aswellcontinuingtostudy and SAP. Bank of America MerrillLynch, Ezetop,Ericsson,GlantaLtd, Derivatives, Curam,Havok,Vigill, IBM,Bloomberg,Symantec, CNGL, Empower, Accenture, Deloitte,Google,NewBay, First Susquehanna InternationalGroup, Arris, Intel,Creme, Cisco, DemonWare, Microsoft,MasterCard, Murex, developed duringyourstudies.Internshipsareoffered by: putting intopracticetheknowledgeandskillsthatyouhave abroad. Hereyouwillhaveopportunitiestoworkonliveprojects year willbespentworkingon advanced subjectslistedabove. The secondhalfofyourfourth degree overfiveyears,youalsochoosefromtherangeof If youdecidetostudyfortheMasterinComputerScience choice. academic supervisoronasubstantialprojectinanareaofyour You willspendthesecondhalfofthisfourthyearworkingwithan Tel: +35318961765 E-mail: [email protected] e www.scss.tcd.ie/cs Further information Career opportunities Study abroad internship eitherinIrelandor a substantialresearch theories inbusiness. Overallattheendofcourse graduates and publicsector fromamulti-disciplinaryknowledge basisof be abletoanalyseandsolvea variety ofproblemsintheprivate a businessperspective,attheend ofthecoursegraduateswill applications tomeetdesiredobjectives andspecifications.From evaluate computer-basedsystems, processesandprograms/ graduates willbeabletodesign, implement/engineerand From acomputerscienceperspective, attheendofcourse achieve fullaccreditation. expected thatfurthertrainingorexaminationswillberequired to exist inaccountancyandcomputerengineering.However, itis for professionalaccreditation–example,suchasthosethat in awaythatallowsstudentstofulfilsomeoftherequirements organisers willstructuretheprogramme,insofaraspracticable, still beaminimumrequirementforstudyineachdiscipline. The options incomputerscienceandbusiness,althoughtherewill and fourth)yearswillallowstudentstochooseamongvarious taught intheFreshman(firsttwo)years. TheSophister(third be requiredtocompletecertainmandatorysubjects,largely obtain anadequategroundingineachdiscipline,studentswill science subjectsandarangeofbusinesssubjects.Inorderto Over thefouryearsstudentsengagewitharangeofcomputer for postgraduatestudyandresearchineitherofthesefields. in computer science and/or business, as well as positioning them of fouryearsduration,preparesstudentsforchallengingcareers organisations and business management. The course, which is skills requiredtounderstandthefundamentalsofmarkets, field of computer science along with the business management the knowledge and expertise needed to work in the technical This jointdegreeprogrammeaimstoprovidegraduateswith Course overview and alanguage,page41 TR085, TR086, TR087, TR089, TR090: Businessstudies TR081: BESS,page37 TR039: Computerscienceandlanguage,page120 TR034: MSISS,page124 TR033: Computerscience,page117 TR017: Lawandbusiness,page92 See also: GCSE Advanced GCE(A-Level) Leaving Certificate Special EntryRequirements: DEGREE AWARDED: POINTS 2011: PLACES 2012: COURSE CODES: science Computer and business
Grade C HC3/OA2 Grade A OR
and business in Computerscience B.A. Moderatorship 420 30 TR082
Mathematics Mathematics Mathematics
Engineering, Mathematics and Science 119 Assessment Career opportunities Business module choices Exploring International business & the global economy; and analysis; organisational experience; Financial reporting Advances Financial markets and the corporate sector; non-profit in marketing theory and practice; Managing organisations; Managing new product development. Computer science module choices: Distributed systems; Advanced telecommunications; Fuzzy logic; Advanced Human factors; Computer graphics; Computer vision; compiler design; Strategic information systems. Please note that not all modules are run each year and that the selection of modules is subject to change. Courses are examined by a combination of continuous assessment and formal examination. wide a up opens business and science Computer in B.A. The range of career opportunities as well as further study options. Likely careers for graduates include, but are not limited to, the information Chief manager; developer/Project Software following: architecture; Business executive or manager; Consulting officer/IT Banking/Accounting; science); computer and/or (business Consumer and business to business products and service organisations; Entrepreneur in marketing and Human resources; Operations management; many roles in the public sector. Junior Sophister Year Sophister Junior students take a combination Sophister (third) year, In the Junior one third be from business, of which one third must of subjects, The subject third from either. science and one from computer follows: optional modules as drawn from a list of choices are choices: Business module Marketing management; Human resource management; Applied finance; accounting; Financial and management and change; Services & information Organisational theory in society; Innovation, Entrepreneurship management; Business and new venture development. module choices: Computer science programming; Software Applied probability; Symbolic engineering engineering; Information management; Software Telecommunications; Artificial Intelligence; group project; of programming Compiler design; e-Business; Semantics systems; languages; Functional programming; Concurrent Computational mathematics. Year Senior Sophister take one business students In the Senior Sophister (fourth) year, The project. subject and the computer science final-year of optional modules remaining subjects can be drawn from a list as follows:
Course content Is this the right course for you? Is this the right (e.g. development of C/C++ applications) or Systems analysis and design. Students take the following computer science subjects: Programming techniques (algorithms, design patterns etc.); Software engineering programming project and Information management, and a choice of either Systems programming Senior Freshman Year Senior Freshman students take a number In the Senior Freshman (second) year, some choice of subjects of mandatory subjects but are offered in computer science. Students take six mandatory business subjects (half year courses): Organisational behaviour; Introduction to marketing principles; Introduction to accounting; Financial analysis; Introduction to finance; Introduction to operations management. Students take seven mandatory computer science subjects: Students take seven mandatory computer Mathematics I & II; Introduction to programming I & II In the Junior Freshman (first) year, students take a number of In the Junior Freshman (first) year, science areas. mandatory subjects in business and computer Introduction Students take three mandatory business subjects: to economic to organisations and management; Introduction policy; and Statistical analysis I. (e.g. development of Java applications); Programming project I; Introduction to computing I; and Business computing systems I. Junior Freshman Year Junior Freshman This course is unique in that it allows for the study of computer in that it allows for the study of computer This course is unique interesting and in a contemporary, science and business The computer science subjects will build relevant manner. logical and mathematical skills and upon your problem solving, a deep understanding of the science challenge you to develop your The business subjects will build upon of computers. and your understanding of the role knowledge of businesses Computer science and the networked of business in society. of development environment are core issues at the forefront of computer in many fields of business, and the combination to produce science and business management is designed computer science graduates who not only understand the latest management skills applications but also have general business human resources including marketing, organisational behaviour, identified a need for and finance. Government and industry have business skills, and more graduates with computer science and demand. this joint honours course helps to meet this will be able to apply their knowledge of computer science, of computer science, to apply their knowledge will be able their along with business and management, mathematics, both familiar environments; skills, in new and problem–solving and in science and Business of Computer within the disciplines workplace. of the modern the wider context 120 Engineering, Mathematics and Science E-mail: [email protected] School websites: science-business Course website: See page39. Further information School ofBusiness? Why choosetheTrinity College www.scss.tcd.ie/undergraduate/computer- www.tcd.ie/business orwww.scss.tcd.ie e degree, orwithin computationallinguistics. to shapetheirmajor focuswithinoneofthethree strandsofthe well asthirdand fourthyearprojectsandoptions toallowthem strands ofthiscourse.Students choosetheiryearabroad,as Computational linguisticsisadiscipline thatunitesthethree degree level,withemphasison aural,oralandwrittenfluency. The chosenlanguage(French, German orIrish)isstudiedto factors thatimpingeonlanguage useandlanguagesincontact. process ofhumanlanguageacquisition,andsociological (constraints onsyntax,semanticsandsoundpatterns),the cognitive scienceexplorestheinternalpropertiesoflanguages Linguistics isthescientificstudyoflanguagesingeneral. This of studyincludesoftwareengineeringandartificialintelligence. software andcomputer-relatedmathematics. Advanced areas science, studentslearntheunderlyingfundamentalsofcomputer cultural awarenessinthelanguagecomponent.Incomputer analysis oftheoriesanddatafromlinguistics,tofluency problem-solving incomputerscienceandmathematicsto different strandsfosterawide rangeoftalents,fromanalytical offered bytheUniversity, bridgingbothscience andarts,its The CSL degreecourseisoneofthemostinterdisciplinary What isCSL? Advanced GCE(A-Level) Leaving Certificate Special EntryRequirements: DEGREE AWARDED: POINTS 2011: PLACES 2012: COURSE CODES: science Computer TR082: Computerscienceandbusiness,page118 TR034: MSISS,page124 TR033: Computerscience,page117 computer engineering,page135 TR032: Computerengineering,page132;Electronicand See also: their chosenlanguage. Irish. Studentsmustpresentoneoftheabovegradesin Students chooseonelanguagefromFrench,Germanand and language
Grade C HC3 Grade B Grade C HB3 HC1 B.A. (Moderatorship) (435), TR013(460) TR010 (465),TR011 15 TR013 (Irish) TR011 (French),and TR010 (German), language (CSLL): linguistics anda Computer science, This coursereplaced TR039
Mathematics Mathematics French orGerman French orGerman If presentingIrish If presenting If presentingIrish If presenting Engineering, Mathematics and Science 121
Senior Freshman Senior Freshman (2nd year) Discrete and continuous mathematics Data structures and programming techniques Natural language processing Syntactic theory Introduction to speech science Formal semantics Instrumental phonetics Computational morphology Statistics for linguistics oral and Written, aural language fluency Junior Freshman Junior Freshman (1st year) Mathematics Introduction to programming Representations and computation Introduction to the study of language (general linguistics) Introduction to phonetics and phonology Introduction to syntax oral and Written, aural language fluency Area studies Assessment Computer science Linguistics Language Written examinations, course work and projects are all used Written will also complete a final-year dissertation You in assessment. amounting to a substantial proportion of your overall degree result. (first and second year) modules: second year) (first and The Sophister years computer science Junior Sophister (third year) students study in Belgium, and linguistics at a university abroad (typically on the language France, Germany or Scotland, depending The subjects you study during this year will depend studied). you choose, on the specialist area of the particular university allowing you builda degree specifically focused on your interests and strengths. In the Senior Sophister (fourth) year you will take advanced modules in interdisciplinary areas such as artificial intelligence, information systems, computer processing of human language, and the analysis and synthesis of the human will also proceed to advanced study in your chosen You voice. language, perfecting both your oral skills and your written skills in résumé, translation and essay writing. An optional module and a major interdisciplinary project allow you to specialise in areas you particularly enjoy and to shape the degree around your individual strengths. Examples of final-year module options include computer graphics, databases, fuzzy logic, natural language evolution, and human second-language acquisition. Junior and Senior Freshman
Course content Is this the right course for you? the right course Is this In the first two years, half of the programme is devoted to In the first two years, half of the programme linguistics and your computer science and half to the study of is a theme that chosen language. Computational linguistics A year abroad is an integral part unifies the three components. All CSL students also participate in the Dublin Computational students All CSL This weekly seminar is Linguistics Research Seminar Series. rotating annually TCD, UCD, DCU and DIT, hosted jointly by among these partners. Seminars vary from industry talks to (the will notice many CSLL You breaking academic research. former course title for CSL) graduates among the world leaders giving these lectures. of the programme, further developing language skills and of the programme, further developing language life in another providing first-hand experience of university abroad provides additional options that The year country. their own specialist enhance the potential for students to define students the final year offers The areas within the programme. where computers opportunity to explore in greater depth areas of the constituent and language meet or in the classical core a language. disciplines: computer science, linguistics and in each Students complete increasingly complex projects year of the programme. This course offers a unique combination of skills – technical, of skills – technical, unique combination a offers This course so, it In doing analytical and communicative. mathematical, after skills today: degree-level of the most sought provides two and a degree in computing, fluency in a second language career possibilities. Many of these opening up hosts of future the third degree-level competency of the careers also involve text in telephones, automatic course – linguistics. Predictive directory enquiries, and internet search speech recognition in examples of technologies that derive from engines are just three countless others are on the horizon. computational linguistics; to students with strengths in analytical The course is appealing for mastering languages but who do reasoning and an affinity arts and sciences. While the course not want to choose between mathematics and computing, 25% on involves 50% focus on optional elements allow linguistics and 25% on the language, the their major focus. If students considerable flexibility to rebalance solving and are you enjoy mathematics, languages and problem and insightful ways, interested in combining topics in creative then this may be the right course for you. 122 Engineering, Mathematics and Science Tel: +35318961765 www.scss.tcd.ie/cs The possibilitiesarelimitless. e.g. theEuropeanPatentOffice,IrishDiplomaticCorps. graduates havetakenupemploymentingovernmentservice, 10% tendtowardsafocusintechnicaltranslation.Some hold academicstaff positionsinIreland andabroad. Another 25% pursueresearchcareers. A numberofgraduatesnow language ofthedegreefocusisprimarylanguage);about in amainlyEnglishspeakingcountryorwherethe About 65%ofgraduatesworkinsoftwareengineering(whether others havemovedintoprimaryandsecondary-leveleducation. Some haveembarkedoncareersinprofessionaltranslation; work assoftwareengineersininternationalconsultingfirms. banking, translation,publishingormulti-mediasectors. A number information technologistsorsoftwarespecialistsinanyoftheIT, Graduates willbequalifiedtoworkaslanguagespecialists, to careersthatreflecttherangeoftopicswithindegree. Since thecoursebeganin1985,graduateshavemovedon Career opportunities Further information l
assurance. sales, IT andprojectmanagement, securityandquality and development,softwareengineering,support,technical industry andgovernment,suchassystemarchitecture,design skills thatyoucanapplyinarangeofICT rolesinbusiness, this two-yeardiplomacourseisforyou. You willgainin-demand as anICT professional,or advanceyourexistingICT career, up-to-date technicalexpertise.Ifyouwishtoembarkonacareer including well-developedbusinessandcommunicationskills Ireland needsskilledICT professionals withbroadcapabilities, www.scss.tcd.ie/IS Details ofhowtoapplyareavailableat: Late applicationswillbeconsideredsubjecttoavailability. for entrytotheacademicyear2013/14. Completed applicationsmustbereturnedby30June2013 directly totheSchoolofComputerScienceandStatistics. This isnotaCAOcourse. Application Procedure: to apply. into consideration,butexperienceisnotessentialinorder For allcandidates:relevantworkexperiencewillbetaken Mathematics. with atleastagradeC3ordinarylevelinEnglishand least sixsubjectsintheLeavingCertificate(orequivalent), January ofyouryearentry, youmusthavepassedat If lessthantwenty-threeyearson1 youwillbeaged informal qualifications. based insteadonworkexperienceandotherformal do notrequireLeavingCertificategrades. Assessmentis the University’s matriculationrequirementsandtherefore entry). Maturestudentapplicantsarenotrequiredtomeet (aged atleasttwenty-threeyearson1Januaryofyear The majorityofthestudentsonthiscoursearemature Minimum EntryRequirements: systems Diploma inInformation n n Statistics andcomprisestwodistinctcomponents: is deliveredbytheSchoolofComputerScienceand – inbusiness,governmentandsociety. This programme communications technologies(ICT)canbestbeapplied Information systemsisthestudyofhowinformationand Information systems (Part-time/evening) B.Sc. (Hons.)inInformationsystems(2years) inInformationsystems(2years) Diploma Students arerequiredtoapply
Engineering, Mathematics and Science 123
Students are required to apply Be able to develop ICT policies, and architectures. strategies Be able to develop ICT solutions using a Be able to design and implement ICT range of technologies, including social, mobile and cloud computing. in Understand the role, application of ICT and potential government and society. business, industry, operations. Be able to manage ICT Have well-developed business, communication and ICT skills. B.Sc. Degree in Entry Requirements: complete the Diploma in Students who successfully may apply for entry to the two- Information systems degree course. Holders of other year part-time evening high level and deemed to be qualifications at a sufficiently in Information systems may also equivalent to the Diploma degree course. apply for entry to the work experience will be taken For all candidates: relevant experience is not essential in order into consideration, but to apply. Application Procedure: This is not a CAO course. and Statistics. directly to the School of Computer Science by 30 June 2013 Completed applications must be returned for entry to the academic year 2013/14. to availability. Late applications will be considered subject Details of how to apply are available at S www.scss.tcd.ie/I Information systems Information Further information n n n n n S www.scss.tcd.ie/I E-mail: [email protected] +353 1 896 1765 Tel: If you wish to work in ICT or advance your career as a senior If you wish to work in ICT this two-year honours degree professional or manager in ICT, in demanding will be equipped to engage You course is for you. in business and in industry, roles in all sectors of the IT architects, project government. Our graduates include system and specialists in managers, developers, software engineers, of ICT. support, quality assurance and other areas includes The B.Sc. (Hons.) Information systems course from research technologies, techniques and methods drawn On completion of the and internationally-accepted best practice. course you will: Be aware of pressing current issuesBe aware of pressing concerning the use of impact and government and the increasing in business ICT society. on of ICT Be able to construct appropriate ICT solutions using a solutions construct appropriateBe able to ICT social, mobile and cloud including range of technologies, computing. skills through Develop business, and ICT communication and project work. practical assignments methods,Understand the principles, tools and architectures and management of ICT. used in the development Recipients of the Diploma award can continue their studies to Recipients of the Diploma – see B.Sc. (Hons) degree level which takes a further two years in Information Systems. n n n n The diploma runs over two years, with lectures normally with lectures normally runs over two years, The diploma of the week. On completion three evenings per delivered on will: course you 124 Engineering, Mathematics and Science interviewing, reportwritingandresearching. range of personal skills including teamwork, making presentations, and operationsmanagement. The fourthstrandseekstodevelopa based and covers important concepts in management, finance as strategicinformationsystems. The thirdstrandisbusiness- databases, up to state-of-the-art topics/techniques in areas such through programming, system design and development and systems and ranges from basic end user tools, like spreadsheets, science. The second strand focuses on information technology and statistics, probability, data mining, forecasting and management developing skills in quantitative techniques, such as mathematics, MSISS is made up of four strands. The first is based around of MSISSistherangecareersthatgraduatestakeup. flexibility andcreativethinking.Oneoftheremarkablefeatures The emphasisinMSISSisonbuildingupanalyticalskills, problems andinparticular, problemsinbusinessandfinance. science, statistics,probabilityandmathematicstosolve technology togetherwithquantitativetoolssuchasmanagement MSISS isaboutusingbothinformationandcommunications n n n subject areasare: areas supportedbytheinterpersonalskillsframework. The three The fourstrandsinMSISSareorganisedasthreemainsubject are both taught explicitly and implicitly (i.e. built into the teaching Interpersonal skills such as interviewing and making presentations Course overview information systemsstudies(MSISS)? What isManagementscienceand TR082: Computerscienceandbusiness,page118 TR081: BESS,page37 TR039: Computerscienceandlanguage,page120 TR033: Computerscience,page117 computer engineering,page135 TR032: Computerengineering,page132;Electronicand See also: Advanced GCE(A-Level) Leaving Certificate Special EntryRequirements: DEGREE AWARDED: POINTS 2011: PLACES 2012: COURSE CODES: science Management studies (MSISS) systems information and Information systems Quantitative analysis management Business and
Grade C HC3 B.A. (Moderatorship) 385 27 TR034 Mathematics Mathematics
n n n n Business andmanagement: The modulescoveredbymainsubjectareasareasfollows: business, technologyandnumericalskillsareinincreasingdemand. graduates arehighlyemployableinaworldwherecombinationof about issues in both technical and business terms.on severalAs a result,fronts, leading to graduates who have The rangeofsubjectsstudiediswideandwillchallengeyourabilities the ability to think problems andareinterestedinbothtechnologybusiness. complex This courseisideallysuitedtostudentswholikesolving the opportunitytospecialiseinanareaofyourchoice. of other subjects). The Sophister (third and fourth) years provide n n n n n study include: get asolidintroductiontonumberoffields.Subjectsyouwill During theJuniorandSeniorFreshman(firsttwo)years,you will The Freshmanyears n n n n n n n n n n n n n n n n n Personal skills: Information systems: Quantitative analysis: Course content Is thistherightcourseforyou? Economics Operations management Finance andaccounting organisation Introduction tomanagementand Mathematics End-user computing Management science Economics Computer programming Consulting Team-working Research methods Report writing Interviewing Making presentations End usercomputing systems Strategic information (C,C++,VisualProgramming BasicandOracle) Information systemsandtechnology Statistics Probability Mathematics Market research Data mining research) Management science(operations Forecasting Engineering, Mathematics and Science 125
Mathematics Mathematics TR032 165 400 B.A.I. HC3 Grade C
Integrated engineering engineering Integrated entry (common programme) COURSE CODES: PLACES 2012: POINTS 2011: AWARDED: DEGREE Special Entry Requirements: Leaving Certificate Advanced GCE (A-Level) See also: page 137 TR038: Integrated engineering with management, Is this the right course for you? Is this the right course for Course overview What is Engineering? The Freshman years All students follow a common programme for the first two The Junior Freshman (first) year comprises introductory years. courses in engineering science, mathematics, computer science, mechanics, electricity and magnetism, physics, chemistry, graphics and computer-aided engineering, and a group design and build project. Engineering is a constantly evolving profession. As an engineer, As an engineer, Engineering is a constantly evolving profession. rapid development of you will need to be adaptable both to the requirements of new ideas and technology and to the shifting will be a good communicator Ideally you industry and society. Above all, and will also be capable of working as part of a team. must be creative and able You you must be a problem solver. sources to to synthesise and analyse information from different arrive at efficient and practical solutions. The B.A.I. (Integrated engineering) degree programme is based on two years of general engineering, providing students with a firm grounding in the principles common to all disciplines, followed by two years of specialisation. Graduates are professionally accredited engineers with both a broad-based understanding of the whole discipline and a detailed knowledge of their chosen The aim is that graduates will be able to specialist area. continuously train themselves, to adapt and move into related or newly emerging areas as their careers develop after graduation. Engineering is about being creative. Engineers make things Engineering is about being creative. Engineers principles together possible by using mathematical and scientific They tackle existing problems with analytical and design skills. technologies. by developing new solutions through innovative by developing They also expand the frontiers of society construction advanced materials, sustainable energy systems, technologies, transport systems and telecommunications infrastructure. An In recent years s projects have been undertaken for Merrill Lynch, Procter projects have been undertaken for Merrill Lynch, DublinAgriculture, and Gamble, the Department of of Society Alzheimer the Union, Credit Corporation Ireland and the Royal Dublin Society to name but a few. MSISS is highly regarded by employershas and one of the best graduate employment records of any undergraduate course in Ireland. A key feature of the Senior Sophister (fourth) year year (fourth) Sophister Senior the of feature key A will tackle a real-life, practical is the project. You problem in an external organisation. Organisation Organisation and management Statistics accountingFinance and n Did you know? n Further information Career opportunities Assessment Website: www.scss.tcd.ie/courses/bamsis Website: E-mail: [email protected] +353 1 896 1765 Tel: Demand for MSISS graduates has always been steady as the wide ranging skill sets developed in the course of study together sought highly are skills team-working and solving problem the with the in fluency and numeracy of level high A employers. by after use of modern technology are a further attraction for employers. One feature of MSISS is that it provides a base for following aOne feature of MSISS is that it provides a base consultancy, remarkably wide range of careers within management professions. accounting and actuarial the and services financial the management, technology information in work also graduates Many pursue others while service, civil the and marketing control, quality postgraduate study at home and abroad. You will be assessed by a combination of assignments and will be assessed You report on the final-year project is an A end-of-year examination. important part of the assessment. The choice of optional subjects is exceptionally wide and spansThe choice of optional computer science, statistics,business studies, economics, The courses currently offered mathematics and engineering. human economics, accounting, management and financial include management,resources management, mathematics, marketing statistical reporting, financial corporate analysis, investment modelling and production and operations management. integral component of the final year is a project which takes of the final year is a project which takes integral component project for a real world client. the form of a consultancy In each year there are a number of core courses (five in third In each year there are year) and a range of optional subjects year and three in fourth select one in each of the final two years. from which students The Sophister years The Sophister Sophister (third and fourth) years allow The Junior and Senior that are of particular interest to you. you to focus on areas n n n 126 Engineering, Mathematics and Science n n n n n n one ofthesixspecialistareas: At theendofSeniorFreshman(second)yearyouchoose What happensnext? difficulties mayalsoreducethenumberofoptionsavailable. of places for students of any one year may be limited. Timetable to allocate the available places. In some departments the number they choose,theB.A.I.ManagementCommitteereservesright While every effort is made to allow students to study the course about whatspecialismtoconcentrateon. possibilities opentoyouinadvanceofmakingyourfinaldecision design andbuildprojects. This allowsyoutoexploreallthe engineering sciencemodulesandcompletetwomoregroup In theSeniorFreshman(second)year, studentstakefurther assessment ineachdiscipline. A substantial designprojectwillbepartofyourfinal-year might findyourselfbuildingamicroprocessorsystem. Heathrow railway;ifyouchooseComputerengineering, testing thepre-castconcreteusedtobuildPaddington structural andenvironmentalengineeringyoucouldendup undertake real-life,practicalprojects.IfyouchooseCivil, Subjects arestudiedinmuchgreaterdetailandstudents specialism youhavechosentofollowdegreelevel. broaden anddeepenyourknowledgeunderstandingofthe Courses intheSophister(thirdandfourth)yearsaimto Mechanical and manufacturing engineering manufacturing Mechanical and (jointprogramme) computerengineering Electronic and Electronic engineering Computer engineering engineering Civil, structuralandenvironmental Biomedical engineering n n n several optionsfora5thyearleadingtoMastersdegree(M.A.I.). directly eligible for Chartered status. Therefore the School offers Students graduating after 2012 will require a Masters degree to be 5th Year Options n n This option allows studenttospendonesemesteroftheir This optionallows 5thyearin the4thand This entailsspending Trinity College, Suitably qualified students may, at the end of their second year, Partner universities: Chalmers Universityof Chalmers Partner universities: Technology, This isofferedwith theUNITECH incollaboration This isofferedwith theEuropeanCLUSTER incollaboration project in5thyear. specialisation. Studentscompleteasignificantindividual in Trinity Collegeundertakingadditionalmodulesinthe remainder oftheir4thyearandthe5tharespent 4th yearundertakinga M.A.I. (Domestic–Option2) project in5thyear. as agroupprojectin4thyearandsignificantindividual undertaking additionalmodulesinthespecialisationaswell M.A.I. (Domestic–Option1) which confersfullprofessionalaccreditationinFrance. may receive, in addition to the B.A.I., the Diplôme de l’INSA, of a five-year double qualification programme TCD students competence before participating on the programme. At the end students will be required to have a high standard of language in France. Instruction at INSA de Lyon is through French and jointly with the INSA de Lyon, the largest Engineering School apply for transfer to the double qualification programme, run Double qualification withINSA de Lyon Politècnica deCatalunya,Barcelona. Politecnico diMilano;RWTH Aachen University;Universitat Gothenburg; ETHZurich;LoughboroughUniversity; internship withoneofthecorporatepartners. semester inapartneruniversityfollowedby multinational corporatepartners.Studentswillspendone Programme, aconsortiumof9universitiesand15 M.A.I. (International –Option 2) Technology Stockholm. Lausanne; Politecnicodi Torino; KTHRoyalInstituteof Institute of Technology; EcolePolytechniqueFédéralede de Louvain;HelsinkiUniversityof Technology; Karlsruhe Lisbon; KatholiekeUniversiteitLeuven/UniversitéCatholique polytechnique deGrenoble;InstitutoSuperior Técnico Darmstadt; Technische UniversiteitEindhoven;Institut University ofCatalonia,Barcelona; Technische Universität 5th yearat TCD. are: The otherpartneruniversities Technical spends their4thyearabroadandreturnstocomplete Programme, aconsortiumof12universities. The student M.A.I. (International –Option 1) supervised workplacement. The six month Engineering, Mathematics and Science 127 Select one of the six specialisations below: Biomedical engineering page 129 Civil, structural and environmental engineering page 130 Computer engineering page 132 Electronic engineering page 133 Electronic and computer engineering (joint programme) page 135 Mechanical and manufacturing engineering page 136 Management for engineers Engineering mathematics Sophister (third & fourth) years Sophister Thermo-fluids Fluid mechanics – principles of fluid motion; laminar and turbulent flows; pipe flows; free surface flows Thermodynamics – mechanical work processes of closed systems; mass and energy conservation; heat engines; the second law of thermodynamics Electronics Analogue electronics – discrete analogue electronics; linear integrated circuits; analogue/digital conversions Digital electronics – combinational logic; sequential logic; digital circuits Engineering and the environment introduce students to the main To environmental issues associated with engineering activity and to become aware of public concern about processes which affect the environment. develop the concept of sustainability To in engineering practice and the main environmental and ethical issues regarding generation and use of energy. Materials Electrical – semiconductors; conduction processes; p-n junction; semiconductor fabrication Mechanical – manufacture of materials; microstructure and heat treatment of steel and alloys Civil – concrete technology; reinforced and pre-stressed concrete; timber technology Computer science II Basic concepts of computer programming; object-oriented programming; classic data structures; representation and algorithms Solids and structures Mechanics of solids – properties of solids, stress and strain, failure criteria; applications of Structures – pin-jointed structures; analysis beams; design of beams Lectures – 16 hours per week Lectures – 16 hours – 5 hours per week Tutorials hours per week Laboratory work – 4 III and IV Engineering mathematics Laplace transform; Partial differentiation; probability Fourier series and transform; linear algebra; theory; vector calculus; theory optimisation and graph Senior Freshman (second) year Senior Freshman Experimental methods This module introduces students to modern experimental techniques for engineering. The students gain experience with a variety of sensors used in engineering systems and in examine the role of error and uncertainty measurements and analysis. Exposure to and experience in using commercial software for data acquisition and analysis. Provides experience in working in a team in all aspects of the laboratory exercises, including set-up, data collection/analysis and report writing. Mechanics laws, forces, moments Statics – Newton’s and couples, equilibrium, analysis of structures, friction, virtual work, hydrostatics Dynamics – kinematics and kinetics of particles and of rigid bodies, simple harmonic motion and vibration Electricity and magnetism Electric circuits – electrical quantities, lumped-circuit elements, analysis of electric circuits, meters and measurements AC power Electrical energy systems – systems, magnetic circuits and transformers, electromechanics, rotating machines Electronic analogue and communication systems – ideal operational amplifier, introduction to communication systems Graphics and computer-aided engineering An introduction to the basic principles of engineering drawing and graphics, drawing office work, introduction to the use and practical application of computer-aided engineering software tools and packages. Physics – heat, light and sound, laboratory work Computer science I Introduction to computer systems and software; problem solving, algorithms and programming Lectures – 16 hours per week Lectures – 16 hours – 5 hours per week Tutorials hours per week Laboratory work – 6 I and II Engineering mathematics integration, Series and limits, differentiation, equations ordinary differential complex numbers, linear algebra, Vectors, and inference introduction to probability Junior Freshman (first) year Junior Freshman Integrated engineering at a glance engineering Integrated degrees one of six alternative year you will select the end of the second At and second years. follow common first TR032 in All students below. as outlined 128 Engineering, Mathematics and Science assessed entirelybycontinuousassessment. towards yourgradeineachsubject. The designprojectsare Typically, end-of-yearexaminationscontributeatleast50% with continuousassessmentofcourseworkduringtheyear. examination, primarilyattheendoflasttermcombined Assessment ineachofthefirsttwoyearsisbymeanswritten E-mail: [email protected] Tel: +35318961142 www.tcd.ie/Engineerin details ofcareeropportunities. varying careerpath.Seethespecialistareasbelowforfurther institutions outsideIreland.Itwillbeyourgatewaytoawideand Ireland andisrecognisedbyalargenumberofengineering The B.A.I.isaprofessionaldegreeaccreditedbyEngineers third) years.Bothcoursescontinueoverthetwo There isanoptionallanguagecourseinFrenchorGerman,withcertification,theSeniorFreshmanandJuniorSophister (second and Further information Career opportunities Assessment Junior Freshman(first)year organic chemistry General chemistry, physicalchemistry, Chemistry learning andcriticalevaluation. based activityandtofosterself-directing work andcommunicationskillsthroughgroup- creativity andinnovation,todevelopteam work toprovideaframeworkencourage sciences throughlearning-by-doingproject methodology. Studentsapplyengineering Design-Implement-Operate (CDIO)compliant mangonel (catapult)accordingtoaConceive- Students design,buildandtestaRoman Engineering designprojectI independently. questions anddeveloptheabilitytowork to getstudentsdealwithmoreopenended analysis skillsandmostimportantlytobegin is topromotecriticalthinkingand political implications. An associatedobjective social, economic,ethical,regulatoryand decisions madeandactionstakencanhave has morethanatechnicalsideandthatall of thecourseistoemphasisethatthisrole engineer andallthatitentails. The keypoint students totheroleofprofessional The aimofthecourseistointroduce Introduction toprofessionalengineering
@tcdengineering www.facebook.com/TrinityEngineering
g e Senior Freshman(second)year and positionsensors. autonomous vehiclewithmotor-drivenwheels objective istobuildacomputercontrolled battery holdersandsensors. The design a vehiclethatincludesthemotorassemblies, Each grouphasaccesstothebasicshellof requires teamworkandaco-ordinatedeffort. design’ and the scale of the task is such that it an exampleof‘hardwareandsoftwareco- electronic systemsdesign. The projectis This moduleintroducesthechallengeof Engineering designprojectIII construction ofashelter. analysis andcalculations,managethe design problemandcarryoutthenecessary work onamulti-disciplinaryproject,define the teamleaderoramemberand design. Studentsworkingroupseitheras strategies andelementsofsustainable adaptable structure,understandrecycling and buildatemporarydemountable for ahostileenvironment.Studentsdesign the needsofawell-definedspecification project forarefugeeshelterthatmeets This isafullsemesterdesignandbuild Engineering designprojectII Sophister (third&fourth)years Engineering, Mathematics and Science 129 g [email protected]) [email protected] . There are opportunities to study . Nanocomposites for cardiovascularNanocomposites for implants The biomechanics of rowing Design and construction of an improved wheelchair Improved diagnosis and treatment of stroke Remote ECG monitoring Career opportunities Further information Study abroad and work experience Though the biomedical engineering sector worldwide is not as Though the biomedical engineering sector sectors such traditional engineering large as some of the major, Ireland as telecommunications and automotive engineering, companies making has a very strong concentration of medical medical devices and it a European hub for the manufacture of have a strong need for high These companies pharmaceuticals. quality graduates at the Masters and PhD level because of the high technical level of their products. Biomedical engineers also find employment in hospitals where they work as clinical engineers, responsible for complex, expensive diagnostic equipment and laboratories. Course coordinator: Richard Reilly ( www.tcd.ie/bioengineerin Website: for Bioengineering: Centre Trinity + 353 1 896 4214 Tel: In the Junior Sophister (third) year you will study technical you will study technical Sophister (third) year In the Junior and engineering both mechanical/manufacturing courses in Anatomy and a course in engineering, along with electronic year and (optional) Sophister (fourth) In the Senior physiology. subjects, a range of technical year you will study Masters (fifth) areas of Biomedical engineering (see most being in specialised in Cell and molecular biology. above), and a course aspect of this degree and there is Project work is an important will carry You facility available to students. an extensive research including a major research project in your out several projects, of final-year projects include: Some examples final year. n n n n n part of your fourth year studying abroad can spend You or working in industry Unitech exchange abroad through the Erasmus, Cluster and The Department links with many universities programmes. de Belgium; INSA including Katholieke University of Leuven, KTH, France; INPG Grenoble; Karlsruhe, Germany and Lyon, Sweden. – using the body’s own cells to make – using the body’s engineering Tissue new tissues Neural signal analysis – measuring and analysing signals from the brain – using computers and telecommunications in Telemedicine a medical context – how the human body works Anatomy and physiology biology – how living cells work Cell and molecular Medical device design – designing new devices for new instruments or monitoring implantation into the body, equipment Biomechanics – principles of statics and dynamics applied to the human body Biomaterials – materials used in implants, instruments and other medical devices measurement Physiological and data analysis – collecting and interpreting data from diagnostic instruments Students who wish to study Biomedical engineering engineering wish to study Biomedical Students who The degree (TR032). Integrated engineering apply to the all Integrated engineering are common to first two years of the second year students select students and at the end as their specialist area. Biomedical engineering of the Freshman (first two) years. See page 125 for details Biomedical engineering Biomedical What will you study? What is Biomedical engineering? What is Biomedical n n n n n n n n n Course topics include areas of both mechanical and electronic Course topics include areas of both mechanical engineering and engineering, specialised topics in biomedical Courses courses in basic medical and biological sciences. include the following: It’s a very exciting field in which new products are being It’s technology in developed all the time, often using the latest analytical tools. materials, manufacturing techniques and It’s a challenging subject which requires a basic knowledge of It’s of a range of biology and medicine as well as understanding mechanics engineering topics spanning electronics, computers, and manufacturing. Biomedical engineering is the application of engineering Biomedical engineering the human body works and to design principles to study how diagnostic equipment. Biomedical medical devices and working in companies making medical engineers are found MRI scanners devices such as cardiac pacemakers, stents, They also work in and aids for people with disabilities. pharmaceutical companies and as clinical engineers in hospitals. 130 Engineering, Mathematics and Science environment. must alsobeeconomicalandhaveaminimumimpactonthe that itisbuiltinandforthepurposewhichintended.It engineers havetoensurethatabuildingissafeforthearea involve designingabuilding,bridge,stadium,etc.Structural Structural engineeringisabranchofthatmight Structural engineering happens inasustainableway. power fromrenewableresourcesandensurethatdevelopment waste. Environmentalengineersalsodesignwaysofproducing us withwaterforallpurposesandthesystemsthatdeal Environmental engineersdesignthesystemsthatprovide Environmental engineering and inquisitive. addition totheseskillsacivilengineerneedsbeimaginative mind, alogicalapproachandgoodproblem-solvingabilities.In skills neededtobeagoodcivilengineeraremathematical civil engineersareinvolvedineveryaspectofourlives. The and buildingsdesigningmanykindsofstructures. Therefore, looking aftertheenvironment,designingfoundationsforhomes many different areas,includingdesigningtransportsystems, and broaddiscipline.Itoffers graduatesthechancetoworkin Civil, structuralandenvironmentalengineeringisaverydiverse for theenvironmentandeachother. enables theengineertoinfluenceusersmakebetterchoices controlled; understandingthedecisionsthattravellersmake of thetransportengineer. Notonlydoestraffichavetobe from cyclingtohigh-speedrailways,allcomeunderthebrief The planningandmonitoringofourvarioustransportsystems, Transportation environmental engineering? What isCivil,structuraland See page125fordetailsoftheFreshman(firsttwo)years. environmental engineeringastheirspecialistarea. end ofthesecond-yearstudentsselectCivil,structuraland common toallIntegratedengineeringstudentsandatthe engineering degree(TR032). The firsttwoyearsare environmental engineeringapplytotheIntegrated Students whowishtostudyCivil,structuraland environmental engineering and structural Civil, n n n n n n n n n n Junior Sophister(thirdyear)modulesinclude: n n n n n n n n n engineering modules: In theSeniorSophister(fourth)yearyouwilltakeninecorecivil to ParisandBarcelona. to aninternationallocation. interest nationallyandthereisalsoa site visitstocivilengineeringworksandareasofgeological and thecourseinvolvesalotof project work.Studentsundertake A significant amountofteachingtakesplaceinthelaboratory, What willyoustudy? a stadium,cathedralandanoperahouse. Group designproject designs. Computer-aided design Highway engineering–thedesignofroadinfrastructure. engineering. Geology Hydraulics –thestudyofwatermovementandflow. of thematerialsusedincivilengineering. Materials –thestudyofpropertiesandbehaviour of sustainabletransportsystems. Transportation of thesoil. Geotechnics –thestudyofpropertiesandbehaviour on, orbeneaththesurfaceofearth. determine orestablishtherelativepositionofpointsabove, to Surveying –thescienceoftakingmeasurements of structures. constructionofalltypes Structures –thedesignand structures anddesignoftallbuildings. concrete, pre-stressed nonlinearanalysisof Advanced theoryanddesign ofstructures slope andtunnelstability. and groundwaterengineering;rockmechanics,including Engineering geology andhydrogeology block; clayandcementitiousbrick; Materials –origin,decay, preservation ofstone,mortarand modelling andsystems. Transportation engineering rigid andsimpledesign. introduction toplastictheory, limit statedesign,rigid,semi- design,structuralsteel: Structures 1–reinforcedconcrete pressures andretainingwalls. determination, slopestability, bearingcapacity, earth Geotechnical engineering conduits, pipenetworkanalysis,pumpcharacteristics. Hydraulics –flowofwaterincircularandnon-circular wastewater treatment,airpollution. characteristics, naturalprocesses,processdesignconcepts, Environmental engineering1 Management forengineers – thestudyofearthandhowthisaffects –the study of the design and maintenance –thestudyofthedesignandmaintenance –Inthepast,studentshavedesigned –theuseofcomputerstocreate Recenttripshaveincludedvisits –soilstrengthandits –transportationengineering, –waterquality one-week technicalvisit –hydrogeology –reinforced Engineering, Mathematics and Science 131 – – a course on the – a course
Structural dynamics and earthquake engineering Structural dynamics non-linear dynamics with a particular a course in linear and (Eurocode 8). emphasis on earthquakes elastic – allowable movements, structure interaction Soil pile groups, tunnelling, soil foundations, earth pressures, reinforcement. – materials, and sustainability Concrete durability case studies. sustainability, durability, – road materials, geometric design, engineering – road materials, Highway economics. design, highway highway pavement analysis Applied transportation transport systems and concepts of intelligent background and international level. at national and its applications Further information Study abroad Career opportunities The fifth year project will be an individual research project. The fifth year project g www.tcd.ie/civilen + 353 1 896 1457 Tel: E-mail: [email protected] n n n n n to study in students get the chance In their penultimate year, Italy or Spain) as part of the Erasmus Europe (France, Germany, programme. of engineering In addition to working in the traditional areas management, civil such as construction, design and transport in law industry, engineers are often employed in the banking numerical and problem-solving The firms and in business areas. are broad based skills and expertise that civil engineers have to many different and make them very attractive employees industries. – aquifer – practical use of concrete; of use practical – – sustainable water and – mathematical theory of – basic geotechnical principles – an introduction to – combined use of surface placement in industry or with placement in industry – different approaches to modelling – different (compulsory). and groundwater resources, including river augmentation schemes and artificial recharge, well design, water resource protecting planning in large river basins, arid zone hydrology, groundwater from pollution, remote sensing techniques. management – solid waste, and environmental Waste thermal treatment: landfill/landspreading hydrology, incineration, pyrolysis, gasification. Contaminated land: investigation and remediation of legal issues; risk analysis. testing, groundwater flow modeling, surface hydrological modeling, wastewater treatment, river and lake quantity models. planning resource Water Modelling of civil engineering systems – analysis of large- civil engineering Modelling of scale-real-world civil and environmental engineering systems with special emphasis on quantitative tools. modelling and hydrological quality Water transportation networks. technology concrete Advanced and fibres, processes. properties; new materials, GRP theory of structures Unified optimisation, structural analysis, structural optimisation. Renewable energy 2 – wind energy (resources, micrositing, turbine design, aerodynamics, controls, wind turbine economics, lifecycle cost, grid integration and transmission) / wave energy/ tidal energy/hydroelectric. Transport modelling Transport Advanced structural analysis – programming the finite method and time-stepping element method, finite difference calculus. dynamic analysis, plus introduction to variational Geotechnical engineering 2 and field and processes, ground investigation, laboratory piling testing, design correlations, compaction technology, and compaction. engineering Transportation transportation engineering. Introduction to environmental analysis – source-pathway- Introduction aspects; target concepts; legal, political and sociological biological concepts. Risk Physical, chemical and ecology. analysis: EIA/EIS. Environmental engineering and diffusion sanitation, air quality and pollution, dispersion, fire engineering. Research methods energy resources and trends, – World Renewable energy 1 energy conservation, energy renewable energy overview, and solar energy. from biomass, geothermal n n n n n n n n n n n n n n n The optional fifth year will allow students to study toward the students to study toward fifth year will allow The optional Master’s level of with a more advanced degree qualification be the There may also listed above. treatment of the topics a opportunity to undertake Fifth year modules include; The Senior Sophister (fourth) year project will be a small group project will be a small Sophister (fourth) year The Senior some design with on a major infrastructure project working element to it. individual design Unitech or Cluster a research group or to participate in the penultimate year. programmes in your 132 Engineering, Mathematics and Science advanced leveloftreatmentthetopicslistedabove. degreequalificationwithmore study towardtheM.A.I.Master’s The optionalfifthyearoftheprogrammewillallowstudentsto to projectmanagementpositions. skills andgoodpeopleastheyoftengetquicklypromoted or doallthree.Computerengineersneedgoodmanagement computer programs,integratethevarioussub-systemstogether Computer engineersmaydesigncomputerhardware,write realised bytheingenuityofcomputerengineers. that werenotevenimagined30yearsago,buthavenowbeen mobile phone,theInternetandgamesconsolesareallproducts and morepervasivethanthatofmanyotherdisciplines. The The impactofcomputerengineeringhasbeenmoresignificant the computersystemsthemselves. mechanical engineering,thermodynamicsandfluidsaswell sub-systems andhowtheyinteract. This mightinvolvesome needs abroadtheoreticalunderstandingofallthesevarious able todesignandconstructsuchacar, thecomputerengineer things astheenginetiming,brakesandairbags. To be contains manyseparatecomputersystemsforcontrollingsuch that surroundus. Take forexampleamodern-daycar;car systems work,andalsohowtheyintegratewithother Computer engineeringisaboutunderstandinghowcomputer n n n Third yearcoursescover: What willyoustudy? What isComputerengineering? See page125fordetailsoftheFreshman(firsttwo)years. Computer engineeringastheirspecialistarea. students andattheendofsecond-yearselect two yearsarecommontoallIntegratedengineering to theIntegratedengineeringdegree(TR032). The first Students whowishtostudyComputerengineeringapply Computer engineering processors. another, inthesameprocessorormultipleconnected systems ofprogrammesdesignedtorunalongsideone allocation ofcomputerresourcestootherprogrammes; programmes thatcoordinate,manageandcontrolthe Operating systemsandconcurrent networks. Computer networks–protocolsandbehaviourofcomputer and systemsoftwareofmicroprocessor-basedcomputers. design, constructionandcharacterisationofthehardware microprocessor system) Microprocessor systems(includingbuildinga –allaspectsoftheprinciples, – management andanengineeringproject,youwillstudy: In thefourthyear, inadditiontoacourseengineering n n n n n n n n n n n n n n n n n n n n n n n n year dissertation.Someexamplesofprojectareasinclude: year projectthatisassessedbyapresentationandanend-of- During thesecondsemestereachstudentundertakesafinal semester. These coursesinclude: degree, studentsanumberofelectivecoursesduringthefirst years. Inthefifthoptionalyear, whichleadstoanM.A.I.Master’s Practical workisemphasisedthroughoutthethirdandfourth Kerberos, TLS anddigitalrightsmanagement. tools availabletocontrolrisk,securityprotocolssuchas understanding ofriskasitappliesindistributedsystems, Security ofnetworks anddistributedsystems games. design anddevelopmentofinteractiveaugmentedreality Augmented reality–interactiveinterfaces,3Dvision, created bythecontinuousgrowthofICT industry. for howenergyiscurrentlyusedinICT andtheproblems foundations ofsustainabilityandgivesanappreciation Sustainable computing applications, heuristicsearchandcase-basedreasoning. design andoperationofrule-basedsystems,expertsystem Knowledge engineering –knowledgemanagement; healthcare, multimediaandrobotics. recognition andtrackingwithreferencetoapplicationsin 3Dvision,object Computer vision–imageprocessing, modelling, renderingandanimation. Computer graphics–introductiontocomputergraphics: information structuringandretrieval, management, Data engineering–fileanddatabase computer systems. and casestudies,thearchitectureofhigh-performance servers, naming,recoveryfromfailure,advancedtopics Computer architecture Bluetooth IP withpaymentforservices Real-time smashsimulation Virtual environments educational forprogrammeoptimisation Genetic algorithms data highspeedinterconnect ofnon-invasive Statistical analysis processing Character comparisonusingimage jobscheduler CLP-based printing ofJavaprogrammes Automatic visualisation An investigationintoSugarscape Real timeanimation Artificial intelligence Networked applications Advanced computerarchitecture Formal methods Fuzzy logic Distributed systems –distributedsystemsmodels,file –thiscourseintroducesthe – Engineering, Mathematics and Science 133 – or to participate in the – all aspects of the principles, Core elements of analogue and digital electronics Core elements of analogue and the principles of operation of electronic devices and their behaviour when connected to form circuits. Microprocessor systems design, construction and characterisation of the hardware and system software of microprocessor-based computers. Electronic engineering Electronic engineering apply wish to study Electronic Students who The first (TR032). engineering degree to the Integrated engineering are common to all Integrated two years of the second-year students select students and at the end as their specialist area. Electronic engineering of the Freshman (first two) years. See page 125 for details Course overview What will you study? What is Electronic engineering? What is Electronic Junior Sophister (third year) courses cover: n n In the Junior Sophister (third) year you will study a total of In the Junior Sophister (third) year you will four core engineering seven electronic engineering subjects and There are approximately 16 hours of lectures, 4 hours subjects. 3 hours of project time of tutorials, 3 hours of laboratory time and per week. typically has a fourth year electronic engineering student A weekly timetable of 14 hours of lectures, 4 hours of tutorials you will have Additionally, and 3 to 4 hours of laboratory work. laboratory access for individual work on your project. The optional fifth year of the programme will allow students to study toward the M.A.I. Master’s degree qualification with more There advanced level of treatment of the topics listed below. may also be the opportunity to undertake a placement in industry or with a research group Unitech or Cluster programmes. Electronic engineering involves the use of electricity to perform a involves the use of electricity to perform Electronic engineering to and the application of these functions wide range of functions our lives. improve the quality of suitable circuits The role of the electronic engineer is to devise and and systems for the acquisition, storage, processing as information- transmission of low-power electronic signals bearing electrical entities. is an ever-growing use of Age there Information In today’s entertainment mobile phones, internet resources, computers, and automation. systems, satellite imaging, optical fibres, cornerstone Electronic components and circuits are the process and technology used to monitor or detect, store, of these systems. transmit the information generated by each and innovation Electronic engineers provide the vital skills components needed to design and develop these remarkable and systems. Further information Career opportunities Study abroad g www.scss.tcd.ie/undergraduate/computer-engineerin +353 1 896 1765 Tel: The demand for software and system designers will continue The demand for software and system designers graduate you will to grow within the next decade. When you companies, large find opportunities for employment in software and multinationals industrial organisations, research institutions Japan. in Ireland as well as in Europe, the US and You may choose to spend all or part of the penultimate year at a may choose You programme. European university as part of the Erasmus 134 Engineering, Mathematics and Science n n n n n n n n n n n n n n n programmes. university aspartoftheErasmus, ClusterorUnitechexchange You maychoose tospendthepenultimateyearataEuropean n n n n n n n n n of-year dissertation.Someexamplesofprojectareasinclude: individual projectthatisassessedbyapresentationandanend- During thesecondsemestereachstudentundertakesamajor courses include: number ofelectivecoursesduringthefirstsemester. These degree, studentstakeacourseinresearchmethodsand In theoptionalfifthyear, whichleadstoanM.A.I.Master’s Fourth yearcoursescover: either individuallyorwithinagroup. engineering. Eachfinal-yearstudentalsocompletesaproject, of subjectsthatallowsfurtherspecialisationinelectronic in engineeringmanagement,youwillchooseacombination In theSeniorSophister(fourth)year, inadditiontoacourse Study abroad Cognitive radiosystems andapplications Probability modelling and mediaprocessing Digital signal Bioinstrumentation Neural engineering characterisation Microphone array adhocnetworks Sensor-based optoelectronicmaterials Electronic and Integrated circuittechnology Electronic circuitdesign networking Communications dataanalysis measurement and Physiological Wireless networksandcommunications processing Statistical signal engineering Speech andaudio systems Digital media Introduction tobioengineering Microelectroniccircuits technologyand Microelectronic mediaprocessing processing andDigital Digital signal Telecommunications communications andDigital Digitalcontrolsystems Integrated systemsdesignand of informationoverguidedpathsandthroughfree-space. the principlesofmodulationandcodingfortransmission Telecommunicationsand –electroniccircuitsandnetworks of electromagneticradiation. and ofthemathematicalcharacterisationtransmission Electromagnetism –theprinciplesofphysicalsystems signals suchasaudioandvideo. methods andalgorithmsfordescribingprocessing Signals andsystems – electronic circuits, mathematical –electroniccircuits,mathematical E-mail: [email protected] Tel: +35318961580 www.tcd.ie/eleceng Department ofElectronicandElectricalEngineering long beenappreciated. analytic andproblem-solvingskillsofelectronicengineershave opportunities inbusinessandfinancialmanagementwherethe design andmanagementintelecommunicationscompaniesto from circuitdesigninelectronicscompaniesthroughnetwork The careersopentograduatesinelectronicengineeringrange Further information Career opportunities
e
Engineering, Mathematics and Science 135 Integrated circuit technology Electronic and optoelectronic materials Sensor-based ad hoc networks Microphone array characterisation quantisation of images in pyramidal form Vector Design and development wireless of a campus-based information access system Digital media systems Speech and audio engineering Statistical signal processing Wireless networks and communications Physiological measurement and data analysis Distributed systems Fuzzy logic Formal methods Advanced computer architecture Networked applications Artificial intelligence Real time animation Communications networking Electronic circuit design – electronic circuits and networks circuits and networks – electronic and Telecommunications coding for the transmission of modulation and the principles and through free-space. over guided paths of information andIntegrated systems design Digital control systems Digital and communications Telecommunications Digital signal and Digitalprocessing media processing Microelectronic and technology Microelectronic circuits Computer architecture Data engineering Computer graphics Computer vision Knowledge engineering Sustainable computing Augmented reality Security of networks and distributed systems During the second semester each student undertakes a major individual project that is assessed by a presentation and an end- of-year dissertation. Some examples of project areas include: In the fourth year, in addition to a course in engineering course in engineering in addition to a year, In the fourth project, you will choose and an engineering management that allows you to balance your a combination of subjects the electronic and computer engineering specialisation between subjects: cover: Fourth year courses which leads to an M.A.I. Master’s In the optional fifth year, methods and a degree, students take a course in research These semester. number of elective courses during the first courses include: n n n n n n n n n n n n n n n n n n n n n n n n n n n n n n n n n – or to s – all aspects of the principles, – electronic circuits, mathematical design, construction and characterisation of the hardware and system software of microprocessor-based computers. and systems Signals methods and algorithms for describing and processing signals, such as audio and video. Computer networks – protocols and behaviour of computer networks. Core elements of analogue and digital electronics Core elements of analogue and the principles of operation of electronic devices and their behaviour when connected to form circuits. Microprocessor system engineering (joint programme) (joint engineering and computer wish to study Electronic Students who (TR032). degree engineering Integrated the to apply engineering common to all Integrated engineering The first two years are of the second-year students select students and at the end in Electronic and computer engineering the joint programme as their specialist area. of the Freshman (first two) years.. See page 125 for details Electronic and computer computer and Electronic What will you study? Course overview What is Electronic and computer engineering? n n n Third year courses cover: n This degree option blends aspects of both the Electronic engineering (see page 133) and Computer engineering (see page 132) options into one course. The optional fifth year of the programme will allow students to study toward the M.A.I. Master’s degree qualification with more advanced level of treatment of the topics listed above. participate in the Unitech or Cluster programmes. A fourth year electronic and computer engineering student fourth year electronic and computer engineering A of 14 hours of typically has a weekly timetable consisting of laboratory work. lectures, 4 hours of tutorials and 3 to 4 hours access for individual work you will have laboratory Additionally, There may also be the opportunity to undertake on your project. group a placement in industry or with a research In the third year you will study four core engineering subjects In the third year you will study four core engineering There subjects. and seven electronic and computer engineering hours of tutorials, 3 are approximately 16 hours of lectures, 4 time per week. hours of laboratory time and 3 hours of project Organising both hardware (electronic) and software (computer) Organising both hardware (electronic) and system is the principal components into a useful and productive With a unique job of the electronic and computer engineer. is trained combination of both skill-sets, such an engineer most productive to make design decisions that result in the systems. 136 Engineering, Mathematics and Science www.tcd.ie/eleceng/undergraduate Tel: +35318961580 Department ofElectronicandElectricalEngineering www.scss.tcd.ie/undergraduate/ug-course-list.ph Tel: +35318961765 Department ofComputerScience engineers havelongbeenappreciated. analytic andproblem-solvingskillsofelectroniccomputer opportunities inbusinessandfinancialmanagementwherethe design andmanagementintelecommunicationscompanies,to processors forawiderangeofapplications,throughnetwork computer engineeringrangefromdesigningembedded The varietyofcareersopentograduatesElectronicand Unitech exchangeprogrammes. at aEuropeanuniversityoraspartoftheErasmus,Cluster You maychoosetospendallorpartofthepenultimateyear n n n n n Further information Career opportunities Study abroad such asBoards.ie, TheJournal.ie and Adverts.ie.” operate someofthebestknown onlinebrandsinIreland media business.It’s nowcalledDistilledMediaandwe have youhadtodate?:“Daft.ie hasgrownintoalarge What didyoudoaftergraduation andwhatsuccesses helped usbeatourbiggerandbetterfinancedcompetitors.” such ascriticalthinkingandproblemsolvingwhichreally skills youlearninengineeringaretransferrabletobusiness launched Daft.iewhenIwasinsecondyear. A lotofthe How did Trinity helpdetermineyourcareerdirection?:“We juicy projectworkandaninterestingsyllabus.” to learnisthroughself-directedlearning.We hadsome doesn’t handholdyouwhichisgoodbecausethebestway life andImadesomegreatfriendsthere. Academically, it with adiversestudentpopulation.Ithasgreatsocial academically andsocially)?:“Trinity isniceandcompact What doyourecallaboutyourtimeat Trinity (both disappointed.” at thetimeforcomputerengineeringandIwasn’t Why didyouchoose Trinity?: “Ithadthebestreputation Eamonn Fallon Graduate Profile Secure lottery-likeservicesoverWAP A application distributedmusicrehearsalstudio sharing systemfortheinternet Anonymous, secure,robustandscalablepeer-to-peerfile eventdetectionforvideoretrieval Impulsive audio Interactive distributedartinstallationusingnetworking
p technology tomaketheworldabetter, saferplace. a mechanicalengineeryouwillworkasprofessionalusing and manufactureofmechanicaldevicescomponents. As Mechanical engineersareinvolvedindesign,testing,inspection smooth runningandefficiency. manufacturing operationreliesonamechanicalengineerforits the skillsofamechanicalengineer. Everyindustrialplantor supply planttothetiniestsurgicalinstrument–haverequired washing machinetothemostcomplexaircraftorelectricity Nearly allmachinesusedineverydaylife–fromthecaror electronics tometalfatigueandfluidmechanics. qualifications astheskillsrequiredrangefrommathematicsand This isoftenseenasthebroadestofallengineering n n n n n n n n n Course topicsinclude: manufacturing engineering? What isMechanicaland What willyoustudy? See page125fordetailsoftheFreshman(firsttwo)years. engineering astheirspecialistarea. year studentsselectMechanicalandmanufacturing engineering studentsandattheendofsecond- (TR032). The firsttwoyearsarecommontoallIntegrated engineering applytotheIntegrateddegree Students whowishto study andmanufacturing Mechanical manufacturing engineering and Mechanical body: designofmedicaldevices andinstruments. Bioengineering design ofcomponents;computer-aided design. Engineering underlyingthecorrect design –principles processes. example theelectroniccontrolofenginesandmanufacturing Mechatronics including acousticsandvibrations. Dynamics –thestudyofmovingbodiesandmachines, components aremadeandhowfactoriesorganised. Manufacturing technologyand systems–how flow ofairintoacarengine. example theflowofairoverwingsanaircraft,or Fluid mechanics–thestudyofgasesandliquids,for metals, polymers,ceramicsandcomposites. Engineering materials by componentsunderserviceloads. Solid mechanics creation anduseofenergy. tothe Energy –thestudyofthermodynamicsapplied – the study of electro-mechanical systems, for – Engineering principles of the human principlesofthehuman –Engineering – stresses and deformation experienced –stressesanddeformationexperienced –themechanicalpropertiesof Engineering, Mathematics and Science 137
Mathematics Mathematics TR038 18 380 B.Sc. (Ing.) HC3 Grade C
gliders to space craft ball-point pens to laser printers matchbox cars to F1 racing cars wheelchairs to artificial joints for the human body A380 Airbus yachts to the with management Integrated engineering engineering Integrated CODES: COURSE PLACES 2012: POINTS 2011: AWARDED: DEGREE Special Entry Requirements: Leaving Certificate Advanced GCE (A-Level) See also: page 125 TR032: Integrated engineering, Is this the right course for you? What is Integrated engineering with management? However, in today’s market, a qualification in engineering in today’s However, must also reflect the global commercial outlook of companies. Engineers are in demand because they are seen as people who can contribute greatly to productivity and competitiveness in the world marketplace. Integrated engineering with management is concerned with the analysis, design, improvement, installation and management of integrated systems of people, finances, materials and equipment. It draws upon specialised knowledge in the principles and methods of engineering analysis and design, together with a number of disciplines such as the management of people, finances, sales, marketing, production, project management and communications. Do you like the creative, analytical, problem-solving focus of engineering? Do you like the diversity of engineering? Perhaps, though, you see your professional life more involved with managing projects, or being a consultant? running a company, If any of these describes you, then you should consider this The diversity and flexibility of this course will give you course. endless possibilities in your professional life, both in what you do core competencies As well as providing the and how you do it. n n n n n Integrated engineering with management is an exciting and Integrated engineering with management is broad in scope wide-ranging engineering programme that business aspects and aims to develop both the technical and They apply of engineering. Engineers are problem-solvers. complex and varied their practical and analytical skills to highly an engineer has problems. In almost every human endeavour, They have created the designs and been involved somewhere. systems to make everything from:
e Large public utilities – Local authorities, transport, power generation etc. Companies manufacturing mechanical, electronic, biomedical and pharmaceutical products Specialist areas such as design, engineering management, financial services and IT Engineering consultancy companies engaged in national and international engineering projects Making new body parts by tissue engineering Study of jet engine exhaust noiseStudy of jet engine exhaust Design and build for ‘Robot Wars’ an entry Design and construction of energy storage devices for the developing world Pedestrian car impact simulation Further information Career opportunities Study abroad and work experience g www.tcd.ie/mechen + 353 1 896 1383 Tel: E-mail: [email protected] n n n n As well as the potential for a career in mainstream mechanical As well as the potential for a career in mainstream have found work in or manufacturing engineering, graduates There is airlines. industries as diverse as film production and development work in also a demand for specialist research and research organisations and universities. Opportunities industry, manufacturing engineering graduates in mechanical and for exist to find employment in Ireland and elsewhere in the following areas: You can spend part of your fourth year studying abroad can spend You There are opportunities to study or working in industry. Unitech exchange abroad through the Erasmus, Cluster and The Department links with many universities programmes. de Belgium; INSA including Katholieke University of Leuven, KTH, France; INPG Grenoble; Karlsruhe, Germany and Lyon, Sweden. n n n n n Project work is an important aspect of this degree and there aspect of this degree and there Project work is an important facility available to students. You is an extensive research projects, including a major research project will carry out several examples of final-year projects include: Some in your final year. In the Junior Sophister (third) year you will study eight technical you will study eight Sophister (third) year In the Junior (fourth) year and optional the Senior Sophister courses. In of from a wide range year you will choose Masters (fifth) suit to tailoring your degree non-technical subjects,technical and in areas of the subject can specialise You your own interests. or manufacturing. aeronautics energy, such as: bioengineering, 138 Engineering, Mathematics and Science n the fouryears. These themesare: The courseisstructuredaroundthemesthataredevelopedover resulting ina5yearMastersleveldegree(M.A.I.). performance intheirthirdyear)toa2-yearMasterscycle, level degree(B.Sc.)orproceeding(subjecttosatisfactory programme havetheoptionofcompletinga4yearbachelor Students intheIntegratedengineeringwithmanagement business andmanagementskills. who wishtobroadenatraditionalengineeringdegreewith The syllabusisambitiousanddiversewillappealtostudents management, amongstothers. quality systems,operationsstrategy, andhumanresources comprises managementsubjectssuchasmarketing,finance, modelling, bio-engineeringandmaterials. The remaining20% subjects suchasdesign,automation,computersimulation/ Approximately 80%ofthesyllabuscomprisesengineering a provenengineeringprogramme. achieve this,thesyllabusintegratesmanagementsubjectswith competitive environmentofworld-classmanufacturing. To that producesgraduateengineerscapableofworkinginthe The courseisafullyaccreditedprofessionalengineeringdegree strategies implementedbyourworldclassstaff. and hands-onexercises,deliveredthroughactivelearning This reflectsacorebeliefinthevalueofsmall-groupteaching programme isthattheclasssizecappedat20students. A keyfeatureoftheIntegratedengineeringwithmanagement careers inthebusinessandfinancialsectors. graduates tocompetefavourablywithgeneralfor and engineeringconsultancy, thebreadthofcourseequips for employmentinresearch,manufacturing,production,design n n n n n projects, casestudiesandteamwork. Throughout thecourse,astrongemphasisisplacedongroup What willyoustudy? Course overview Management science engineering Manufacturing Materials science Design Business General engineering n n n 3 principalroutesareavailable: eligible forprofessionalaccreditationwithEngineersIreland. qualifications (e.g. further/alternative post-graduate graduate afterfouryearswiththeB.Sc.degreewillrequireadditional study) to be (Masters inEngineering)degree. Those studentswhochooseto a 2yearMasterscycle,whichwillleadtotheawardofanM.A.I. satisfactory academic standard in their 3rd yearbusiness may proceed and managementto component. Students who comprisingachieve a both technical engineering subjects andThe aB.Sc. significant degree programme is based on a 4-year programme Five Year MastersinEngineering Tel: +3531896 1383 E-mail: [email protected] www.tcd.ie/mecheng/engman Engineers, PWC Accountancy, Accenture, ReckittBenckiser. Stockbrokers, Wyse Pharmaceuticals,DenisWoods Forensic IBM, Intel,ProjectManagementGroup,JP Morgan,Davies of optionsavailable.Pastgraduatesarecurrentlyworkingin broad, butthefollowinglistmaygivesomeideaofrange working environments.Careeropportunitiesareextremely Graduates willbeabletoadaptawiderangeofcareersand as wellinthebroaderbusinessandfinancialsectors. careers inprojectmanagementandconsultancy The qualificationisalsowellsuitedtothosewhowishpursue managers, financialcontrollers,marketingandsalespeople. project managersonteamswithdesignandtestengineers, (e.g. design,fabrication,assembly). They oftenworkas pharmaceutical, electronic)aswelltraditionalmanufacturing to jobsinthehigh-techsector(e.g.computer, aerospace, and engineeringmanagementfields.Graduateswillbesuited that willallowthemtoexcelquicklyinboththeengineering Graduates oftheprogrammewillhaveawiderangeskills continuous assessment. Some courses,suchasdesign,areassessedcompletelyby (laboratory andtutorialassignments)projectwork. Assessment isbywrittenexamination,continuousassessment Further information Career opportunities Assessment approved combinationofprojectworkandlectures. in An integrated2yearcyclebased TCD, comprisingan project. advanced levelmodulesandasubstantial TCD andcompletetheirstudieswithanappropriaterangeof formal industrialplacement,afterwhichstudentsreturnto year isspentateitheranapprovedpartneruniversity, orina 6-8months)inthe4th An extendedperiod(approximately modules andasubstantial their studieswithanappropriaterangeofadvancedlevel university, afterwhichstudentsreturnto TCD andcomplete The entire4thyearistakenabroadatanapprovedpartner research-based project. research-based Engineering, Mathematics and Science 139 4th year (optional) and 5th year: 4th year (optional) and Final integration of the (B.Sc. professional degrees with or M.A.I.) in engineering management. Project Work: project Substantial engineering of emphasising the integration technical and business solutions. The 4th year project in the case of the M.A.I. will be a group The design and build exercise. final year project in both cases will be a substantial project – with the M.A.I. project accounting for approximately 50% of the 5th year and having a strong research focus, and the B.Sc. final year project accounting for 25% of the final year. Required courses: Advanced manufacturing Supply chain management Engineering options: Micro-manufacturing Thermodynamics Automation and control and acoustics Vibrations Fluid mechanics Biomechanics Mechanics of solids Materials Selected technical options Management options: Operations strategy Management science in practice Strategic information systems New product development Abroad Placement/Study Work range of formal options A are available – see section Masters in Year below on ‘Five Engineering’. Junior Sophister (3rd yr): Junior Sophister (3rd Integrates the professional with degree in engineering management science. Project Work: Individual and group design projects integrating manufacturing, business, and human factors. Engineering themes: Computer methods Mechanics of machines Solid mechanics Control systems Failure of materials Manufacturing technology Engineering design Placement Work and encouraged are Students assisted in finding suitable vacation work between the 3rd and 4th year. Management themes: Project management Human resource management Communication Forecasting Information systems Operations management Development of themes in Development of themes and Integrated engineering in the management introduced first year. Project Work: Design projects introducing and standards in drawing design using computer-aided engineering software tools. Group and independent research projects in materials. Senior Freshman (2nd yr): Senior Freshman (2nd Engineering themes: Mathematics Mechanics of solids Electronics Materials Thermodynamics Manufacturing Fluid mechanics Engineering design Management themes: Accounting and finance Statistical analysis Junior Freshman (1st yr): Junior Freshman (1st Course content Course A foundation year that will foundation year that A introduce you to many in of the basic concepts Integrated engineering with management. Project Work: group and Individual new designing on projects and concepts product experimental methods. Engineering themes: Mathematics Physics Chemistry Computer science Engineering science Manufacturing Engineering design Management theme: Management science Integrated engineering with management at a glance with management engineering Integrated class, the larger engineering are shared with Several of the courses engineering degree. pursue an accredited TR038 Students in TR038. to students but the vast majority are unique MSISS and business There is an optional language course in French or German, with certification, in the Senior Freshman and Junior Sophister (second and There is an optional language course in French or German, with certification, in the third) years. Both courses continue over the two years. 140 Engineering, Mathematics and Science based scientifictrainingandbackground. in, youwillfindthatemployers value thebenefitsofabroad- a scientist.Evenifyoualready know whatyouwanttospecialise is idealifyouwanttoexplorethe manyavenuesopentoyouas Science at Trinity Collegeleavesplentyofroomforflexibilityand for yourfinaltwoyears. have theopportunitytofocusononeofsixteenspecialistareas understand betterwhereyourrealinterestslie. At thispointyou beyond theextentofscienceasitistaughtatschoolandwill of theSeniorFreshman(second)yearyouwillhavemovedfar you toandtraininthefundamentalsciences.Byend mind. Coursesinthefirsttwoyearsaredesignedtointroduce study thatscienceat Trinity Collegeisstructuredwithchoicein It ispreciselybecauseofthescopeandvarietythisfield So wheredoyoubegin? spectrum andsumofhumanknowledgeaboutthenaturalworld. Science isasmallwordandyetitconjuresupthewhole Course overview Is thistherightcourseforyou? entry programme) DEGREE AWARDED: POINTS 2011: PLACES 2012: COURSE CODES: (common Science TR031, 035,073,074,075,076,077:pages160-168 See also: Applied mathematicswith Agricultural sciencewithbiology Physics/chemistry withphysicsorchemistry Combinations ofsubjectsnotpermitted: Special EntryRequirements: Advanced GCE(A-Level) GCSE Leaving Certificate
HC3 Grade B HD3 or OC3 Grade C
B.A. 470* 340 TR071
In two of physics, mathematics geography or applied mathematics, geology, chemistry, biology, science or agricultural applied mathematics geology, geography, physics/chemistry, mathematics, chemistry, biology, In twoof:physics, Mathematics Mathematics typically average24classcontacthoursperweek. support thematerialpresentedinlectures.Sciencestudents given atbothbasicandadvancedlevelstoexplain,expand students inafriendlyandinformalatmosphere. Tutorials are also beabletodiscusscourseworkwithlecturersandother Smaller seminarclassesandgrouptutorialsmeanthatyouwill and themethodologyofscientificresearchfromfirstyear. classes, soyouwillbecomefamiliarwithlaboratorypractice Teaching isbylectures,seminars,tutorialsandlaboratory Course content Engineering, Mathematics and Science 141 physical system Earth and interaction of the physical, chemical and biological systems resources hazards and Earth’s systems development The living planet: History of life on delicate balance: Living with natural A The physics of motion The material world Hearing and seeing Electromagnetic interactions Origins of modern physics Exploring the universe Climate change Global atmospheric oceanic and Global geoecology Global geosystems Surface processes and landscape Conservation Environmental degradation Environmental hazards Geology topics include: Earth in space: Earth as a dynamic
Geography 1022 (10 credits) Physics – foundation physics for the life and earth sciences (10 credits) foundation course of lectures, practical A work and tutorials including the following topics: physics of motion, biomechanics, physics of hearing and seeing, electricity and magnetism and bioelectricity, nuclear physics and related radioactivity, medical applications, heat, pressure and fluids and their biological, geological and medical applications. No previous knowledge of physics is required. Physics (20 credits) Previous knowledge of physics is not required for this course. include: Topics n n n n n n n n n n n n n n n n (10 credits) Geology 1101 n n Geography 1021 (10 credits) Geography 1021 (10 The suggested combinations of subjects are shown in subjects are shown combinations of The suggested thermodynamics, equilibria and kinetics and organic chemistry coordination chemistry group chemistry chemistry bonding biology Electrochemistry, acids and bases Electrochemistry, The solid-state, gas laws, Introduction to systematic inorganic Aspects of main group and Aliphatic and aromatic functional General and physical chemistry Introduction to the fundamentals of and stoichiometry Table The Periodic Atomic structure and principles of Microbiology Plant and animal biology Ecology Introduction to and cellular molecular Genetics Developmental biology
Chemistry CH1101 is a prerequisite for Chemistry CH1101 Chemistry CH1102 n n (10 credits) Chemistry CH1102 n n n n n n n n (10 credits) Biology 1102 n n is a prerequisite Biology 1101 for Biology 1102 Chemistry The course provides a general introduction to the fundamentals of basis for and forms the modern chemistry, further studies, both in chemistry and in other sciences. (10 credits) Chemistry CH1101 Biology in the fundamentals Broad-based training of modern biology. include: Topics (10 credits) Biology 1101 n n n maxima and minima Functions, graphs, derivatives, Integration Matrices, linear equations equations Differential Introduction to computing Differential equations Differential Computing Probability and statistics Calculus Partial derivatives Linear algebra
n n n n n Patterns 1-4, on page 142. Patterns 1-4, for the life and earth methods; Physics; Foundation physics Geology; Mathematics; Mathematical Biology; Chemistry; Geography; of moderatorship (3rd and their choice subjects can affect be aware that their choice of Junior Freshman sciences. Students must see pages 144-159 for further details. 4th year specialisation), page 164. be studied as a single honor subject see Mathematics can also Mathematics (20 credits) mathematics as This course teaches a basic a full subject and provides suitable for all mathematical training branches of science. Junior Freshman (first year) Junior Freshman a total of 60 credits. the following to choose subjects from Students n n n n n n Mathematical methods (10 credits) short foundation course in mathematics A and computing for first-year students not This taking mathematics as a full subject. is a less detailed course that will introduce you to the principles and rules governing scientific investigation. Students who take this course may not take one of the physics degree options in 3rd and 4th years. include: Topics TR071 Science at a glance TR071 142 Engineering, Mathematics and Science See nextpageforoutlinesofyearstwo,threeandfour. Geography 1021 Biology 1101 Chemistry CH1101 Three fromeachsemester Geography 1021 Biology 1101 Chemistry CH1101 (two fromsemester1andthree2) and fiveofthefollowing Mathematical methods Geography 1021 Biology 1101 Chemistry CH1101 and fourofthefollowing(twofromeachsemester) Mathematics Geography 1021 Biology 1101 Chemistry CH1101 and twoofthefollowing(onefromeachsemester) Physics Mathematics Semester 1 Junior Freshman(1styear)CourseOutline Pattern 4 Pattern 3 Pattern 2 Pattern 1 Geography 1022 Geology 1101 Biology 1102 Chemistry CH1102 Geography 1022 Geology 1101 Biology 1102 Chemistry CH1102 Foundation physics Geography 1022 Geology 1101 Biology 1102 Chemistry CH1102 Foundation physics Geography 1022 Geology 1101 Biology 1102 Chemistry CH1102 Semester 2 Tel: +35318961970 E-mail: [email protected] www.tcd.ie/Science in aresearchlaboratory. encourage youtospendyoursummermonthsworkingabroad page 14)tofacilitatethis.Somedepartmentswillalsoactively classes areavailabletoyouinfirstandsecondyear(see variety ofuniversitiesthroughoutEurope.Optionallanguage students havestudiedintheUSA,Canada, Australia, andina (third) yearinmostsciencecourses.Inthepast,forexample, You willhavetheoptiontostudyabroadinJuniorSophister Further information Study abroad
Engineering, Mathematics and Science 143
Current electricity Oscillations Physical optics: introduction Thermodynamics Special relativity Quantum physics Nuclear physics Observing the Universe Molecular orbital theory Coordination chemistry Chemical thermodynamics Chemical kinetics synthesisIntroduction to organic Main group chemistry Nuclear and medicinal inorganic chemistry Theoretical and quantum chemistry Chemistry of aromatic compounds Introduction to organic synthesis Organic spectroscopy Molecular modelling CH2202 (10 credits) This module will cover topics in: PY2P20: Modern physics This module combines four elements of modern physics: Chemistry (20 credits) CH2201 (10 credits) topics in: This module will cover n n n n n n n n n n n n n n n n n n n n Physics (20 credits) PY2P10: Classical physics: This module combines four elements of classical physics: Physics and astrophysics, page 155 page 157 Physiology, Plant sciences, page 158 page 159 Zoology, BY2209: Infection and immunity (5 credits) bio-resources animal an Plant BY2210: (5 credits) BY2201: Cell function structure and (5 credits) and function form BY2202: Vertebrate (5 credits) (5 credits) BY2203: Metabolism credits) BY2204: Evolution (5 BY2205: Microbiology credits) (5 biology andBY2206: Ecosystem global change (5 credits BY2207: Behaviour (5 credits) BY2208: Genetics (5 credits) Geology (20 credits) GL2205: Dynamic Earth 1: rocks and evolution (10 credits) GL2206: Dynamic Earth 2: structure and microscopy (10 credits)) Biology (20 credits) n n n n n n n n n n Geology, page 150 Geology, page 151 Immunology, page 152 Microbiology, Molecular medicine, page 153 Neuroscience, page 154 Physics, page 155
[email protected] Develop students’ geographical skills Develop students’ of numeracy data management, manipulation, analysis, display, interpretation and explanation. Introduce students to a variety of methods in geographical study, analysis and research Enable students select to appropriate methods to study diverse geographical issues Human geography Physical geography MA22S2: Vector calculus for science calculus MA22S2: Vector (5 credits) for science MA22S3: Fourier analysis (5 credits) (5 credits) MA22S4: Mechanics data analysisMA22S6: Numerical techniques (5 credits) science (5 credits) MA22S1: Multivariable calculusMA22S1: Multivariable for
GG2022: Collection and analysis of geographical data (10 credits) This module is divided into three components and aims to: Junior and Senior Sophister (third and fourth years) Select one of: page 144 Biochemistry, page 145 Chemistry, Environmental sciences, page 146 page 147 Functional biology, Genetics, page 148 page 149 Geography, n n n n n n n n n n Students choose three subjects from the following to a total of 60 credits: from the following choose three subjects Students Geology Geography; Physics; Chemistry; Biology; Mathematics; 3rd specialisation in the their choice of subjects can affect (1st and 2nd year) choice of Freshman be aware that their Students must 144-159 for further details) and 4th year (see pages Mathematics (20 credits) Senior Freshman (second year) Senior Freshman Geography (20 credits) GG2021: Changing worlds (10 credits) This module will cover topics in: If you need more information on the TR071 Science course outline, please do not hesitate to contact the Science Course Office, TR071 Science course outline, please If you need more information on the +353 1 896 1970 or 144 Engineering, Mathematics and Science n n Topics include: development andorganisationofthehumanbeing. biochemistry– fromthebehaviourofsimplecellstocomplex broad knowledgeandunderstandingofthefundamentals The coursesintheJuniorSophister(third)yearprovidea other pathologicalconditions. of newdrugsandtherapiesforcancer, infectiousdiseases,and significant investmentinbiochemistrytohelpaidtheirpipeline design ofnewdrugs. All majorpharmaceuticalcompanieshave of proteinsimplicatedinhumandiseaseisalsousefulforthe or otherproteinsaredeveloped.Knowledgeofthestructure processes fortheproductionoffoodsandfuels,enzymes occur. Itisalsoanessentialcomponentofbiotechnology, where to understandthemechanicsofhowdiseaseanddisorders subject areaisalsoanintegralpartofmedicine,asithelpsus building blocksoflife(proteins,lipids,DNA andRNA). This provides anunderstandingofthestructureandfunction Biochemistry isthestudyofmoleculardesignlife.It n n n 3D structureofthemoleculeslife. Immunology alsohasthebestfacilitiesinIrelandforstudying metabolism andcellsignalling. The School of Biochemistryand development, cancer, neurobiology, parasitology, immunology, areas fromwhichtopicsmaybechosenincludedrugdesignand part oftheSeniorSophister(fourth)year. Examplesofresearch A researchprojectintheareaofbiochemistryformsanessential What willyoustudy? What isBiochemistry? including entryrequirements,seepage140. For detailsofthefirsttwoyearsSciencecourse, BY2201, BY2203,BY2205andBY2208. Senior Freshman(secondyear)prerequisite:Biology Mathematical methods. CH1101 andChemistryCH1102. Also, Mathematicsor Junior Freshman(firstyear)prerequisites:Chemistry their specialistareaforthe3rdand4thyears. Science degree(TR071)andmayselectBiochemistryas Students whowishtostudyBiochemistryapplythe Biochemistry Eukaryotic genestructure Immunology regulation Cellular Membrane biology Protein science Tel: +35318961608 www.tcd.ie/Biochemistry management, accountancy, patentlawandmerchantbanking. such ascommunications,informationsystems,teachingand in highdemandcareersnotdirectlyrelatedtobiochemistry communication skills.Consequently, ourrecentgraduatesare critical thinking,analyticalreasoningandpresentation Biochemistry graduatesbenefitfromtheirtrainingintermsof biotechnology, foodscience,pharmaceuticalsordiagnostics. work inhospitalsandcommerciallaboratoriesdealingwith or academicresearch. Alternatively, youwillbequalifiedto and subsequentlytakeupacareerinindustrial,medical decide tocontinueyourstudiesatthepostgraduatelevel biochemistry, cellbiologyandmolecularbiology. You may This courseequipsyoutoworkinallmajoraspectsof university intheUnitedKingdom,FranceorGermany. opportunity forstudentstospendtheirthirdyearstudyingina The SchoolparticipatesinanErasmusschemewhichoffers the Further information Career opportunities Study abroad Engineering, Mathematics and Science 145 in the cutting-edge areas of This may be conducted in Trinity College or in College or be conducted in Trinity This may As well as offering a broad choice of topics for study As well as offering inorganic (organic, chemistry of areas traditional the in Chemistry of School the chemistry), physical and has research strengths materials and nano- medicinal and biological chemistry, can Students chemistry. computational and chemistry select a range of lecture courses from topics as diverse and polymers biological cancer, of chemistry the as catalysis therapy, chelation metal materials, synthetic receptors, synthetic and recognition molecular and providing fascinating illustrations of the basic modes review to used are topics These reactivity. chemical of the into insight gain to principles, chemical important with acquainted become to and discovery, of history cutting-edge research that fills the pages of the scientific popular the of those enters occasionally and literature press. Did you know? n Further information Study abroad Assessment Career opportunities y www.tcd.ie/Chemistr +353 1 896 1726 / 2040 Tel: The chemical and pharmaceutical industries, which contribute The chemical and pharmaceutical industries, Trinity excellent employers of exports, are some 20% to Ireland’s graduates of chemistry chemistry graduates. Former College’s Glaxo-Smith- Pfizer, are working in companies such as Henkel, government Kline and Bristol Meyers Squibb. Patent offices, public analytical advisory and information services, libraries, also employ laboratories, schools and third-level institutions postgraduate research chemists. Or you may decide to carry out College or in another Trinity leading to a higher degree either in successful routes university in Ireland or abroad. Other equally careers in the business graduates have taken in the past include and financial services sectors, and in management. December. December. of projects at wide range A laboratory abroad. an academic research within the many of chemistry are available the forefront in the School. areas located has exchange agreements with a The School of Chemistry universities where students carry out large number of other projects, from September to December. their final-year research have completed their research projects Centres where students Toulouse Berlin, Bologna, included Vienna, in recent years have and McGill and Duke Universities in North and Utrecht in Europe interests The areas of research cover modern chemical America. through chemistry, and DNA such as cancer chemotherapy materials processing, to homogeneous device fabrication and catalysis and supramolecular chemistry. by a combination of continuous will be assessed You assessment and end-of-year examinations. which you will carry out from September to Physical chemistry – macromolecules and interfacial kinetics, quantum chemistry, spectroscopy, chemistry, thermodynamics, analytical chemistry, electrochemistry, chemisorption and catalysis – organometallic chemistry, catalysis, catalysis, Inorganic chemistry – organometallic chemistry, spectroscopic bio-inorganic chemistry, group theory, methods, identification and characterisation of compounds, inorganic polymers Organic chemistry – organic synthesis, spectroscopy, reaction heterocyclic chemistry, stereochemistry, mechanisms, amino acid and peptide synthesis Students who wish to study Chemistry for their degree for their degree wish to study Chemistry Students who and may select Science degree (TR071) apply to the 4th for the 3rd and as their specialist subject Chemistry years. year prerequisite: Chemistry Junior Freshman (first) or plus Mathematics and Chemistry CH1102 CH1101 Mathematical methods. year) prerequisite: Chemistry Senior Freshman (second CH2201 and CH2202. two years of the Science course, For details of the first see page 140. including entry requirements, integral part of the following courses: Chemistry is also an molecular modelling, see page 160. TR074: Chemistry with page 165. see TR075: Medicinal chemistry, of advanced TR076: Nanoscience, physics and chemistry materials, see page 167. Chemistry What will you study? What is Chemistry? In the Senior Sophister (fourth) year, lectures consist of core In the Senior Sophister (fourth) year, fundamental material and an extensive range of optional develop her/his own particular alloweach student to courses that The practical component of this year is an extended interests. research project Lectures are complemented by laboratory experimental classes where you will gain experience in more sophisticated preparative chemical techniques and will also be able to carry out your own spectroscopic analyses and computer-based modelling. In addition there are courses on environmental chemistry, In addition there are courses on environmental chemistry, computer programming, maths and physics, and you have the option of taking complementary courses from other disciplines. n n n Junior Sophister (third year) courses will cover the three main Junior Sophister (third year) courses will cover disciplines: Chemistry is a central science. Without it, many modern Chemistry is a central science. Without it, biology and disciplines such as materials science, molecular Modern chemistry environmental science would not be possible. major contributors and chemical technology are vital and very food production, to modern lifestyle in areas as diverse as are molecular health, medicines and communications. Chemists compounds for engineers involved in developing novel target and drugs, photo- applications as diverse as pharmaceuticals and catalysts. and electro-responsive materials, and polymers 146 Engineering, Mathematics and Science ecology, andaMediterraneanfieldtrip. the possibilityofstudentstoattendfieldcoursesin Terrestrial optional tripsoffered byZoologyandPlantsciencesallow attend, aswellamandatoryintroductoryfieldtrip.Inaddition, students haveachoiceofuptothreefieldtripswhichtheycan attend fieldexcursionsintheirJuniorSophister(third)year; Field workisacorecomponentofthecoursestructure.Students for aselectionwhichreflectsparticularstudent’s interests. There shouldbeamplechoicewithinthelistedoptionalmodules modules plussuitablefromcontributingdisciplines. professional field. Theprogrammecomprisesspeciallydesigned students withaninterestinthisrapidlydevelopingacademicand Natural Scienceshasbeendesignedtoprovidefortheneedsof The undergraduatedegreecourseoffered bytheSchoolof law andthesocialsciences. required whichmayalsoinvolveanunderstandingofeconomics, applied totheenvironment. A broadscientificknowledgeis similar tootherphysicalorlifescientists,butisspecifically environment. Environmentalscientistshavetrainingthatis the biological,chemicalandphysicalcomponentsofour research area–astudyofthevariousinteractionsbetween Environmental sciencesisbyitsnatureamultidisciplinary n n n n n n n fieldwork classesinareassuchas: Teaching isbylecture,seminar, practicallaboratoryand What willyoustudy? What isEnvironmentalsciences? including entryrequirements,seepage140. For detailsofthefirsttwoyearsSciencecourse, BY2205, BY2206,BY2207,BY2208,BY2209,BY2210. following: BiologyBY2201,BY2202,BY2203,BY2204, Senior Freshman(secondyear)prerequisites:4ofthe & 1102. Junior Freshman(firstyear)prerequisites:Biology 1101 third andfourthyears. Environmental sciencesastheirspecialistsubjectforthe directly totheSciencedegree(TR071)andmayselect Students whowishtostudyEnvironmentalsciencesapply Environmental sciences Geographical informationsystems. Geographical andbiodiversity Conservation Terrestrial aquaticpollution and chemistry Environmental change Global environmental Water technology governance Environmental Tel: +35318961274 www.tcd.ie/Botany/undergraduate/environmental-science industry. for takingahigherdegreeorpursuingcareerinbusiness county councils. The course alsoprovidesanidealbackground consultancy orareworkingwithregulatoryauthoritiesand awareness. Manygraduatesmovestraightintoenvironmental the worldwidedemandgeneratedbyincreasingenvironmental As agraduateinthisareayouwillbeabletotakeadvantageof gas emissions. ecology, waterquality, habitatmanagementandgreenhouse projects onairpollution,wastemanagement,restoration environmental project.Inthepast,studentshaveundertaken (fourth) yearyouwillresearchandwriteathesisonan and environmentalimpactassessment.IntheSeniorSophister environmental dynamics,coastalprocessesandmanagement, of ecology, bioindicatorsandpollution,wildlifebiology, Joint moduleswithotherdisciplinesincludefundamentals Further information Career opportunities
Engineering, Mathematics and Science 147 p Research project Research Functional biology:Genetics for genetics developmental of neural development, plant of drosophila, genetics plant molecular genetics II developmental genetics, biologyExtended Essay: Functional and society evolution, in Zoology: developmental biology, Tutorials eyes and vision biomedical parasitology, plant in Plant Science: plant biology, molecular Tutorials physiology Environmental physiology Data handling Further information Career opportunities www.naturalscience.tcd.ie/undergraduate/functional- biology.ph +353 1 896 1366 Tel: A major component of the Senior Sophister (fourth) year is Sophister (fourth) year of the Senior major component A specialist areas of functional in Tutorials project. the research as taught modules: also selected as well biology are n n n n n n n for Functional biology acts as the perfect springboard bioscience undergraduate students to go on to post-graduate degrees; e.g. Masters and PhDs in biological/physiological are also ideally disciplines. Graduates of Functional biology through placed to contribute to the knowledge economy/society having industry, careers with biotechnology companies and/or The course training. gained unique and valuable experience and students who want to also provides an excellent background for pursue a career in teaching biology.
Developmental biology Applied molecular techniques Experimental design and analysis Broad curriculum (see page 14) Plant physiology metabolism Plant structure, anatomy, Plant molecular biology Parasitology Comparative physiology Tutorials: Current issues in functional biology Current Tutorials: Genetics for functional biology: gene Neurogenetics, expression, plant molecular genetics I Students who wish to study Functional biology apply to Students who wish to and may select Functional the Science degree (TR071) area for the 3rd and 4th years. biology as their specialist & 1101 year prerequisites: Biology Junior Freshman (first) or Mathematical methods Mathematics 1102, year) prerequisites: Biology Senior Freshman (second BY2208. BY2201, BY2202, BY2203, two years of the Science course, For details of the first see page 140. including entry requirements, of organisms Functional biology – the comparative physiology What will you study? What is Functional biology? n n n n n n n n n n n Work in the Junior Sophister (third) year provides a broad Work overview of functional biology and includes core modules in: This course focuses on comparing and contrasting animal and This course focuses on comparing and contrasting from the disciplines of Modules are provided plant physiology. School of Genetics Plant sciences and Zoology and from the a The Junior Sophister (third) year provides and Microbiology. while broad knowledge and understanding of Functional biology, in the final year a major component of the course is a lab-based research project chosen from the disciplines of Plant sciences Final-year teaching also occurs through small-group or Zoology. tutorials in areas of specialisation in plant or animal Functional biology as well as through lectures. Functional biology is the comparative physiology of plants and Functional biology is the comparative physiology kinds of organisms animals; i.e. comparing the way different Many of the function in the context of their structure (anatomy). conserved across mechanisms organisms use for survival are principles. species, allowing the revelation of key functional have evolved Furthermore, the mechanisms which organisms through depend on their interactions with the environment Functional biology has important roles to play time. Finally, mutations and/or deletions of gene in elucidating the effects on gene protein function and environmental effects affecting expression. 148 Engineering, Mathematics and Science n n a combinationoflectures,tutorialsandpracticalcourses. man, andotheranimalsplants.Subjectsaretaughtthrough Courses coverthemoleculargeneticsofbacteriaandviruses, of organisms. this, thegeneticscoursecoversawidefieldandallmajorgroups and isincreasinglyimportantinmodernmedicine.Reflecting of organismsandtheevolutionspecies.Itiscentraltobiology everything fromhowcellsworktothephysiologyandbehaviour how theywork.Geneticsprovidesanapproachtostudying molecular biology, whichhasfiguredoutwhatgenesareand phenotypic traitsareinherited–andthemodernfieldof Genetics encompassesboththescienceofheredity–how n n n n n What willyoustudy? What isGenetics? see page162. students shouldapplytocourse TR073 –Humangenetics Alternatively, tostudyhumangeneticsexclusively, including entryrequirements,seepage140. For detailsofthefirsttwoyearsSciencecourse, BY2201, BY2203,BY2205andBY2208. Senior Freshman(secondyear)prerequisites:Biology Mathematics orMathematicalmethods. CH1101, ChemistryCH1102, Biology1101 and Junior Freshman(firstyear)prerequisites:Chemistry specialist areaforthe3rdand4thyears. degree (TR071)andmayselectGeneticsastheir Students whowishtostudyGeneticsapplytheScience Genetics development andphysiology. Plant genetics:studiesthegenesthatcontrolplant populations andtheroleofthisvariationinevolution. Population genetics: dealswithgeneticvariationin processes thatdriveevolution. evolutionary relationshipsbetweenorganismsandthe Bioinformatics andevolutionary genetics: organism. different cellscontrolthedevelopment andgrowthofan Developmental genetics:investigateshowgenesin cell death,proliferationordifferentiation. processes inanimalorhumancellsandbacteria,suchas gene expressionandfunctionofgenesinvariouscellular Molecular andcellbiology: behaviour andpsychiatricdisease. and functionofthenervoussystemtheirinfluenceson controlthedevelopment Neurogenetics: studieshowgenes genetic andstem-celltherapiestotreatthem. causing variousclinicaldisordersandthedevelopmentof identificationofgenes Medical genetics:includesthe explores thecontrolof investigates human evolutionarygenetics. cancer genetics,geneticsofvision,behaviouraland responses orplantgenetics.Specialistlecturecoursesinclude blindness, celldeath,neuraldevelopment,bacterialstress an originalresearchprojectinareasuchas:hereditary specialise inareasofparticularinterest,andwillcarryout In theSeniorSophister(fourth)year, youwillbeableto Tel: +35318961140 www.tcd.ie/Genetics degree willputyouinhighdemand. critical thinkingandproblemsolvingprovidedbytheGenetics a careernotdirectlyrelatedtothescientificsubject,skills of medicine, patentlaworsciencejournalism.Evenifyouchoose in teaching.Othergraduateshavegoneontocareerssuchas counselling, publichealthandepidemiologyprogrammes, medical orclinicaldiagnosticlaboratories,forensics,genetic and pharmaceuticalcompanies,agriculturalorganisations, postgraduate study. Opportunities alsoexistinbiotechnology to careersinacademicorindustrialresearchbeginningwith science orareasrelatedtoit.Manygeneticsgraduatesgoon Graduates havegoneontocareersindiversefields,many financial assistanceprovided. research laboratory. to spendthesummermonthsworkinginahumangenetics At theendofJuniorSophister(third)year, youmaybeable assessment andend-of-yearexaminations. You willbeassessedbyacombinationofcontinuous Further information Career opportunities Study abroad Assessment n n Did youknow? most prestigiousresearchawardsinEurope. Research Council Advanced Grantsinbiology-the research and holds two of Ireland’s three European an outstandingreputationforproducinghigh-quality genetics research institute in Ireland. The institute has at theSmurfitInstituteofGenetics-onlydedicated genetics publishedfromIreland,primarilybyscientists numbers of citations received by research papers in UK andGermany. This rankingisbasedonthehigh Science indicators), ahead of countries such as the and genomics(source: Thomson ScientificEssential national rankingsforresearchinmoleculargenetics Ireland wasrankednumber1inEuropethe2010 with state-of-the-art research facilities. Genetics is housed in the Smurfit Institute of Genetics, This isoftenintheUSA,withsome Engineering, Mathematics and Science 149
Trinity College Dublin is ranked 40th in the world in Trinity 2011). Rankings University World QS the (by Geography Climate change Human origins Globalisation and development Historical geography I and II Hydrology the state Property development, urban planning and Glacial geomorphology Reconstructing environmental change Understanding environmental change Advanced research methods in geography I Advanced research methods in geography II (which includes Advanced research methods an overseas fieldtrip) Geographic information: data & tools History and philosophy geography of Coastal processes and management I and II Globalisation Hydrology Quaternary environmental change and climate Environmental governance 1 Did you know? n Assessment Study abroad Several of the Sophister year options require field and laboratory work. Students may also opt to take a number of courses outside geography in their Sophister years. There are also additional optional modules (5 credits each) There are also additional optional modules covering a wide range of subjects that include: undertake a students For their Senior Sophister (fourth) year, modules that research dissertation and choose from optional include: There are opportunities for students to spend all or part of the Bordeaux, Paris, Utrecht or third year studying abroad at Exeter, Stockholm universities. of geographical data which includes a fieldwork component. of geographical data n n n n n n n n n end-of-year combination of continuous assessment and A examination is used. per module per week. The Senior Freshman (second year) The Senior Freshman per week. per module economic relating to cultural, modules cover issues geography human-modified and to natural and geography, and historical are Research skills processes and systems. environmental analysis on collection and further through a course developed years The Sophister modules (5 credits each) in Junior There are four compulsory Sophister (third) year: n n n n n n n n n Global geoecology Global geosystems Surface processes and landscape development Climate change Global atmospheric and ocean systems See also: page 102 TR029: Political science and geography, TR077: Earth sciences, page 161 Students who wish to study Geography apply to the apply to the wish to study Geography Students who as select Geography (TR071) and may Science degree and 4th years. area for the 3rd their specialist year prerequisite: Geography 1021 Junior Freshman (first) and/or Geography 1022 year) prerequisite: Geography Senior Freshman (second GG2021 and GG2022. two years of the Science course, For details of the first see page 140. including entry requirements, other Geography may be combined with one Alternatively, social science discipline within the subject from an arts or a TSM is (TSM) programme. two-subject moderatorship honors degree is awarded in An joint honor programme. that combine with Geography, both subjects. For subjects see page 36. Geography Course content Why study Geography? In the first year, as students study geography in combination as students study geography In the first year, with other subjects, they attend an average of four lectures In addition, students may select to take ‘Geography 1022’ which In addition, students may select to take ‘Geography 1022’ introduces key concepts relating to the interactions between humans and their environment by examining case studies from the fields of conservation, environmental degradation and environmental hazards. n n n n All students take ‘Geography 1021’ which considers the following the considers which 1021’ ‘Geography take students All themes: n The Junior Freshman (first year) Geography course aims to focusing on provide a solid grounding in physical geography, materials that are dealt with in greater depth in later years. Geography is truly interdisciplinary as it spans a broad spectrum Geography is truly interdisciplinary as it spans As physical sciences. of the social, biological, informational and are well placed the world becomes interconnected geographers on social and to bring their understanding and skills to bear geographers, An important attribute of environmental issues. is their ability and one that is highly regarded in the workplace, a wide range of to combine multidisciplinary knowledge with report-writing, transferable skills, including critical thinking, These can be applied to careers numeracy and IT-literacy. such as which directly incorporate a geographic dimension, wider areas planning, and to environmental urban consultancy or such as business and public service. 150 Engineering, Mathematics and Science Tel: +35318961576 www.tcd.ie/Geograph development. insurance), foreignaffairs, leisureandtourismoverseas as wellpositionsinsuchareasfinancialservices(including planning, environmentalconsultancyandresearchteaching geography studentsinrecentyearsincludeurbanandregional are widelyregardedasassets.Careerstakenupbygraduating valued intoday’s jobmarket,whereadaptabilityandflexibility discipline andtraininginhighlyrelevanttransferableskillsis geography graduates. The combinationofabroad-based A widerangeofcareeroptionsispotentiallyavailableto Further information Career opportunities n Did youknow? video documentariesaspartoftheirassessedwork. Iceland, Mallorca and Zambia, and in making digital have beeninvolvedinacademicstaff-led fieldworkin In recent years, Sophister year geography students y compulsory courses: In theSeniorSophister(fourth)yearyouwilltakethree addition, youwilllearnskillsincomputinganddatapresentation. time; investigationofthesubsurface;andevolutionlife.In them tobend,buckleandcrack;themeasurementofgeological will alsostudytheirresponsetoforcesintheEarthwhichcause formed themandtheenvironmentinwhichthistookplace. You each oftherockscontainsinformationonprocessesthat provided inallmajorbranchesofgeology. You willlearnhow In theJuniorSophister(third)year, athoroughgroundingis and integralpartofSophister(thirdfourthyear)geology. (first and second) years see pages 141-143.For details Fieldwork of the topics is covered an inessential the Junior and Senior Freshman society isbased. with theoriginandconcentrationofmaterialsonwhichour dinosaurs, volcanoes,meteoritesandearthquakes.Italsodeals organisms. Itembracesthestudyofsuchdiversetopicsas composition andevolutionofthisdynamicplanetitsliving Geology isthescienceofEarth.Itinvestigates n n n n n n n n n n n n n n subjects include: covering bothacademicandappliedareasofgeology. Optional You willalsoselectsevenoptionalsubjectsfromawiderange What willyoustudy? What isGeology? including entryrequirements,seepage140. For detailsofthefirsttwoyearsSciencecourse, GL2205, GL2206. Senior Freshman(secondyear)prerequisite:Geology Junior Freshman(first)yearprerequisite:Geology 1101 area forthe3rdand4thyears. degree (TR071)andmayselectGeologyastheirspecialist Students whowishtostudyGeologyapplytheScience Geology Radiogeneic isotope geoichemistry andmassspectometry geoichemistry Radiogeneic isotope Laboratory project Economic geology Palaeobotany,organic petrology palynologyand Introduction tomicropalaeontology Planet formationandtheearlyEarth Metamorphic petrology petrology Global igneous quality andgroundwater Hydrogeology evolution andlandscape Continental tectonics andexploration Petroleum geology andseminars Geological literature Fieldwork based invariouspartsofEuropeandalsoNorth America) fieldworkhavebeen Project (recentprojectsincorporating Engineering, Mathematics and Science 151 As there is also a lot you will carry out a and also cover specialist topics Membrane biology Microbiology and virology Core concepts in immunology Cells and molecules of the immune system Infectious diseases and vaccines allergies and cancer Autoimmunity, Protein science Gene regulation Immunology apply to the wish to study Immunology Students who as select Immunology (TR071) and may Science degree and 4th years. area for the 3rd their specialist year) prerequisites: Chemistry Junior Freshman (first or Also, Mathematics and Chemistry CH1102. CH1101 Mathematical methods. year) prerequisite: Biology Senior Freshman (second and BY2208. BY2201, BY2203, BY2205 two years of the Science course, For details of the first see page 140. including entry requirements, What will you study? What is Immunology? In the Senior Sophister (fourth) year active research project within one of the department’s immunology research groups in both biochemistry and immunology. Additional topics include: n n of interest in immunology from the pharmaceutical sector, it is sector, of interest in immunology from the pharmaceutical for skilled graduates anticipated that there will be a high demand into the future. In the Junior Sophister (third) year you will share many of your particularly in the areas of courses with students of biochemistry, cell and molecular biology. Immunology topics covered include: n n n n n n This is a degree in which students become expert in the This is a degree in which students become and immunology. complementary disciplines of biochemistry involved in living Biochemistry is the study of all processes carry out all organisms. It encapsulates how cells replicate, an orderly manner. their specialised functions and then die in diseases and medical It seeks to define the basis for different and most exciting disorders. Immunology is one of the fastest studying the growth areas of biological science and involves in recognising molecules and cells of the body that are involved in immunology has and fighting infection and disease. Research and new therapies helped in the development of new vaccines multiple sclerosis for diseases, such as rheumatoid arthritis, College has a worldwide disease. Trinity and Crohn’s research and it is reputation for excellence in immunology a recognised strategic strength of TCD. y As a student of geology, you will undertake a two-week As a student of geology, field trip to a tectonically active region in Spain. Did you know? n Further information Career opportunities Study abroad www.tcd.ie/Geolog +353 1 896 1074 Tel: Recent graduates have found professional career opportunities with mining companies, civil engineering firms, geological and environmental consultancies, oil companies, organisations based in computing and information systems, and government There is currently a global shortage of geological surveys. geoscientists. Geology graduates are also highly valued in more generalised fields of employment (e.g. in the finance sector) their many transferable skills and their due to their adaptability, experience at dealing with incomplete data sets. There are opportunities for students to spend part of their There are opportunities for students to spend agreements with Junior Sophister year abroad, we have formal (France), but other Uppsala (Sweden) and Clermont-Ferrand locations are also possible. 152 Engineering, Mathematics and Science Tel: +35318961608 www.tcd.ie/Biochemistry management. areas suchasteaching,informationsystems,accountancy, and gone ontostudymedicineorpharmacy, andevencrossedinto However,commercial laboratories. previous graduateshavealso academic research.Somegraduateswillworkinhospitaland and subsequentlytakeupacareerinindustrial,medicalor will beideallysuitedtocontinuestudyingatpostgraduatelevel developments inimmunologycurrently, graduatesofthiscourse areas ofbiochemistryand/orimmunology. Giventheexciting On completionofthiscourseyouwillbequalifiedtoworkinall university intheUnitedKingdom,FranceorGermany. opportunity forstudentstospendtheirthirdyearstudyingina The SchoolparticipatesinanErasmusschemewhichoffers the Further information Career opportunities Study abroad and genetics. techniques, andwillalsobeproficientinmicrobialbiochemistry at bothcellularandmolecularlevels,usingawiderangeof microbiologist isaversatilescientistandstudiesmicrobes of microbialprocessesforapplicationsinbiotechnology. A It alsostudiesthecontroloftheseeffects andtheharnessing and detrimental,onplants,animals,mantheenvironment. and viruses)togetherwiththeiractivitieseffects, beneficial processes ofmicro-organisms(suchasbacteria,protozoa,fungi Microbiology, asascience,investigatesthestructuresandlife the microbialworldisyettobediscovered! about microbesandsomeestimatessuggestthatover95%of are allcausedbymicrobes.Despitethis,westillknowverylittle antibiotic-resistant Staphylococcusaureus(MRSA)infection bovine spongiformencephalopathy(‘madcowdisease’)and Diseases suchas AIDS, malaria,cholera,avianinfluenza, multitude ofinfectiousdiseasesinhumans,animalsandplants. nutrients foroursurvival.Ontheotherhand,microbescausea our digestivesystemandgeneratingessentialvitamins and minerals,providingoxygentoouratmosphere,fuelling aspects oflifeonEarth. This includesrecyclingallnutrients that microbesareessentialforthemaintenanceofmany the contextofdisease,onlyrecentlyhasitbeenfullyrealised Although microbeshavebeenstudiedfor300years,mainlyin molecular microbiology. which housessomeworld-class researchersinmedicaland Microbiology intheMoyneInstituteofPreventiveMedicine, in themicrobiologysectionofSchoolGeneticsand In thethirdyearandfinalyear, youwillmainlybebased microbiological moduleswithinthesubjectofbiology. allowing youtodevelopyourstudyskills.Partofthiswillinclude consolidating yourfundamentalscientificknowledgeand of sciences,facilitatinganunderstandinghowtheyinterrelate, During thefirsttwoyears,youwillbeexposedtoabroadrange Microbes andmicrobiology the course? during study you will What including entryrequirements,seepage140. For fulldetailsofthefirsttwoyearsSciencecourse, BY2201, BY2203,BY2205andBY2208. Senior Freshman(secondyear)prerequisites:Biology Mathematical methods,andBiology1101. CH1101, ChemistryCH1102, plusMathematicsor Junior Freshman(firstyear)prerequisites:Chemistry as theirspecialistareaforthe3rdand4thyears. the Sciencedegree(TR071)andmayselectMicrobiology Students whowishtostudyMicrobiologyshouldapply Microbiology Engineering, Mathematics and Science 153 Immunology Protein chemistry Eukaryotic gene structure Clinical aspects of cancer and infection Stem cells and gene therapy Drug adsorption and metabolism Endocrinology Membrane function Cellular regulation Molecular medicine Molecular to medicine apply wish to study Molecular Students who may select Molecular degree (TR071) and the Science years. for the 3rd and 4th their specialist area medicine as year) prerequisites: Chemistry Junior Freshman (first or Also, Mathematics and Chemistry CH1102. CH1101 Recommended: Biology 1101 Mathematical methods. year) prerequisites: Biology Senior Freshman (second and BY2208. BY2201, BY2203, BY2205 two years of the Science course, For details of the first see page 140. including entry requirements, What will you study? What is Molecular medicine? What is Molecular Science topics include: n n n In the Junior Sophister (third) year, the molecular medicine the molecular In the Junior Sophister (third) year, understanding of course will provide a broad knowledge and cell various fundamental science disciplines, biochemistry, genetics and microbiology and some topics immunology, biology, unique to the molecular medicine course as listed below. Molecular medicine topics include: n n n n n n Molecular medicine is a joint degree programme offered by offered Molecular medicine is a joint degree programme and the School the School of Biochemistry and Immunology changing needs of of Medicine and has been inspired by the between the two medical research. It is a unique collaboration with a strong schools, aimed at creating a science programme theory to therapy emphasis on translational research, i.e. a advances can approach to learning whereby medical research be directly translated into patient care. such degree College is the only Trinity Molecular medicine at will be given lectures programme available in Ireland. Students within at the cutting-edge of current scientific knowledge immunology, the overarching research themes of cancer, in addition to clinical neuroscience, genetics and microbiology, Hospital, which will focus on the lectures given at St. James’s application of research knowledge to the clinic. y Emerging pathogens Molecular pathogenesis (disease mechanisms) of bacterial and protozoal infections Regulation, issues and standards in current microbiological practice Clinical microbiology Gene regulation and expression in bacteria and eukaryotic microbes Bacterial cell surfaces and their proteins Further information Career opportunities In the final year, you will also undertake a 9-week, full-time you will also undertake In the final year, You laboratory. project under supervision in a research topics like genetic will work at the cutting-edge of research on anti-malarial drugs, transfer between bacteria, design of new and novel methods for disinfection in hospitals. www.tcd.ie/microbiolog +353 1 8961190 Tel: Many graduates go on to do a higher degree in Ireland or abroad degree in Ireland or higher do a on to Many graduates go and enter a rewarding career in many of the areas mentioned or continue a research career in a university. Graduates in microbiology have a wide range of expertise and Graduates in microbiology have a wide range or pure research. are considered versatile scientists for industry and medical This makes them sought after by pharmaceutical in assurance staff research laboratories as research and quality analytical or R&D staff drug and medical device manufacture, as health public utilities, the food and beverage industries,by the by service, by teaching and training establishments and publishing houses, in life science sales and product development, medical relief organisations and many other areas. Such employment may find you working with multinational or small companies in Ireland or abroad, working with leading-edge biotechnologies in the production of drugs, enzymes, antibiotics, vaccines or agricultural products. n n n n n n In the final year you will also choose from optional courses In the final year you edge of research and knowledge in topics reviewing the leading such as: Extensive laboratory and computer training cover the safe Extensive laboratory micro-organisms, separation of their handling of pathogenic genetic analysis, biotechnological components and products, methods. techniques and research In the 3rd and 4th years, you will take a core course covering take a core course 4th years, you will In the 3rd and microbial and cell biology, microbial molecular aspects of of these topics As some and applied microbiology. pathogenicity and genetics, immunology related to biochemistry, are closely disciplines. courses from these take complementary you will also 154 Engineering, Mathematics and Science Tel: +35318961608 www.tcd.ie/Biochemistry science andmedicaldisciplines. where thereisademandfortheanalyticalskillsdevelopedin systems, communicationsandmanagement,law, andbanking, Other possibilitiesincludesuchcareersasteaching,information biotechnology, foodscience,pharmaceuticalsordiagnostics. to workinhospitalsandcommerciallaboratoriesdealingwith Institute ofMolecularMedicine. Alternatively, youwillbequalified including theSchoolofBiochemistryandImmunology towards aMastersorPhDinseveraldisciplineslifesciences research. Forexample,itispossibletocontinueyourstudies level andsubsequentlytakeupacareerinmedicaloracademic You maydecidetocontinueyourstudiesatthepostgraduate aspects ofmolecularbiology, biochemistry, andcellbiology. Graduates ofthiscoursewillhavetheabilitytoworkinallmajor A or Germany. third yearstudyinginauniversitytheUnitedKingdom,France scheme whichoffers theopportunityforstudentstospendtheir of celldeath. The Schoolalsoparticipatesinan metabolism, theimmunesystem,geneticdiseases,andcontrol cellular parasitology, viralevasionmechanisms,cellsignalling, cancer, neurobiology, neurologicaldisease,molecularand cycle andcelldivision,cytoskeleton,developmentalbiology, areas fromwhichtopicsmaybechosenincludethecell of ClinicalMedicine,St.James’s Hospital.Examplesofresearch Immunology, onthemainCollegecampusorinDepartment to performtheirprojectintheSchoolofBiochemistryand Senior Sophister(fourth)year. Studentswillhaveachoice immunology orclinicalmedicineformsanessentialpartofthe Further information Career opportunities research project in theareaofbiochemistry, cellbiology, Erasmus Parkinson’s disease,schizophreniaanddepression. brain diseasessuchasMultiplesclerosis, disease, Alzheimer’s causes, andtoproducemoreeffective treatmentsformajor of modernneuroscienceresearchistoelucidatetheunderlying neurological andpsychiatricdisease.Inthisregard,amajorgoal in medicine,consideringthedebilitatingandcostlyeffects of Research intheneurosciencesisofconsiderableimportance understand howwethink,move,perceive,learnandremember. the intricatemachineryofnervoussysteminanattemptto study ofthenervoussysteminhealthanddisease.Itprobes Neuroscience isthedisciplineconcernedwithscientific n n n n n n n n n n n Junior Sophister(third)yearcoursesinclude: experimental design,datahandlingandresearchskills. disorders. You willalsobetrainedinscientificmethodologyand to behaviour, imagingthebrain,anddrugtreatmentofbrain its responsetoinjuryanddisease,therelationshipofbrain Other modulesfocusonthedevelopmentofnervoussystem, as onthestructureandoperationofnervoussystem. fundamentals ofmodernmolecularandcellularbiology, aswell several faculties. The courseinvolvesin-depthinstructioninthe as aresultmodulesareprovidedbyseveralSchoolswithin Neuroscience linksneurobiologywithcognitivescience,and What isNeuroscience? What willyoustudy? including entryrequirements,seepage140. For detailsofthefirsttwoyearsSciencecourse, BY2201, BY2202,BY2203andBY2204. Senior Freshman(secondyear)prerequisites:Biology Mathematical methods.Recommended:Biology1101. CH1101, ChemistryCH1102. Also: Mathematicsor Junior Freshman(first)yearprerequisites:Chemistry their specialistareaafterthesecondyear. Science degree(TR071)andmayselectNeuroscienceas Students whowishtostudyNeuroscienceapplythe Neuroscience Research skills techniques Applied laboratory ofpharmacology General principles Biochemistry andimmunology physiology Cellular biology Developmental Introduction toneurogenetics I Neurochemistry I Neurophysiology Neuroanatomy Introduction toneuroscience Engineering, Mathematics and Science 155
a three-month research project Mechanics and special relativity Electromagnetism Quantum mechanics Laser and modern optics Solid-state physics Physics, Physics and astrophysics or Physics and wish to study Physics Students who the Science degree (TR071) and astrophysics apply to two courses as their specialist may select one of these Sophister and Senior Sophister subject for the Junior (3rd and 4th) years. year prerequisites: Mathematics, Junior Freshman (first) Physics. year) prerequisites: Senior Freshman (second Mathematics, Physics. two years of the Science course, For details of the first see page 140. including entry requirements, part of the following courses: Physics is also an important Theoretical physics, page 168. TR035: of advanced TR076: Nanoscience, physics and chemistry materials, page 167. Physics You will also take specialist courses in areas such as You nanoscience, astrophysics, nuclear and elementary particle physics, superconductivity and computer modelling. of uranium enrichment, to computational analysis of climate models or to the biophysics of proteins. Studies in physics cover experimental and theoretical training in core subjects, including: skills in theory, data analysis and instrumentation. data analysis and skills in theory, College enjoys a worldwide reputation, and Trinity Physics at for study and provides an exceptionally stimulating environment the Senior Sophister for subsequent postgraduate research. In (fourth) year you will carry out College or Trinity in a modern research laboratory either in and many find this at another institution in Ireland or abroad, topics ranged part of the course particularly rewarding. Project in semiconductors, to monitoring from photogalvanic effects n n n n n Physics explores our universe in all of its diversity – from Physics explores our universe in all of its from quanta particles to planets, from crystals to chaos, Its to quasars and from superstrings to superconductors. applications are to be found in modern communications, of vital in computers, lasers and many other technologies flexible physics degree will help you develop A importance. a major research project a major research project ). The research The research e). (www.tcd.ie/neuroscienc Scientific literature skills Neuroimmunology, neuroinflammationexperimental and Neuroimmunology, neuropathology Neuropharmacology Neuropsychology Neurogenetics Neurophysiology II Neurochemistry II Further information Career opportunities An important part of your final year is An important part of your one of the several neuroscience that is carried out in College Institute of the Trinity research groups within Neuroscience in the following Research projects are currently available Alzheimer’s disease, research areas: Neurobiology of of MDMA Neurobiology of Multiple Sclerosis, Neurotoxicity memory and learning, (‘Ecstasy’) and cannabis, Neurobiology of disease, Neuroinflammation, Neurobiology of Parkinson’s research. Neurobiology of depression, Human sleep project will be preceded by a literature review, and will lead to a by a literature review, project will be preceded dissertation. e www.tcd.ie/Neuroscienc +353 1 896 8484 Tel: You may also study for a higher degree in neuroscience, may also study You pursue a research biological or psychological research, and career in an academic, government, pharmaceutical, (some recent biotechnology or medical research organisation College Institute of Trinity graduates are now employed by the Neuroscience). If you do not want to pursue a research career, the course provides transferable skills suitable for a wide variety of careers in teaching, business, management and industry. Some graduates also go on to take professional degrees in medicine, speech therapy or allied health-related sciences. As a graduate of neuroscience you can expect to find As a graduate of neuroscience you can expect general scientific employment in organisations that utilise your recent graduates training as well as your specialist skills (some Abbott and Quintiles). Biopharma, are now employed by Wyeth n n n n n n Senior Sophister (fourth) year courses include: (fourth) year courses Senior Sophister n 156 Engineering, Mathematics and Science an observatoryinIrelandorabroad. astrophysics researchprojectwiththeopportunityofworkingat Senior Sophisterstudentscarryouteitheraphysicsoran astronomy, suchasdark matter, blackholesandsupernovae. galaxies. There isalsoafocus onmoderndevelopmentsin planetary systemsaroundotherstars,interstellarmatterand provide amorein-depthstudyofourownsolarsystem, In theSeniorSophister(final)yearastrophysicslectures laboratory, usingopticalandradiotelescopes. on experienceofastrophysicalobservationinthethird-year to generalrelativityandmoderncosmology. There ishands- space plasmas,stellarevolution,galaxiesandanintroduction range overmodernastronomicalinstrumentation,spectroscopy, In theJuniorSophister(third)yearastrophysicscourses with astrophysicscoursesinthefinaltwoyears. substituting roughlyonequarterofthegeneralphysicscourses choose tostudyforadegreeinPhysicsandastrophysicsby At theendofSeniorFreshman(second)year, youmay still amajorpartofhumanendeavourinscience. the universebeyondcontinuestofascinateus. Astrophysics is wonder atthenightsky. The explorationofour solar systemand Since beforethedawnofhumancivilisationmanhasgazedin at theEuropean Space Agency inMadrid. the NASA GoddardSpaceFlightCenter intheUnitedStatesand at theUniversitiesofPotsdamand RegensburginGermany, at students haveworkedattheBelgian NuclearResearchCentre, project atalaboratoryorobservatory abroad.Inrecentyears astrophysics maygettheopportunity tocarryouttheir Final-year studentsinbothPhysics andPhysics Study abroad Physics andastrophysics research Tel: +35318961675 www.physics.tcd.ie is veryattractive. managerial oractuarialcareerforwhichatechnicalbackground the degree.Itcouldalsobeausefulprimarytrainingforlegal, employers valuetheskillsofproblem-solvingthatcomewith computing. There isalsoawiderangeofcareersforwhich biophysics, hospitalandhealthphysics,automation are diverseopportunitiesinelectronics,telecommunications, and productionfacilities,orthemeteorologicalservice. There institutions, governmentandindustrialresearchorganisations as inteaching. You mayalsofindacareerinacademic elsewhere inmodernhigh-technologyindustries,aswell Physics graduatesarealwaysindemandIrelandand Career opportunities Further information n Did youknow? universities andinstitutesaroundtheworld. in collaborationwithresearchgroupsotherleading Masters andPhDdegrees.Muchofthisresearchis universities arecurrentlydoingresearchleadingto 100 physicsgraduatesfrom Trinity Collegeandother physics departmentinIreland(northorsouth).Over The School of Physics in Trinity College is the biggest Engineering, Mathematics and Science 157 y Further information Further www.medicine.tcd.ie/physiolog 896 2723 +353 1 Tel:
This project will individual research project. Students who wish to study Physiology apply to the wish to study Physiology Students who Physiology select Physiology (TR071) and may Science degree as their specialist area for the 3rd and 4th years. area for the 3rd as their specialist year prerequisite: Mathematics or Junior Freshman (first) and 1102. Recommended: Biology 1101 Mathematical methods. year) prerequisites: Biology Senior Freshman (second and BY2208. BY2201, BY2202, BY2203 two years of the Science course, For details of the first see page 140. including entry requirements, Career opportunities What will you study? What is Physiology? When you graduate you will be able to use your general scientific training and specialised knowledge of physiology You may pursue to find employment in a wide variety of jobs. further training in physiology and become a research scientist in a government agency or a hospital, the pharmaceutical industry, Some graduates undertake further study in health- a university. related fields such as medicine or physiotherapy. In the Physiology Department at Trinity College, which is part of College, Trinity In the Physiology Department at physiology and how the School of Medicine, we focus on human by disease, although a comprehensive understanding it is affected in other of physiology will also involve studying comparisons emphasis on themes There is a particular mammalian species. our department, which reflect major research interests in physical exercise. including brain function and responses to During the second half of the Senior Sophister (fourth) year you During the second half of the Senior Sophister will undertake an As a student of physiology you will be provided with a detailed As a student of physiology you will be provided systems, and will understanding of a range of cell and organ experimental design, receive training in scientific methodology, data analysis and research skills. Physiology is the study of how cells work, how they co-operate of how cells work, how they co-operate Physiology is the study organs function in organs like the heart or brain and how these knowing how the together in the body as a whole. Because how it goes wrong in body works is essential for understanding basis of human sickness and disease, physiology is the scientific and animal medicine. be based in Trinity College or in one of its associated hospital Trinity be based in departments and will include a literature survey and production of a written dissertation. Some typical recent research projects of cannabis on brain cells, have looked at the toxic effects gastric motility in patients with pancreatitis, respiratory function in lung disease, the cellular mechanisms of memory formation, cardiovascular adaptations in athletes and muscle performance warm-up protocols. after different 158 Engineering, Mathematics and Science 3rd yearundergraduate studentsonarecentfield triptoGranCanariaphotographed intheCalderadeBandama. climate changeimpacts. conservation ofallformsplantlifeandtheirresponsetoglobal Trinity Collegespecialisesinthestudyofevolutionand biodiversity oflivingorganismsandintegrityhabitats. energy foranexpandinghumanpopulationwhilstconservingthe manipulation ofplantsinthefuturewillneedtoprovidefoodand change will be one of the biggest challenges of this century. Human global climate change. Dealing with the threats from global climate we use,andarecoretotheunderstandingofprocesses the foodweeat,oxygenbreathe,mostofmedicines The studyofplantsisvitalimportance;theyarethesource of freshandmarinewaters. Plants rangefromthelargestforesttreestosingle-celledalgae pursued inthefield,botanicgardenandlaboratories. Plant sciencesisthescientificstudyofplants. Thesestudiesare What willyoustudy? What isPlantsciences? including entryrequirements,seepage140. For detailsofthefirsttwoyearsSciencecourse, BY2205, BY2206,BY2207,BY2208,BY2209,BY2010. following: BiologyBY2201,BY2202,BY2203,BY2204, Senior Freshman(secondyear)prerequisites:4ofthe Junior Freshman(firstyear)prerequisites:Biology 1101 & 1102. as theirspecialistareaforthethirdandfourthyears. the Sciencedegree(TR071)andmayselectPlantsciences Students whowishtostudyPlantsciencesapplydirectly Plant sciences are alsowidelyapplicableinbusinessandindustry. The skillsyouacquireintheSophister(thirdandfourth)years to goontakeahigherdegreein Trinity Collegeorelsewhere. well asteachingatsecond-level. Alternatively, youmightdecide consultancy, environmentalprotectionoragriculturalresearchas to plantbiology, suchasnatureconservation,environmental When yougraduatecanmovedirectlyintoacareerrelated n n n n n n Courses include: Tel: +35318961274 www.tcd.ie/Botany (Gran Canaria). courses whichtakeplaceinIrelandandtheCanaryIslands All studentsaregiventheopportunitytoparticipatein research projectintheSeniorSophister(fourth)year. active researchlinesandemphasisisplacedonyourown Herbarium supportteaching. the CollegeBotanicGardenandinternationallyrecognised The laboratoriesandgreenhouseson Trinity College’s campus, Career opportunities Further information Pollination biology Pollination Plant molecularbiology Long-term environmentalchange change andglobalclimate Plant physiology Ecology andconservation Plant biodiversity All coursesarederivedfrom field Engineering, Mathematics and Science 159 y Career opportunities Career Further information Tel: +353 1 896 1366 Tel: Many graduates are pursuing academic and research careers, and research are pursuing academic Many graduates have entered the agricultural overseas. Others in Ireland and as service, and aid agencies, sectors, the wildlife and fisheries experts and as inspectors and managers. advisers and technical furthermore taken up College Zoology graduates have Trinity magazines and educational literature, publishing of wildlife in the media, fish farming, computer film making and careers second and third-level teaching, museum software development, lobbying with organisations work, tourism, environmental environmental consultancy and wildlife such as Greenpeace, conservation and management. www.tcd.ie/Zoolog
In previous years projects have included Biodiversity Developmental biology form and function Vertebrate Parasitology Applied molecular biology Ecology Physiology Animal behaviour Students who wish to study Zoology apply to the Science apply to the Science wish to study Zoology Students who Zoology as their specialist and may select degree (TR071) 3rd and 4th years. area for the 1101 year prerequisites: Biology Junior Freshman (first) Mathematics or Mathematical methods. and 1102, year) prerequisites: Biology Senior Freshman (second BY2208. BY2201, BY2202, BY2203, two years of the Science course, For details of the first see page 140. including entry requirements, Zoology What will you study? What is Zoology? A major component of the Senior Sophister (fourth) year is the major component of the Senior Sophister A There are also additional options selected from the environmental or medical zoology programmes. research project. squirrels, deep African children, conservation of parasites in climate change sea fisheries and others on biodiversity, in specialist areas are selected from Tutorials and pollution. evolution wildlife biology, marine biology, freshwater biology, developmental biology and molecular biology, and behaviour, parasitology. n n n n n n n n Work in the Junior Sophister (third) year provides a broad Work in: overview of zoology and includes core courses The course highlights the major concerns of modern zoology in The course highlights the major concerns and introduces relation to environmental and medical biology, fieldwork you to cell biological and other analytical techniques, and computer-aided data handling procedures. Zoology is the scientific study of the animal kingdom, along with study of the animal kingdom, along with Zoology is the scientific This involves building its evolution, diversity and environment. kinds of animals knowledge of both the structure of different that and how they function, and the complex relationships their surroundings. govern how animals relate to each other and on three areas of our Zoology provides fundamental information and human health. society: the environment, food production 160 Engineering, Mathematics and Science work. special molecularmodellingcourses, practicalworkandproject Core componentsoftheChemistrydegreearetakenalongwith The courseisbasedontheChemistrydegree(seepage145). in arangeofareassuchasdrugdesignandmaterialschemistry. molecular modellingtounderstandandsolvechemicalproblems a chemistrydegreebutarealsointerestedinlearningtouse The programmewillsuityouwellifwouldliketoobtain n n n n reactivity ofmoleculesandsolidsincluding: applications. This coursefocusesonmodellingthestructureand modelling haveleadtoanexplosivegrowthinarangeof understand andexplorechemistry. Advancements inmolecular Molecular modellingistheuseofcomputerto What isMolecularmodelling? Course overview Is thistherightcourseforyou? molecular modelling DEGREE AWARDED: POINTS 2011: PLACES 2012: COURSE CODES: with Chemistry materials, page167 TR076: Nanoscience,physicsandchemistryofadvanced TR075: Medicinalchemistry, page165 TR071: Chemistry, page145 See also: Special EntryRequirements: Advanced GCE(A-Level) Leaving Certificate The theory behind the modelling approaches themodelling The theorybehind proteins, drugmoleculesandcomputationaldesign moleculesincludingDNA, andbio-organic Modelling organic and behaveduringchemicalreactions arearrangedinmaterials ofhowelectrons The modelling catalysts etc. and nano-materialsincludingoxides,semiconductors, ofthestructureandpropertiesmaterials The simulation
Grade C HC3 HC3 Grade C
B.A. 430 5 TR074 In one of physics, In one of physics, chemistry orbiology chemistry orbiology chemistry, physics/ Mathematics Mathematics academic orresearchlaboratoryabroad. mid-December. ThismaybedoneinTrinity Collegeorinan a computationalproject, As aSeniorSophister(fourth-yearstudent)youwillundertake computational experimentsusingmolecularmodelling. class timeisspentincomputerlaboratoriesperforming In theJuniorSophister(third)year, abouthalfofyourlaboratory and modellinginsolid-statematerialschemistry. modelling proteinstructure,drugdesign,moleculardynamics, including generalmolecularmodelling,quantummechanics, chemistry withadditionalcoursesinmolecularmodelling In thethirdandfourthyearsyouwilltakecorecoursesin The Sophisteryears per weekintheFreshman(firsttwo)years. lectures andtutorialsaround6hoursoflaboratorytime There areapproximately19hoursofsupervisedstudyin applications. introduce theconceptsofmolecularmodellingandtohighlight spent incomputerlaboratories.Speciallecturesaregivento some oftheexperimentalchemistrylaboratoryclasstimeis in theSciencecourse– TR071 (seepage140).However, and mathematicsoneofbiologyorphysicsasstudents You willstudythesamefoundationcoursesinchemistry The Freshmanyears magnetic materials), financialservicesandmeteorology. (developing catalysts),materials chemistry(semi-conductors/ include: pharmaceutical(computational drugdesign),chemical where peopleareemployeddirectly inscientificcomputing into managementandbusiness. Examplesofindustries sectors oftheIrisheconomy. Chemistsalsofitscomfortably pharmaceutical industries,oneofthelargestandfastestgrowing range from teaching and research to working in the chemical and environments andinotherprofessions.Careeropportunities an attractiveprospectforemployersbothwithincomputing specially developedcomputationalskillsmakegraduates open (see TR071 –Chemistry page145).Inadditionthe opportunities availabletoregularchemistrygraduatesremain The degreeisfundamentallychemistry-basedandsothe McGill andDukeuniversitiesinNorth America. Vienna, Berlin,Madrid, Toulouse andUtrechtinEurope have completedtheirresearchprojectsinrecentyearsinclude out theirfinal-yearresearchprojects.Centreswherestudents large numberofotheruniversitieswherestudentsmaycarry The SchoolofChemistryhasexchangeagreementswitha assessment andend-of-yearexaminations. You willbeassessedbyacombinationofcontinuous Career opportunities Study abroad Assessment typicallyfromlateSeptemberto
Engineering, Mathematics and Science 161 Mathematics Mathematics In two of: physics, chemistry, biology, biology, chemistry, mathematics, physics/ geology, chemistry, applied geography, or mathematics agricultural science biology, chemistry, geology, mathematics, applied or geography mathematics In two of physics, physics, of two In TR077 12 460* B.A.
Grade C Grade HD3 or OC3 Grade B HC3
Leaving Certificate GCSE Advanced GCE (A-Level) Special Entry Requirements: Combinations of subjects not permitted: Physics/chemistry with physics or chemistry Agricultural science with biology Applied mathematics with mathematics See also: TSM, page 36 TR001: TR071: Science, page 140 Earth sciences Earth CODES: COURSE PLACES 2012: POINTS 2011: AWARDED: DEGREE Is this the right course for you? Earth sciences In an increasingly interconnected and complex world, employers are seeking graduates who can combine analytical rigour with an understanding of real-world problems that are not limited Trinity The Earth sciences degree at to a single discipline. College, positioned on the interface between geography, environmental sciences, physics and chemistry, geology, This degree programme focuses on Planet Earth, and in This degree programme focuses on Planet surface the Earth’s particular the composition and structure of layers, atmosphere and oceans, the dynamic processes that influence and shape our world, and the formation and distribution of resources that we depend upon. Notable areas of study include climate change, geomorphic hazards (earthquakes, landslides, volcanism, flooding), pollution and the availability and exploitation of resources, including energy The degree aims to produce articulate and informed resources. graduates with a broad knowledge of Planet Earth by providing students with a firm grounding in those sciences that relate directly to the surface of the Earth and to surface-forming and atmospheric and oceanic processes. Particular emphasis is placed on the development of critical thinking, a scientific approach to understanding, and training in relevant, transferable skills, including laboratory- and field-based analytical techniques.
e “I began an undergraduate degree in Computational “I began an undergraduate Chemistry with molecular Chemistry (now called in 1999. I chose this College Trinity modelling) in love for chemistry sets and course out of my childhood The really know what to expect. Nintendo, and didn’t physics, degree allowed me to develop skills in chemistry, was not until mathematics and computer science, but it the power a final year research project, that I realised systems. (and fun) of computer modelling of chemical position in This experience drove me to accept a PhD and I spent the group of Professor Graeme Watson, properties three years studying the electronic structure time, I had the of post-transition metal oxides. During this opportunity to use some of the largest supercomputers on my in the world, publish research papers based to see an experimental simulations, and most excitingly, After group from Oxford University verify my predictions! for the Colorado to work graduating, I moved to Denver, of new U.S. Department of Energy on the development In 2009, materials for converting sunlight into electricity. the European I was awarded a research fellowship from and continue Union to move to University College London, I In 2011 my research on energy materials and processes. Chemical secured a position in the centre for Sustainable at the Universirty of Bath. I have had the Technologies the globe, opportunity to present my research around hold everywhere from Hawaii to Seoul, and I currently The Shanghai. a visiting fellowship to Fudan University, goals of science are universal, and pursuing a career in science has allowed me to experience a world I never knew existed.” Dr. Aron Walsh Dr. Graduate Profile Further information Further Contact: Prof. Graeme Watson Contact: Prof. E-mail: [email protected] 896 1357 +353 1 Tel: g www.tcd.ie/Chemistry/undergraduate/molecular-modellin 162 Engineering, Mathematics and Science Ireland. for studentstobasetheirresearchprojectworkoutside one overseasfieldcourse,togetherwithopportunities degree. Inaddition,theEarthsciencesdegreeincludesatleast carry outpartoralloftheJuniorSophister(third)year with alargenumberofotheruniversitieswherestudentsmay The SchoolofNaturalScienceshasexchangeagreements assessment andend-of-yearexaminations. Most modulesareassessedbyacombinationofcontinuous programme. some modulesdrawnfromoutsidetheEarthsciencesdegree Sophister year, studentsalsohavetheopportunitytotake degree programmes(seepages149-150).IntheirSenior a varietyofmodulesfromtheexistingGeographyandGeology The Sophister(thirdandfourth)yearsenablestudentstotake page 14). for earthscientistsandamodulefromtheBroadCurriculum(see geographical data);Geochemistryforearthscientists;Physics Geography (ChangingworldsandCollectionanalysisof Structural geologyandMapwork,plusamoduleofFieldwork); Geology (Mineralogy, Palaeontologyandstratigraphy, Petrology, In theSeniorFreshman(second)year, studentstakecoursesin and Introductiontophysicalchemistry. geography II(human-environment);Maths;Foundationphysics, Geology; IntroductiontogeographyI(physical); In theJuniorFreshman(first)yearstudentstakesixmodules: they arealsoasourceofmanythesolutions! underpin manyoftheproblemscurrentlyfacedbyhumankind, potentially hugelyrewarding:notonlydotheearthsciences and oceans. The degreeisbothhighlychallengingandalso influencing theinhabitedsurfaceofEarthanditsatmosphere provides aninsightintothecomplexitiesofphysicalprocesses Tel: +35318961713 E-mail: [email protected] www.naturalscience.tcd.ie/undergraduate/earth-science.php from theEarthsciencesdegree. teaching, andresearchallpotentiallyoffer careers forgraduates such asoilandgas,riskassessment,environmentalanalysis, and managementofresources,includingmineralreserves planning, overseasassistance,theassessment,exploitation Areas suchasenvironmentalconsultancy, environmental Further information Career opportunities Study abroad Assessment Course overview
option. research, youmustbepreparedtotakethisrouteasacareer field. Asmostgraduatesofthisprogrammegoontocareersin Human geneticsisaknowledge-driven,dynamicandexciting n n n n detail. Examplesofremarkableadvancesinknowledgeinclude: technology hasmadeitpossibletostudygenesinmuchgreater and societies.Ithasdevelopedrapidlyinthelastdecadeasnew It alsoexaminestheeffects ofthesegenesonbothindividuals Human geneticsisthestudyofgenes–orheredityinhumans. Is thistherightcourseforyou? What isHumangenetics? DEGREE AWARDED: POINTS 2011: PLACES 2012: COURSE CODES: Human genetics of thecourse.Seepage148. specialist subjectfortheSophister(thirdandfourth)years (TR071) havetheoptionofselectingGeneticsastheir Students whoapplyforthegeneral-entrySciencecourse plant, humanandotheranimalgenes. while theGeneticsoptioninScience(TR071)examines Human genetics(TR073)focusesonthegenesofhumans, Applied mathematicswith Physics/chemistry withphysicsorchemistry Combinations ofsubjectsnotpermitted: Special EntryRequirements: Advanced GCE(A-Level) GCSE Leaving Certificate The application ofDNAThe application finger-printingtoforensicscience ofmankind The abilitytotracetheevolution for inheriteddisorders ofgeneticandstem-cell-basedtherapies The development disorders basisofmanyinherited ofthemolecular The discovery
HC3 Grade B OC3 orHD3 Grade C
B.A. 535* 15 TR073 In two of physics, In two of physics, applied mathematics mathematics and biology, chemistry, applied mathematics mathematics and physics/chemistry, biology, chemistry, Mathematics Mathematics
Engineering, Mathematics and Science 163
This is often in the USA, with some Human genetics is housed in the Smurfit Institute of Institute Smurfit the in housed is genetics Human research facilities.Genetics, with state-of-the-art 1 in Europe in the 2010Ireland was ranked number in molecular geneticsnational rankings for research Thomson Scientific Essential and genomics (source: the as such countries of ahead indicators), Science This ranking is based on the high UK and Germany. in papers research by received citations of numbers scientistsgenetics published from Ireland, primarily by dedicatedat the Smurfit Institute of Genetics - the only has institute The Ireland. in institute research genetics an outstanding reputation for producing high-quality European three Ireland’s of two holds and research Advanced Grants in biology - the Research Council most prestigious research awards in Europe. at Trinity College? at Trinity Why study Human genetics n n Further information Assessment Study abroad Career opportunities s www.tcd.ie/Genetic +353 1 896 1140 Tel: You will be assessed by a combination of continuous will be assessed You assessment and end-of-year examinations. you may be able At the end of the Junior Sophister (third) year, in a human genetics to spend the summer months working research laboratory. financial assistance provided. Many Human genetics graduates go on to study for a higher degree or to a career in research, whether in a university, Opportunities exist in research institute, or in industry. biotechnology and pharmaceutical companies, agricultural organisations, medical or clinical diagnostic laboratories, forensics, public health and epidemiology programmes, and in teaching. Genetic counselling is a rapidly expanding field that might also interest you. Other graduates have gone into careers such as medicine, patent law or science journalism. Even if you choose a career not directly related to the scientific subject, the skills of critical thinking and problem solving provided by the Human genetics degree will put you in high demand. In the Senior Sophister (fourth) year, you will be able to year, Sophister (fourth) In the Senior out interest, and will carry in areas of particular specialise such as: hereditary project in an area an original research biology, stem-cell cell death, neural development, blindness, lecture genetics. Specialist and psychiatric human evolution genetics, genetics of vision, behavioural courses include cancer evolutionary genetics. genetics and human
deals with studies the mechanisms explores the control of of mutation and its role in cancer and function of the nervous system and their influences Cancer genetics and mutation: Computer programming: provides an essential skill for this field, where large amounts of data must be analysed, and one which is easily transferable to other careers evolution: and human Population genetics Neurogenetics: studies how genes control development on behaviour and psychiatric disease Molecular and cell biology: gene expression and function of genes in various cellular processes, such as cell death, proliferation or differentiation genetic variation in populations and the role of this variation in evolution, especially in humans Medical genetics: includes the identification of genes development causing various clinical disorders and the of genetic and stem-cell therapies to treat them of genetic and stem-cell therapies to treat Course overview Course Subjects are taught through a combination of lectures, tutorials and practical courses. n n n n n n In the 3rd and 4th years you will undertake specialised studies In the 3rd and 4th years you will undertake The Sophister years In each of the first two years you will take some of the In each of the first two years you will take chemistry and same courses as Science students: biology, year and biology mathematics in the Junior Freshman (first) and 2209, chemistry modules BY2201, 2203, 2204, 2205, 2208 (second) year – see and mathematics in the Senior Freshman weekly genetics page 141-143. In addition you will have a tutorial with faculty from the Department. in areas such as: The Freshman years years you will In the Junior and Senior Freshman (first two) chemistry and mathematics, concentrate on the areas of biology, of genetics in and will also be introduced to the principles separate tutorials. Over the four-year period of your degree programme, the Over the four-year period the importance of studies in course will also demonstrate the mouse. Seminar and tutorial model organisms, especially from various disciplines, with staff programmes, organised your studies, and encompass such are an integral part of between genetics and the social subjects as the interactions and the general philosophy and law, sciences, ethics, linguistics, genes, society and culture. relationship between This course provides you with a strong base in the basic strong base in the basic provides you with a This course as well as in chemistry and mathematics, biology, sciences of population and – molecular, principles of genetics the classical bioinformatics and molecular evolution. quantitative genetics, 164 Engineering, Mathematics and Science any environment that requires strong numerical and logical skills. and logical strong numerical any environmentthatrequires broad mathematicaltrainingthat will,inturn,allowyoutowork This four-yearprogrammeisdesigned toprovideyouwitha students. a longperiodinprovidingdiversecareeropportunitiesformany will requirefurthertraining. The course hasbeensuccessfulover career inactuarialwork,financeoraccounting,althoughthese then thiscoursewillsuityouwell.Itisalsoagreatstartfor interested inapplyingmathematicalsolutionstoproblemsolving, If youhaveanaturalabilityinmathematicsandaregenuinely mathematical areas. world class,whilealsocateringforthosewithtalentsindifferent experience frommanypartsoftheworld,courseaimstobe into methods.Withanacademicstaff thatbringsexpertiseand numeracy, abilityinabstractreasoningandtheskilltoturnideas for mathematicsgraduatesinthejobmarketwhichvalues is anexcellentchoiceforanyonehopingtomeetthedemand the areasthatmostsuityourinterestsandtalents.Mathematics basic areasofmathematicsandthenallowyoutospecialisein The courseaimstoprovideyouwithafirmfoundationinallthe Course overview Course content Is thistherightcourseforyou? TSM points: TR035: Theoretical physics,page168 See also: programme, and TSM studentsmustbemoreselective. workload islessintensethanthatofthesinglehonor mathematics modules.However, for TSM studentsthe Single honorand TSM studentsfollowthesame combine withmathematicsseepage36. degree isawardedinbothsubjects.Forsubjectsthat programme. TSM isajointhonorprogramme. An honors other subjectwithinthetwo-subjectmoderatorship(TSM) TR001 (TSM):Mathematicsmustbecombinedwithone TR031: Mathematicsisstudiedasasinglehonorcourse. DEGREE AWARDED: POINTS 2011: PLACES 2012: COURSE CODES: Mathematics Special EntryRequirements: Advanced GCE(A-Level) Leaving Certificate
HB3 Grade B See page27 B.A. 485 30 TR031 Mathematics Mathematics 515*-565 25 TR001 (TSM) n with twoofthem. the followingtopics.Insecondsemester, youwillcontinue In addition,duringyourfirstsemesteryouwillbeintroducedto absolutely universaltomathematics. They arequiteintensive. a structuredwayofdealingwithmathematicalideasthatis are fundamentaltoawiderangeofmathematicsbutalso in algebraandanalysis,whichintroducenotonlytopicsthat In theJuniorFreshman(first)yeartherearecoremodules The Freshmanyears n n n n project conductedunderthesupervisionofamemberstaff. An importantaspectofthecourseisan computer-aided design. engineering, mathematicaleconomics,cryptographyand and secondyear, butadditionalpossibilitiesincludecomputer wide-ranging options.Manysubjectscovertopicsfromthefirst opportunity tochoosesubjectsfromaselectionofover20 In theSophister(thirdandfourth)yearsyouwillhave The Sophisteryears n n The modulesoffered canbegroupedintofourareas: of interest. to begintailoringthedegreeyourownstrengthsandareas or ‘BroadCurriculum’ modules(seepage14). This allowsyou Freshman topicsingreaterdepth,oryoumaychoosenew choice fromarangethatincludesexploringsomeoftheJunior algebra andanalysis.Inadditionyouwillselectmodulesofyour In theSeniorFreshman(second)yearyouwillcontinuetostudy Junior Freshman(first)year. There areapproximatelytwentyhoursofclassesperweekinthe specialise intheareasthatappealmosttoyou. as aSophister(thirdandfourth-yearstudent)youwillbeableto gradually morechoiceisoffered insubsequentsemestersuntil, All studentstakecommonmodulesintheirfirstsemester, and degree) mathematical modulesessentialforthe Theoretical physics Classical mechanics Statistical modelsandmethodology The mathematicsoftheoreticalphysics problems tosolvepractical mathematics Applied andcomputational abstract theories basicconceptsand Pure mathematicswhichexplores (this willincludepracticalwork) Introduction to computerarchitectureandprogramming subsequent optionalmodules) Introduction to statistics(thisopensthewayformany (thisleadsontomanyofthe independent research
Engineering, Mathematics and Science 165
Mathematics Mathematics In two of: physics, chemistry, biology, biology, chemistry, mathematics, physics/ geology, chemistry, geography, mathematics applied or agricultural science biology, chemistry, geology, mathematics, applied or geography mathematics In two of physics, physics, of two In TR075 28 500 B.A.
Grade C Grade OC3 or HD3 Grade B HC3
Medicinal chemists are the professionals behind the the behind professionals the are chemists Medicinal as such drugs new of development and discovery Squibb which is manufactured by Bristol Myers Taxol, in Swords (Co. Dublin) and has saved the lives of many women with breast cancer. Did you know? n Leaving Certificate GCSE Advanced GCE (A-Level) Special Entry Requirements: Combinations not permitted: Physics/chemistry with physics or chemistry Agricultural science with biology Applied mathematics with mathematics See also: page 145 TR071: Chemistry, page 160 TR074: Chemistry with molecular modelling, of advanced TR076: Nanoscience, physics and chemistry materials, page 167 Medicinal chemistry Medicinal CODES: COURSE PLACES 2012: POINTS 2011: AWARDED: DEGREE What is Medicinal chemistry? Is this the right course for you? Medicinal chemists are the creative talent behind the modern As well as being expert chemists, they pharmaceutical industry. have a particular expertise in molecular design, the synthesis of drugs and the understanding of biological functions. if your dream is to design and prepare new drugs, if Yes, you want to understand the biological reasons by which they cure diseases, if you have a natural flair for chemistry and are simultaneously interested in developing skills and expert knowledge relevant to the rapidly growing pharmaceutical industry. Trinity College Dublin is ranked as the world’s 15th-best 15th-best world’s the as ranked is Dublin College Trinity QS rankings). mathematics (2011 university for n Did you know? Did you Further information Career opportunities Study abroad Assessment e www.maths.tcd.i +353 1 896 1949 Tel: A degree in mathematics opens up the possibility of a career A have found in a variety of industries and sectors. Graduates skills have employment in computing, where mathematics The financial services and immediate and practical application. first destinations internet security sectors are also common teaching, for graduates. Other options include statistics, actuarial work, finance, and all areas of pure and accountancy, further study or applied mathematics. Many of these involve intensive research. You may choose to spend the Junior Sophister (third) year may choose You exchange at a European university as part of the Erasmus programme. You will be assessed by a combination of continuous will be assessed by a combination You examination, with all work assessment and end-of-year last two years counting towards your undertaken during your final degree result. 166 Engineering, Mathematics and Science n n n n n n chemistry courseswillinclude: In theJuniorSophister(third)year, yourspecialmedicinal medicinal chemistryunits. chemistry inordertoallowfortheintroductionofnew emphasis beingplacedonphysicalchemistryandinorganic The overlapwillbemainlyinorganicchemistry, withless with theChemistryprogramme(page145). medicinal chemistry, althoughtherewillbeconsiderableoverlap course willbranchoff intothemorespecialisedaspectsof In theJuniorandSeniorSophister(thirdfourth)years The Sophisteryears chemistry. group willintroduceyoutotheideasandtechniquesofmedicinal 141-143. Inaddition,specialsessionsheldspecificallyforyour further biology(20units)ormathematics–seepages chemistry and20prescribedunitsofbiologywiththeoption year. IntheSeniorFreshman(second)yearyouwilltake (1101 &1102) andmathematicsintheJuniorFreshman(first) programme, takingchemistry(CH1101 &CH1102), biology In thefirsttwoyearsyouwillfollowScience(TR071) The Freshmanyears understanding theirbiologicalactions. to thedesignandproductionofnewmedicinalcompounds chemistry butfocuseson,andextendsinto,topicsofrelevance This degreeprovidesyouwithasoundgeneralgroundingin n n at anoverseasuniversity, orinacommerciallaboratory. supervision ofamemberstaff, inachemistrydepartment This maybecarriedouteither inTrinity Collegeunderthe Practical workinthefinalyear will consistofa programme. specific diseasesordrugtypes),willalsofeatureonyour methods. Casestudiesinmedicinalchemistry(focusingon as computationalmedicinalchemistryandmodernanalytical systems, combinationalchemistryanddrugdelivery, aswell medicinal chemistryofthecardiovascularandcentralnervous In theSeniorSophister(fourth)year, youwillcoverthe Course overview industry) Industrial chemistry(shortcourseonmedicinalin (studyofdrugsbasedonthesteroidskeleton) Steroid drugs drugs inthisarea) (studyofthedevelopmentnew Anti-malarial chemistry combat themicroorganismsthatcausedisease) agents(compoundsthatcan andanti-infective Anti-microbial anti-cancer agents Anti-viral and diseases) Drug design(howchemistsnewdrugsforspecific withthebody) (howdrugsinteract Pharmacology ofmedicinalchemistry Basic principles research project. degree foragraduatecourseinmedicine. Medicinal chemistrywouldalsoserveasanexcellentprimary Touche. such asWyeth, Abbot, GlaxoSmithKline,ServierandDeloitte& Former graduatesofthiscourseareworkingincompanies all possibilitiesopentoyouasagraduateofmedicinalchemistry. industry itself,business,finance,administrationandteachingare in awidevarietyofareas.Inadditiontothepharmaceutical during thiscoursewillmakeyouhighlyattractivetoemployers As withgraduatesinothertypesofchemistry, theskillsacquired assessment andend-of-yearexaminations. You willbeassessedbyacombinationofcontinuous Bologna universities. Regensburg, Madrid,Liverpool,Copenhagen,Montpellierand their final-yearresearchprojects,fromOctobertoDecember, in To date,arrangementshavebeenmadeforstudentstocarryout Tel: +35318963411 www.tcd.ie/Chemistry/undergraduate/medicinal-chemistry Career opportunities Assessment Study abroad Further information Engineering, Mathematics and Science 167
– which e www.crann.tcd.i Some laboratory training is provided Is this the right course for you? the right course Is this Course overview The Sophister years will study In the Sophister (third and fourth) years, you chemistry. specialised courses in materials physics and year includes lectures The course in the Junior Sophister (third) quantum mechanics, on solid state physics and chemistry, macromolecules, lasers, thermodynamics, electrochemistry, materials preparation and group theory, spectroscopy, microelectronic technology. The practical course will introduce you to a wide range of techniques for the synthesis, preparation and characterisation of modern materials. in CRANN using their state-of the art facilities in nanofabrication and nanocharacterisation. The Senior Sophister (fourth year) course further explores nanoscience and other topics, including more advanced solid non-linear optics, materials for state physics and chemistry, electronic and optoelectronic devices, conducting and insulating surface and polymers and metal oxides, superconductivity, computer simulation and advanced growth interface effects, techniques (with specific examples of their applications in the nanosciences). This course will appeal to you if you are interested in science you are interested in will appeal to you if This course to your scientific skills strong desire to apply and have a are shaping our futures. and technologies that industries you how to use and apply the principles This degree will teach to solve practical problems associated of chemistry and physics of new technologies and their application with the development understand how to make, To to the areas of nanoscience. use advanced materials, nanostructures or develop, control and to have a thorough grounding in both nanodevices it is advisable chemistry and physics. The Freshman years (TR071) In the first two years you will follow the Science and mathematics physics programme, taking chemistry, tutorials on historical There will be special (pages 141-143). materials science from and modern aspects of nanoscience and and Physics of Schools the in based experts leading world Adaptive and in CRANN (Centre for Research on Chemistry, Nanostructures and Nanodevices) – the properties of materials and other aspects of nanoscience. the properties of materials and other aspects and 6 There are approximately 15 hours of lectures/tutorials hours in laboratory classes each week. is Ireland’s research centre for nanoscale materials. In the research centre for nanoscale is Ireland’s special courses on Senior Freshman (2nd year) there will be
Mathematics Mathematics Mathematics chemistry, biology, biology, chemistry, physics/chemistry, mathematics applied and mathematics chemistry, biology, chemistry, mathematics, or or mathematics, applied mathematics In two of physics, physics, of two In In two of physics, physics, of two In TR076 10 475 B.A.
Grade C C Grade OA2 or HC3 A Grade HC3
Advanced GCE (A-Level) GCSE or Advanced GCE (A-Level) Leaving Certificate Special Entry Requirements: See also: Theoretical physics, page 168 TR035: TR071: Science, page 140 page 160 TR074: Chemistry with molecular modelling, 165 page TR075: Medicinal chemistry, Combinations not permitted: Physics/chemistry with physics or chemistry Applied mathematics with mathematics and chemistry of materials advanced COURSE CODES: PLACES 2012: POINTS 2011: AWARDED: DEGREE Nanoscience, physics What is Nanoscience Advanced materials? and The ability to create new technologies or devices would not be possible without the use of advanced materials. Energy is an important issue for any new device, and making devices smaller approaching the nano-scale can reduce the energy cost, or nanodevices These nanostructures while increasing speed. can behave in surprising ways which are not like miniaturised versions of the macroscopic devices. Ultimately this behaviour is explicable by quantum mechanics but new methods of fabricating or interacting with such nanostructures is what nanoscience is all about, ideally to the benefit of technology and to people. Nanoscience incorporates applications in photonics, medical diagnostics, ultra-fast electronics and many other areas Advanced materials which in addition use advanced materials. include superconductors, polymers, lasers and optoelectronics and they can be found in applications ranging from computers and electronics, to telecommunications and broadcasting, to airlines and healthcare. 168 Engineering, Mathematics and Science materials, akeyresearchareain Trinity Collegeitself. also opportunitiestocarryoutpostgraduatestudyinadvanced as thesemiconductor, polymerandopticalindustries. There are employment incutting-edgehightechnologyindustries,such This degreewillprovideyouwithaflexiblequalificationfor to learnaboutdifferent countriesandcultures. students todeveloptheirpracticalskillsinmaterialsscienceand in Australia, Belgium,France,GermanyortheUSA. This allows Many studentscarryouttheirfinalyearprojectabroad,mainly assessment andend-of-yearexaminations. You willbeassessedbyacombinationofcontinuous University ofPotsdam(UniversitätPotsdam)Germany. The ScrippsResearchInstitute,LaJolla,California;andthe micro- andnano-electronicsresearchcentreinLeuven,Belgium; Laboratories whereprojectshavetakenplaceincludetheIMEC as nano-technology, andsmartbiomimeticmaterials. students dotheirprojectsininnovativeresearchareassuch nanostructures ornanodevicesinreal-lifesituations.Many become familiarwiththeapplicationsofadvancedmaterials, project, frequentlyabroadinanindustriallaboratory, to In thefinalyearyouwillalsocarryoutaresearch Tel: +35318961726/2040 www.tcd.ie/Chemistry/nanoscience Further information Career opportunities Study abroad Assessment n Did youknow? Schools ofPhysicsandChemistryin Trinity College. into the nanoworld. CRANN was pioneered by the College andhasstateoftheartfacilitiesforresearch It is housed in the new Naughton Institute in Trinity in the CRANN research centre for nanoscale materials. Many graduatesfromthiscoursegoontodoresearch graduates areindemandfortheirtechnicalskillsandversatility. which rangeswidelyacrossphysicsandmathematics.Its law, finance andcomputing. Trinity Collegeprovidesacourse provides thebasisformanycareeroptionsinindustry, medicine, an academiccareerinmathematicsorphysics.Forothersit experimental investigation.Forsomeitisthefoundationfor fundamental level,usingmathematicaltheoriesguidedby Theoretical physicsexploresthenaturalworldatitsmost superconductivity, lasertechnologyandsemiconductors. the practical classes you will study the latest ideas in magnetism, mechanics aresomeoftheexciting topicsthatyouwillstudy. In Cosmology, astrophysics,chaos,relativityandquantum hours oflectures,tutorialsandlaboratoryclassesperweek. in mathsand30creditsphysics. There areapproximately24 (third andfourth)yearsstudentstake,onaverage,30credits 20 creditsinphysics(fromatotalof60credits).IntheSophister (first andsecond)yearsstudentstake40creditsinmaths the Theoretical physicsprogramme inmind.IntheFreshman curricula, includingseveralmodulesspecificallydesignedwith The coursecombinesmuchofthemathematicsandphysics Trinity experience. attracts aspiritedandtalentedclassthatmakesthemostof the future,youcandothisin Theoretical physics.Itconsistently this course.Ifyouwanttokeepawiderangeofoptionsopenfor scale fromthequarktoBigBang,youwillbestimulatedby be developedtounlockthesecretsofuniverseonevery If youenjoymathematicsandseeinghowphysicaltheoriescan What isTheoreticalphysics? Course content Course overview Is thistherightcourseforyou? DEGREE AWARDED: POINTS 2011: PLACES 2012: COURSE CODES: Theoretical physics materials, page167 TR076: Nanoscience,physicsandchemistryofadvanced TR071: Science,page140 TR031: Mathematics,page164 See also: Special EntryRequirements: Advanced GCE(A-Level) Leaving Certificate
HB3 Grade B
B.A. 490* 40 TR035 In mathematics and physics physics In mathematics and Engineering, Mathematics and Science 169
equations physics cosmology Quantum field theory geometry Differential General relativity Partial differential Condensed matter theory Electron and photon High energy physics Nanoscience Advanced topics Interstellar medium and Computer simulation
Other mathematical modules Other mathematical modules and a project option are available each year Senior Sophister Senior Sophister (4th year) 25-35 credits maths, 25- 25-35 credits physics (total 60 35 credits credits) In addition you will complete a computational physics project. There are also tutorials to develop your physics problem solving ability n n n n n n n Optional courses are in: n n n n
and electrodynamics physics Computer simulation I class, and workshops to develop communication skills Classical field theory Quantum mechanics Statistical physics Atomic and nuclear Condensed matter Condensed matter Astrophysics I or There is also a laboratory physics I physics II Further information e e or www.physics.tcd.i www.maths.tcd.i +353 1 896 1949 / 2019 Tel:
Junior Sophister Junior Sophister (3rd year) 30 credits maths,, 30 credits physics 30 credits n n n n n n n n physics Analysis Mechanics Equations of mathematical Algebra
Topics in both classical and in both classical Topics modern physics are taken: The physics of motion, Thermal physics, Oscillations and waves, Optics, Materials, Quantum physics, Nuclear physics, Electromagnetic interactions, Special relativity, Chaos and complexity, Astrophysics. There are laboratory classes and group study projects 40 credits maths, 40 credits n n n Junior & Senior Freshman Junior & Senior years) (1st & 2nd physics 20 credits n Trinity College Dublin is ranked in the world’s top 50 Dublin is ranked in the world’s College Trinity universities for Mathematics and for Physics/Astronomy QS rankings). (2011 n Did you know? Physics The teaching of physics is divided into two modules (each of 10 credits) in each of the Freshman years and 5 credit lecture and 10 credit practical/project modules in the Sophister years Career opportunities Assessment A total of 60 ECTS credits is to total of 60 A each year. be taken in Maths Many of our graduates proceed to PhD degrees in leading institutions throughout the world (such as Cambridge University, Harvard, and Imperial College London) in mathematics and Alternatively, experimental physics as well as theoretical physics. The broad scientific an infinite world of possibilities beckons. background and skills that the course develops are in great demand by employers in diverse areas including patent law, journalism, weather forecasting, telecommunications, medical scientific computing and physics, information technology, teaching. Continuous assessment and end-of-year examinations make up Continuous assessment and end-of-year the assessment process. 170 Health Sciences Dental hygiene Health Sciences Midwifery: Bachelorinmidwiferystudies Midwifery Medicine Human nutritionanddietetics Human healthanddisease Dental technology Dental science Dental nursing 171 185 183 179 178 177 176 174 172 Nursing Radiation therapy Physiotherapy Pharmacy Occupational therapy Bachelor in nursing studies Bachelor innursing Children’s nursing andgeneralintegrated nursing Intellectual disability Psychiatric nursing (Adelaide) General nursing General nursing 196 195 193 191 190 186 186 186 186 186 186 Health Sciences 171
Head and neck anatomy Human diseases and general pathology Periodontology & implantology Research methods Cariology & paediatric dentistry Psychology and social concepts Introduction to orthodontics Basic preventive and therapeutic oral care Restorative and prosthetic materials and therapy Dental radiography Computer skills Public dental health services Presentation and communication skills Clinical practice Applied psychology Health promotion & project work Smoking cessation counselling Professional responsibilities Microbiology and cross–infection control Dental pathology and disease Physiology and medical emergencies Pharmacology Introduction module
Course overview Course Course content
Module 3: Clinical practice and health promotion (15 ECTS) Module 5: Evidence based practice (10 ECTS) n n n n n n n n (25 ECTS) Module 2: Introduction to clinical practice n n n n n n n Second year modules Module 4: Health promotion practice (15 ECTS) n n n n This two-year course is based in the Dublin Dental University the Dublin Dental University course is based in This two-year and academic, project-based College. It has Trinity Hospital at Dental out in the Dublin which are carried clinical components Services Executive and general University Hospital, Health is on small-group interactive hospital settings. Emphasis projects, evidence-based learning, learning, health promotion be integrated with undergraduate will You and clinical practice. and dental nursing students for some dental science students elements of the programme. modular design and some modules are The curriculum has a prerequisites for others. First year modules science Module 1: Introduction to applied clinical n n n n (20 ECTS) TR802 8 420 Diploma Garda Vetting: vetting. See Students will be required to undergo Garda page 26 for further details. Entry Requirements: Leaving Certificate and in four other subjects, pass in English, mathematics A biology, one of which must be physics, chemistry, agricultural science or physics/chemistry. of a standard Of the six subjects presented two must be of at least grade C3 on higher Leaving Certificate The remaining four subjects must be presented papers. Leaving to a standard of at least grade D3 on ordinary Certificate papers. of admission to this course are made subject to All offers infectious disease testing. page 198. See Precautions against infectious diseases COURSE CODES: COURSE PLACES 2012: POINTS 2011: AWARDED: DEGREE entry course. Applications must be This is a restricted 2013. submitted by 1 February a questionnaire in March to be Applicants will receive completed and returned. Dental hygiene (diploma) hygiene Dental Is this the right course for you? What is a Dental hygienist? If you have an interest in working in oral health, and particularly You preventative oral health, then this course is right for you. will need to be able to develop good patient care skills, so an empathic personality and good communication skills are player and show initiative good team be a need to You important. to achieve the best for people in your care. The dental hygienist provides preventative oral care to both The dental hygienist provides preventative needs in children and adults including those with special This clinical setting. collaboration with a registered dentist in a (gum) includes treatments to prevent or control periodontal and counselling in relation to advice disease and dental decay, The dental hygienist lifestyle habits such as diet and smoking. also provides oral health education to both individuals and groups of people and can be involved in the planning, delivery The and evaluation of oral health promotional programmes. dental hygienist works within the dental team and with other groups of health care workers to provide a holistic approach to patient care. 172 Health Sciences in Ireland. This registrationismandatoryforworkingasadentalhygienist as adentalhygienistontheRegisterofIrishDentalCouncil. Dublin entitlesgraduatestoregisterimmediatelyaftergraduation The DiplomainDentalhygieneconferredby Trinity College care andafinalwrittenclinicalexamination. clinical creditsdemonstratingofareasonablelevelpatient in variousclinicalprocedures,completionoflogbooks, community-based healtheducationproject,competencetests Assessment isbywrittenexaminationsduringthetwoyears,a n n n n n n n n n n n n n Module 6:ClinicalpracticeII(30ECTS) Tel: +35316127369 E-mail: [email protected] MSc. Contact: LecturerinDentalhygiene: CatherineWaldron RDH, www.dentalhospital.i sector. in hospitalsandinstitutionalsettingswithinthecommercial or specialistdentalpractices,intheHealthServicesExecutive, employed oremployed. You mayfindemploymentingeneral As adentalhygienist,youhavetheoptionofbeingself After qualifyingasadentalhygienistyouwillbeableto: Further information Career opportunities practice Your degreeandprofessional Assessment temporarily re-cementcrowns Place temporarydressingsand anaestheticfordentalhygieneprocedures Administer local Take dentalradiographs mouthandinformthedentist inthe Recognise abnormalities agents totheteeth anddesensitising preparations Apply fluoride-containing Place fissuresealants theteeth Debride andpolish oral healthandhygiene Carry outprocedurestomeasureandassessthelevelsof groups andindividuals oral educationalactivitiesfor Plan, implementandevaluate primary healthcare a dentalteaminoralhealthpromotionandtheprovisionof Describe theroleofdentalhygienistandfunctionwithin oflocalanaesthesia Administration – portfolioofexperience Radiography inavarietyofsettings experience Clinical e (SelecttheEducationlink) e
involved withtheadministrationofdentalsurgery. provision ofdentaltreatment. The dental nursemayalsobe to workcloselyprovidingsupportandassistanceduringthe ability touseinitiative,goodmanualdexterityandbeprepared include thefollowing:communicationandorganisationskills, Skills requiredofstudentsconsideringdentalnursingshould care. preparation andmaintenanceofthedentalsurgery, andpatient Main dutiesincludeinfectioncontrol,chair-sideassistance, in thedeliveryofdentaltreatment. an auxiliaryprofession,supportingmembersofthedentalteam Dental nursesarevaluablemembersofthedentalteam. This is Voluntary RegisterofDentalNurses. and acquirethequalificationsforentrytoDentalCouncil You learnabouttheday-to-dayrunningofadental practice and practicalcompetenceneededtoworkinadentalsurgery. and dentalhealtheducation. This coursegivesyoutheskills The moderndentalnursetrainsinallaspectsofclinicalpractice emergencies andpatientcare. prevention, chair-sideassistance,managementofmedical care. The maindutiesofadentalnurseinclude:infectioncontrol all aspectsofpatienttreatmentandplaysavitalrolein and managementofthedentalpractice,assistsdentistin The dentalnurseplaysanimportantroleintheorganisation What isaDentalnurse? DEGREE AWARDED: POINTS 2011: PLACES 2012: COURSE CODES: Dental nursing(diploma) page 26forfurtherdetails. Students willberequiredtoundergoGardavetting.See Garda Vetting: Certificate papers to astandardofatleastgradeD3onordinaryLeaving papers. The remainingfoursubjectsmustbepresented of atleastgradeC3onordinaryLeavingCertificate Of thesixsubjectspresented,twomustbeofastandard agricultural scienceorphysics/chemistry. one ofwhichmustbephysics,chemistry, biology, A passinEnglish,mathematicsandfourothersubjects, Leaving Certificate Entry Requirements: Diploma 330 25 TR801 Health Sciences 173 e e (from the main menu select: Education, Career opportunities Further information As a graduate of Dental nursing, you will be able to find work in a variety of working environments including dental hospitals and Health Service Executive dental clinics, as well as in general and specialist dental practices. Depending on the work setting, advancement in the field may include: senior dental nurse, clinic marketing representatives for practice manager, nurse manager, relevant companies, and oral health promotion. Successful completion of this programme will permit entry onto Register of Dental Nurses, Ireland. the Dental Council Voluntary Tutor Please contact the Dental Nurse +353 1 6127238 Tel: E-mail: [email protected] www.dentalhospital.i Undergraduate programmes)
Clinical dentistry II, practice management and health psychology (10 ECTS) Clinical placements II (45 ECTS) Case study (5 ECTS) Anatomy, public oral health and social concepts in dentistry Anatomy, (10 ECTS) Clinical dentistry II and computer skills (5 ECTS) Clinical placements I (25 ECTS) Microbiology and pathology (10 ECTS) Physiology and medical emergencies; I clinical dentistry (10 ECTS) Assessment Course content Course overview Is this the right course for you? the right course Is this Year 2 is assessed by written examinations, a multi-station Year practical examination, a portfolio of clinical experience, case study written report and an oral presentation. Year 1 is assessed by written examinations, practical Year examinations, continuous clinical assessment and an oral presentation. n n n Second year modules n n n n First year modules n The programme consists of lectures, tutorials, demonstrations The programme consists of lectures, tutorials, will be assessed on a continuous You and practical experience. of theory to practice. basis regarding suitability and application appropriate By the end of the course, you will have developed will be integrated You skills in patient and team management. hygiene and dental with undergraduate dental science, dental the course to ensure technology students for some elements of teamwork throughout the dental profession. effective In second year, you will spend time on external placements in In second year, in general dental a health-service executive dental clinic and practices throughout the Dublin area. This two-year course is divided into practical and academic This two-year course Both the formal academic teaching and (modular) components. experience are gained at the Dublin Dental your practical clinical College. Trinity University Hospital at You will need to be able to develop good patient skills and be develop good patient need to be able to will You a caring and while having effectively, able to communicate is an advantage. understanding personality Yes, if you have an interest in working as part of a dental team in in working as part if you have an interest Yes, of oral healthcare. the delivery 174 Health Sciences attention todetailwithsmallmargins forerror. The courseislong physically andmentallydemanding asitrequiresconsiderable You shouldalso enjoyundertakingclinicalpracticethatis relationship withpatients,co-workers andthewidercommunity. you alsohaveanabilitytobuild acaringandprofessional individuals. The natureofdentistry makesitessentialthat like tospecificallyfocusonoralhealthcareanditsimpact Yes, ifhealthcareingeneralinterestsyouandwould the removalofteeth. replacement ofmissingteethandsurgicalproceduressuchas restoration ofdamagedteeth,thecorrectionirregularities, and dentaldiseases. Treatment involvesareassuchasthe care, includingprevention,diagnosisandtreatmentoforal can safelyandeffectively deliverthefullrangeofprimarydental This five-yearprogrammeisdesignedtoensurethatgraduates Course overview Is thistherightcourseforyou? DEGREE AWARDED: POINTS 2011: PLACES 2012: COURSE CODES: Dental science diseases page198. infectious diseasetesting.Seeprecautionsagainst All offers ofadmissiontothiscoursearemadesubject Agricultural sciencewithbiology Physics/chemistry withphysicsorchemistry Combinations ofsubjectsnotpermitted: Special EntryRequirements: Advanced GCE(A-Level) Leaving Certificate page 26forfurtherdetails. Students willberequiredtoundergoGardavetting.See Garda Vetting:
HB3 +HC3 Grade B+C B.Dent.Sc. 570* 32 TR052 B orbetter mathematics atgrade present GCSE physics youmust a qualificationin chemistry orbiology at OC3/HD3orbetter present mathematics physics youmust a qualificationin agricultural science. physics/chemistry or chemistry, biology, If youdonothave In twoof:physics, If youdonothave In twoof:physics, learning whichisarequirementforallhealthcareprofessionals. aims toprovidegraduateswiththeskillsnecessaryforlife-long encourages studentstoengageinself-directedlearningand achieve thelearningobjectives.Problem-basedalso supervision) toundertakeresearchfindoutabouthow learning objectivesandstudentsorganisethemselves(under will beapplied.Structuredproblemsaresettomeetspecified relevant tothefutureclinicalsituationsinwhichknowledge physiology inanintegratedmannerandacontextthatis students tolearnsubjectssuchaschemistry, biochemistryand Problem-based learning(PBL)isdesignedtoencourage progress throughouttheprogramme. ensuring thatstudentsreceiveconsiderablestaff inputintotheir through yourprofessionalcareer. The classsizesaresmall evaluate andupdateyourknowledgeclinicalpractice format, whichaimstoprovideyouwiththeskillscontinuously The curriculumisdeliveredinaproblem-basedlearning(PBL) standard withemphasisontheuseofinformationtechnology. at Trinity College. The clinicalfacilitiesareofaveryhigh This courseisbasedintheDublinDentalUniversityHospital than forstudentsofothercourses. (five years)andintenseastheacademicyearismuchlonger n n n n n n n areas (approximately30hoursperweek): During thefirstdentalyearyouwillcoverfollowingsubject The firstdentalyear qualified dentalstaff fromthesecondyearonwards. You willprovidepatientcareunderthestrictsupervision of provided asappropriate. simulations, audiovisualande-learningopportunitiesarealso will develop in laboratories and clinics. Lectures, demonstrations, with thedevelopmentofpracticalandclinicalskillsthatyou problems presentedandfacilitatedbystaff. These topicstiein (PBL) thatconsistofstudent-leddiscussionsontopicsand The courseisdeliveredmainlythroughsmall-grouptutorials Problem-based learning(PBL) Why studyatTrinity College? Course content Ethics andlaw Behavioural science (ECDL) Computer applications Introduction todentistry learning Physics project-based Anatomy workshopsandlectures PBL tutorials(6hours/week) Health Sciences 175
e e (from the main menu select: Education, Your degree and professional degree and Your practice (B.A., B.Dent.Sc) Further information Assessment Study abroad Career opportunities such as the USA or Canada may be required to undergo or Canada may be required such as the USA additional training and pass specified examinations. by Trinity College Dublin entitles EU citizens to register immediately conferred The degree Bachelor of Dental Science (B.Dent.Sc) immediately register to citizens EU entitles Dublin College Trinity by of the Dental after graduation as a dentist on the Register with the regulatory Council of Ireland and they may also register Union (such as the bodies of other countries in the European etc.). UK, France, Germany, Graduates who wish to practice in countries outside the EU www.dentalhospital.i Undergraduate programmes) +353 1 896 2043 / 1690 Tel: E-mail: [email protected] In keeping with the PBL-style curriculum, a wide variety of a wide variety with the PBL-style curriculum, In keeping There are end-of- in all years. methods are used assessment skills tests practical tests, written assessments, term integrated examinations, written reports and oral/ of competence, clinical short The written assessments include verbal presentations. short answer and multiple choice type questions. essay, year can participate in an Erasmus Students in the fourth Sweden, with dental schools in Norway, exchange programme fifth dental years, some students Between the fourth and in a wide variety of international undertake voluntary placements countries. locations such as developing many also enter While most graduates enter general practice, smaller A countries. vocational training schemes in a variety of and hospitals number of openings exist in dental schools These positions can lead for house officers or registrars. include on to training in specialist areas. Other possibilities career. postgraduate research or a university teaching Prosthodontics which involves of artificial the various type replacements for missing teeth Experimental design, data collection and analysis Public dental health with an emphasis on disease prevention care of special needs as well as on the and epidemiology, patients dental health which includes orthodontics (braces) Children’s and dental care specific to children Restorative dentistry which involves fillings and crowns; periodontology which includes treatment for gum disease Human diseases, including both medical and surgical aspects The principles of experimental design, data collection and analysis the biological and medical sciences Relevant elements of of a practising dentist appropriate to the needs Health and safety Normal function at cell and system levels and the integration levels and the integration at cell and system Normal function of body systems their relationshipBacteria, viruses and to the human immune system Clinical of systemic and oral disease signs and symptoms Basic clinical for the treatment of patients skills necessary Clinical training begins in the second year with students learning Clinical training begins in the second year and diagnosis. the vital basic skills of history taking, examination will start providing Approximately half way through the year you very simple treatments for patients. In addition you will develop communication skills with particular In addition you will develop communication and explain the reference to patient care, learn how to interpret oral disease with clinical signs and symptoms of systemic and begin to practice the particular reference to dental practice and patients. Courses in clinical skills necessary for the treatment of relevant knowledge the second year are complementedby of the appropriate to elements of the biological and medical sciences the needs of a practising dentist. n n n n n n Topics you will study in years three, four and five include: you will study in years three, four and Topics Years three, four and five three, four and Years be encouraged During the later years of the course you will oral health and to take an approach to the management of scientific evidence. disease which is based on the best available aware of related In tandem with this, you will also need to be communities. In general healthcare issues for individuals and these three years you will provide more complex patient care. n n n n n n n The second dental year The second that you year are to ensure of the second dental The objectives understanding of: develop an 176 Health Sciences good manualdexterityskills,youmaybesuitedtothiscourse. an interestinoralhealth,arecreativelymindedandpossess team fabricatingprostheticdentaldevices. Therefore, ifyouhave As a dental technologist,youwillbeworkingaspartof the dental ensure effective teamworkthroughoutthedentalprofession. Dental sciencestudentsforsomeelementsofthecourseto dental appliances. You willbeintegratedwithundergraduate alloys, makeporcelainrestorationsandcreatehigh-quality relevant materialscienceandlearnhowtoaccuratelycast dental of dentaltechnology. You willgetagoodbackgroundinthe understanding andtechnicalskillsinallofthebasicdisciplines This three-yearcourseisdesignedtogiveyouahighlevelof your technicalskills. laboratory, bothtolearnlaboratory managementandtodevelop and technology. Inthethirdyear, you willbebasedinadental basic sciences,andinallaspectsoflaboratorytechniques College, thiscourseincludeslecturesandpracticalsinthe Based intheDublinDentalUniversityHospitalat Trinity Course content Is thistherightcourseforyou? Course overview completed andreturned. Applicants willreceiveaquestionnaireinMarchtobe submitted by1February2013. This isarestrictedentrycourse.Applicationsmustbe DEGREE AWARDED: POINTS 2011: PLACES 2012: COURSE CODES: Dental technology (ordinary degree) Certificate papers. to astandardofatleastgradeD3onordinaryLeaving papers. The remainingfoursubjectsmustbepresented of atleastgradeC3onordinaryLeavingCertificate Of thesixsubjectspresentedtwomustbeofastandard agricultural scienceorphysics/chemistry. one ofwhichmustbephysics,chemistry, biology, A passinEnglish,mathematicsandfourothersubjects, Leaving Certificate Entry Requirements: B.Dent.Tech 400 6 TR803
n n n n Third year n n n n n n Second year n n n n First year Tel: +35316127256 E-mail: [email protected] Undergraduate programmes) www.dentalhospital.i equipment companyortomoveintoforensicwork. assist youinbecomingarepresentativefordentalmaterials/ studies –dentalmaterialsscienceorresearch.Itwouldalso laboratory owner;teachdentaltechnology;partakeinfurther technologist workinginadentallaboratory, becomeadental This courseallowsyoutopursueacareerasdental examined byexternalandinternalexaminers. undertake aliteraturereviewanddissertationwhichwillbe and recordthisexperienceinalogdiary. Inadditionyouwill In yearthreeyouwillundertakeproductionworkforpatients and two. combined withend-of-yearwrittenexaminationsinyearsone Continuous assessmentinthepracticalaspectsofyourworkis Further information Career opportunities Assessment Dissertation (15ECTS) Orthodontic technology(15ECTS) Fixed prosthodontics(20ECTS) (15 ECTS). denturetechnology removablepartial Complete and Business studies(5ECTS) (5ECTS) Materials science Orthodontics (10ECTS) Fixed prosthodontics(20ECTS) ECTS) dentures(10 Removable partial ECTS) technology(10 Complete denture Physics andchemistry(10ECTS) Orthodontics (10ECTS) Complete andremovablepartialdenturetechnology(20ECTS) andfunction(20ECTS) Fixed prosthodonticsandocclusion e (fromthemainmenuselect:Education,
e
Health Sciences 177 Project topics are varied Project topics are varied A major component of the fourth major component of the fourth A The School of Medicine in Trinity College is a member member a is College Trinity in Medicine of School The medical European leading of consortium a EuroLife, of in training and research enhance to aims that schools in developments underpin that sciences medical the human healthcare. is programme degree disease & health Human The programme Bachelor’s Biomedicine the with linked at the prestigious Karolinska Insititutet in Stockholm Sweden. Through a formal ERASMUS exchange agreement, Human health & disease students can, to opportunity the of avail basis, competitive a on in Stockholm in project year final their complete leading laboratories. one of the institute’s Did you know? n n Further information Career opportunities Assessment www.medicine.tcd.ie/physiology/undergraduate/human_ health_disease The course emphasises the crucial links between the basic and applied biomedical sciences and addresses how advances in both are translated into improvements in patient care and the health of the wider population. Graduates are therefore ideally qualified to participate in health-related research or health Graduates are also promotion within academia or industry. programmes. degree medical graduate to entry for trained ideally for entry into a broad B.Sc. is also an appropriate qualification A range of other careers (e.g. teaching and management). The Sophister (third and fourth) years (third The Sophister which of modules and fourth years, a combination In the third and diagnosis, prevention classification, cover the nature, from the Disease is considered disease are taken. treatment of in terms of its context in society level through to basic molecular priorities and correlates. Delivery of research and public health by specialist clinicians is included. clinically focused material you will undertake advanced modules As a fourth-year student, of disease and cutting-edge advances on the molecular basis in biomedical science. laboratory-based project in year will be a comprehensive supervised by leading researchers biomedical research its affiliated teaching hospitals in College and in Trinity Institutet. Dublin or The Karolinska investigation of brain disorders; and include; cancer biology, gastrointestinal tissue engineering; exercise and rehabilitation; and public health disorders, autoimmune disease, epidemiology research to name but a few. of laboratory Individual and group based continuous assessment skills and portfolio work, group project work, scientific writing generation accompanies end-of-year examinations. In one of physics, In one of physics, Biology Biology chemistry, physics/ chemistry, chemistry chemistry TR056 35 520* B.Sc. HC3 Grade C HC3 Grade C
Advanced GCE (A-Level) Leaving Certificate Special Entry Requirements: COURSE CODES: COURSE PLACES 2012: POINTS 2011: AWARDED: DEGREE Human health and disease health and Human Course overview Is this the right course for you? Is this the right course for What is Human health and disease? What is Human health and You will study the structure and function of the human body You perspective through lectures, tutorials from a ‘molecule to man’ physiology biochemistry, and laboratory classes in cell biology, and anatomy (including dissection). Modules based on critical thinking, problem-based learning, presentation skills and research and statistics will further contribute to the development of a core skill set, as outlined above. The Freshman (first two) years The degree is structured around three main interconnecting Applied biomedical themes namely; 1) Basic human biology 2) TCD graduate attributes. skills and Transferable science and 3) The programme will suit you if you want to obtain a degree that provides comprehensive instruction in all aspects of basic human biology and applied biomedical science. A central feature of the learning experience is the development A in the following areas; of a core set of real-life, transferable skills data analysis, public laboratory technique, group project work, and critical presentation, report writing, research methodology thinking. The Human health and disease degree brings to life the The Human health and disease degree brings and function in the fascinating connections between structure and disease continuum It explores the health human body. therapies act to in depth, including teaching on how medical understanding treat or even prevent disease. For example, to appreciate how brain structure and biochemistry allows us helping biomedical neurones communicate and this in turn is ways to and effective researchers and clinicians to identify new Alzheimer’s Disease. treat and prevent diseases such as 178 Health Sciences the managementofdisease. disciplines topromotehealth,preventdiseaseandcontribute Dietitians applytheirknowledgeoffood,nutritionandrelated Dietetics isoneofthehealthandsocialcareprofessions. dietetics, medicine,communicationsandpublichealth. disciplines includingbiochemistry, physiology, cellbiology, It spansabroad-rangingarea,overlappingwithmanyother Nutrition isabranchofsciencedevotedtothestudynutrients. by DIT and TCD. (honors) degree in Human nutrition and dietetics is awarded jointly and communitylevel.Onsuccessfulcompletion,theB.Sc. their application to human health and wellbeing, at both individual education in the science of nutrition and practice of dietetics and institutions. The courseisdesignedtoprovideanintegrated of Technology (DIT) and TCD. Students are registered in both This four-yearfull-timecourseisrunjointlybytheDublinInstitute Course overview placement-based studiescanproceed. Students arerequiredtoundergoGardavettingbefore requirements contacttheDIT. Institute of Technology (DIT).Forfulldetailsofadmission This isajointcoursebetween TCD andtheDublin Special EntryRequirements: DEGREE AWARDED: POINTS 2011: PLACES 2012: COURSE CODES: Human nutrition and dietetics Website: www.dit.ie/study/internationaloffice/howtoappl Dublin 6 143-149 LowerRathminesRoad Dublin Instituteof Technology The InternationalStudentOffice directed to: Applications frominternationalnon-EUstudentsshouldbe Website: www.dit.ie/stud E-mail: [email protected] Fax: +35314023399 Tel: +35314023445 Dublin 6 143-149 LowerRathminesRoad Dublin Instituteof Technology The Admissions Office applications areconsidered.Furtherdetailsavailablefrom: In addition to standard CAO applications, mature entryApplication Procedure y e B.Sc. (Hum.Nut.&Diet.) 535 25 DT223
y subjects. You willstudy: will developabroadunderstandingoftherelevantpre-clinical During theJuniorandSeniorFreshman(firsttwo)yearsyou The Freshmanyears and capabilityinresearchdevelopment. others inanethicalandadaptablemanner, andtofosterinterest of theoryintopractice,theabilitytoworkandcommunicatewith the developmentofanalyticalandcriticalthinking,integration of scientificknowledgerelevanttohumannutritionanddietetics, The modulesinthiscoursearedesignedtoenabletheacquisition nutritionist intheindustrialsector. level asadietitian,publichealthnutritionistortowork Graduates fromthiscourseareequippedtopracticeatentry demands onyourtime. are importantattributes. The coursewillplaceconsiderable Good interpersonalskillsandanabilitytoworkwithothers particular interestintherelationshipbetweenfoodandhealth. You willneedastronginterestinsciencesubjectsand conducted insome subjects. make uptheassessment process.Oralexaminations are assessment ofcoursework,practical workandassignments End-of-year writtenexaminations, togetherwithcontinuous community settingsinIreland. Practical placementsarearrangedinavarietyofhospitaland will befollowedbyaperiodofcollege-basedconsolidation. one attheendofeachfirstthreeyears.Eachplacement programme. These placements aredividedintothreeblocks, Practice placementsareacompulsoryelementofthe Professional placements European or American university. final year, withtheoptiontocarrythisoutinapartner You willundertakeathree-monthresearchprojectinthe subjects studiedtoanadvancedlevel(nutrition,dietetics). medicine andtherapeutics,medicalscience)thedegree specialist subjectsareintroduced(management,epidemiology, foundation subjectsarestrengthened(researchmethods), In theJuniorandSeniorSophister(thirdfourth)years, The Sophisteryears n n n n n n n Course content Is thistherightcourseforyou? Assessment Professional practice studies Professional practice Research methodologyandstatistics science behavioural Communications, Food studies,nutritionscience,throughthelifecycle Microbiology/immunology Cell biology, physiology, biochemistry Physics, chemistry, clinicalchemistry Health Sciences 179
If you do not have have not do you If In two of physics, If you do not have a qualification qualification a you physics in present must at mathematics OC3/HD3 or better chemistry or biology a qualification in physics you must present GCSE mathematics at grade B or better chemistry, biology, biology, chemistry, physics/chemistry agricultural or science In two of physics, physics, of two In www.hpat- e not www.cao.i
TR051 123 739* M.B. (Bachelor in Medicine), B.Ch. (Bachelor in Surgery) and B.A.O. (Bachelor in Obstetrics).
Grade B + Grade C HB3 + HC3 + HB3
COURSE CODE: COURSE PLACES 2012: POINTS 2011: AWARDED: DEGREES entry course. This is a restricted be made online via Applications MUST 2013. later than 1 February register for the HPAT-Ireland Applicants must also admission test by 20 January 2013 (via u). ireland.acer.edu.a for Students must achieve all grades required in matriculation requirements and course requirements ONE SITTING of their Leaving Certificate/Matriculation/ note 3B (page Advanced GCE (A-level) examinations. See 31) for further details. Special Entry Requirements: Leaving Certificate Advanced GCE (A-Level) Combinations of subjects not permitted: Physics/chemistry with physics or chemistry Agricultural science with biology See page 198 for vaccination requirements with regard to Hepatitis B, Hepatitis C and Tuberculosis. to Hepatitis B, Hepatitis C and Garda Vetting: Students will be required to undergo Garda vetting. See page 26 for further details. Medicine e) s g) www.nutritionsociety.or This course is the only one leading to a professional professional a to leading one only the is course This The Ireland. of Republic the in dietetics in qualification & Dieteticdegree is recognised by the Irish Nutrition (BDA), Association Dietetic British the (INDI), Institute the and (ADA), Association Dietetic American the Nutrition Society. The Irish Nutrition and Dietetic Institute (www.indi.i The Nutrition Society ( “I was always attracted to the study of nutrition because “I was always attracted to the study of nutrition I was fascinated by the possibility of enhancing health though implementing dietary changes. When I read the I and DIT Trinity by curriculum of the course offered the perfect combination of science thought that it offered This is one of the few and practical skills I was looking for. courses where you can study nutrition and dietetics at the same time, so when you graduate you have the practical skills backed up by scientific evidence. Being a mature I felt a bit nervous about leaving student with a family, my job to embark on a full-time undergraduate course. I do not regret anything as I have always found However, last year professional lecturers ready to help. Moreover, which gave me the peace of scholar, Trinity I became a mind of having my fees covered now and the possibility of College is Trinity funding for future postgraduate studies. internationally recognised for its cutting-edge research in many areas and the possibilities after graduating from the course are endless: they range from becoming a clinical dietitian to becoming a researcher in the area or being an Nutrition entrepreneur and setting up your own company. is a relatively young science that has still a lot to be discovered and I am looking forward to making my small contribution to that.” Patricia Dominguez Castro Student Profile Did you know? n Further information Career opportunities Additional information can also be obtained from: Additional information can also be obtained n n www.medicine.tcd.ie/nutrition-dietetic When you graduate, you will be well placed to find work as a When you graduate, in a hospital or in the community. dietitian or clinical nutritionist for example, a food will also be qualified to work in, You nutrition product sales and marketing. company or in clinical have also chosen academic careers in Some of our graduates research or education. Continuous assessments are carried out during your out during your assessments are carried Continuous write a thesis to report will also You placements. professional present and project, and of your final-year research the results defend it orally. 180 Health Sciences St Vincent’s Hospital(Fairview). St EdmundsburyHospital,St.Patrick’s UniversityHospital, Peamount Hospital,RoyalVictoria EyeandEarHospital, Hospice andCareServices(HaroldsCrossBlackrock), Hospital, OurLady’s Children’s Hospital(Crumlin),OurLady’s Maternity Hospital(HollesStreet),NationalRehabilitation Hermitage MedicalClinic,NaasGeneralHospital,National Street), CoombeWomen andInfantsUniversityHospital, Cherry OrchardHospital,Children’s UniversityHospital(Temple Bloomfield CareCentre,CentralMentalHospital(Dundrum), affiliated hospitalsinclude: level hospitals. They haveseveralspecialistunits.Specialist James’s Hospitaland Tallaght Hospital,areup-to-datetertiary Trinity College’s twomaingeneralteachinghospitals,St. n n n n n n n n The majorcharacteristicsofmedicineat Trinity Collegeare: becoming afullyregisteredmedicalpractitioner. resident houseofficer(intern)inanapprovedhospital(s)before graduation youarerequiredtospendoneyearserviceasa Bachelor inSurgeryandObstetrics.Following programme leadingtothedegreesofBachelorinMedicine, Students ofmedicineat Trinity Collegewillfollowafive-year education. Today itisaninternationalleaderinbiomedicalresearchand and hasplayedacentralroleinthegoldenageofIrishmedicine. The SchoolofMedicineat Trinity Collegewasfoundedin1711 contribution. where teamworkwillbeequally asvaluableyourindividual need tofeelcomfortableinapeople-oriented environment medicine isultimatelyaboutthe careofpeople,youwillalso high andtherewillbeconsiderable demandsonyourtime. As highly rewardingexperience. The academic requirementsare The medicalprogrammeat Trinity Collegeisachallengingbut Is thistherightcourseforyou? Teaching hospitals at Trinity College? Why studyMedicine Prioritisation of personal and professional development personalandprofessional Prioritisation of thepatientasanactivepartner Recognition of continuous assessment formatsincluding Promotion ofmultipleassessment and coursecontent programme toensurealignmentwiththestatedoutcomes oftheassessment andrevision Continuous review rotations ofclinical Defined programme interpersonal skills oftechnicaland Early andcomprehensivedevelopment adeepstrategicapproach Facilitation ofactivelearningand context materialanddeliveryin Integration ofscientificandclinical
n n n n n n Aims: Module 1:Humanformandfunction The courseisdeliveredasasetoffourmodules. The firstmedicalyear n n n n n n n n n n Aims: and ethics science behavioural development, Human 2: Module Teaching methodsandtopics: Teaching methods: Course content integrated moduleincludebiology, anatomyandphysiology will besetinahumancontext.Disciplinescontributingtothis appropriate. All topicswillbemultidisciplinaryandscenarios relatedlecturesas tutorialswith Small-group learning studied throughhumandissectionandlectures Anatomy –structureofthelimbs,thorax andabdomen, techniques andtheiruseinthediagnosisofdisease To introducestudentstocurrentdiagnosticimaging surgical implications function withparticularemphasisonthebiomechanicaland To howstructurerelatesto understandingof developan systems andwholebodylevels and functionatcell,organ, development Human physical macroscopic structureofthehumanbody To tounderstandthethree-dimensional enablestudents constructive criticismandtoself-assess realistically the ability togiveandreceive Aspects ofteamworkandalso thinking development ofinformation-handling skillsandcritical The skillsthatcontributetoactivelearningandthe care thatmayariseinthesafedeliveryofhealth Ethical issues facilitate learning usingclinicalscenariosto tutorials Small-group psychology general humandevelopment withthephysicalandpsychologicalaspectsof Lectures deal the babyanditsassimilationintofamily baby andobservethephysicalmentaldevelopmentof physician, makeanumberofvisitstofamilywithyoung guidedbyafamily Family casestudywherestudents, health carethroughthefamilycasestudy To providestudentswiththeirfirstprofessionalexperienceof of normalhumanfunctionandbehaviour To withathoroughandintegratedknowledge equipstudents society andenvironment the functioningandrelationshipsofindividualsinrelationto To tounderstandtheevolutionofmanand enablestudents in physicalandpsychologicalhumandevelopment To ofconceptsnormality givestudentsanunderstanding Health Sciences 181
To ensure that students have a broad knowledge of the To treatment of a wide range of common diseases and effectively ensure that students can prescribe safely To in hospital and for the wider community develop an appreciation of how to critically appraise To information in relation to drug therapy and assess the evidence base contained in peer-reviewed journals To develop, at first in a laboratory setting, the technical To service to skills essential for the delivery of a safe, effective skills including patients. Students learn a range of practical an examination and performing taking a clinical history, interpreting simple investigations focus directly on the range of to ensure skills necessary To interactions with that students have rational and empathetic patients, in particular excellent listening and communication skills a member of assist the development of the student as To a multidisciplinary health care team To consider all the nervous system, from aspects of To health and disease in biophysics to behaviour, studied through dissection Anatomy – neuroanatomy, lectures of the human brain and revise and develop further an understanding of the To 21st century nature and significance of microbes in the explore aspects of infection of prevention and control To a result of and the challenges which are presented as globalisation consider human-host responses to pathogens To All disciplines use lectures, laboratory practicals and small-group tutorials Modes of delivery include communication workshops with role and workshops play and video recording, skills laboratory, Attendance at etc. on suturing, catheterisation, phlebotomy, gerontology day care centres, diagnostic imaging and cardiology organised. pulmonary function laboratories are departments, and This module consists of lectures, practicals and interactive This module consists workshops. Aims: n n n Module 7: Fundamentals of clinical and professional practice Aims: n n n The third medical year There are six modules. Module 1: Pharmacology and therapeutics Module 5: Neuroscience Module 5: and pharmacology biochemistry, of anatomy, The disciplines in this all participate physiology and psychiatry therapeutics, module. Aims: n n of disease Aetiology and mechanisms Module 6: Aims: n n n n
To consider the range of drugs and treatment strategies To available for disease prevention and control The anatomy of the head and neck in this module is included and is delivered by lectures and through human dissection To develop a knowledge and understanding of the To pharmacological basis of therapeutics To build on the understanding of basic biochemistry acquired To in the first year of the course and to consider how that knowledge may be used for diagnosis of disease states To provide an the insight into the mechanisms of To molecular level development of pathological processes at drawn from the Humanities, Arts and Social sciences drawn from the Humanities, To consider medicine, health and theories illness from To gain insight into the human condition To Most learning will take place in small-group tutorials. There will also be core lectures The principles of biochemistry, genetics, and immunology genetics, and The principles of biochemistry, at a basic level Small-group learning with tutorials related lectures as be multidisciplinary and scenarios All topics will appropriate. context. Disciplines contributing to will be set in a human anatomy, biology, include chemistry, this integrated module biochemistry and immunology physiology, The areas of basic science that impact on man and his impact on man and of basic science that The areas the environment survival in This module is largely lecture-based and also uses computer- This module is largely lecture-based and based practical programmes. Teaching methods: Teaching Teaching methods: Teaching n Module 4: Head and neck anatomy Aims: n Aims: n Module 3: Principles of pharmacology and practical scientific research Aims: n Module 2: Clinical biochemistry n Module 1: Molecular and translational medicine Module 1: Molecular and translational Aims: The second medical year In this year there are seven modules. n n Aims: n Module 4: Science and the humanities Module 4: Science n n n Module 3: Evolution and life Module 3: explore: assist students to Aims are to 182 Health Sciences n n Aims: practice Module 5: Advanced clinicalandprofessional n n n n n n Aims: 4: Principlesofmedicalpractice Module and practice surgical of Principles 3: Module n n Aims: Module 2:Laboratoryandinvestigativemedicine n n n n n Aims: medicine andelectivepractice1 evidence-based of practice and Principles 6: Module n structured andmeaningfulway To learntopresenttheirmaterial verballytotheirpeersina factual reportoftheirfindings To todeliver asuccinctand learntocollateinformationand To learntoprioritiseaspectsoftheir findings Toto publishedmaterial critical approach developa scientific literatureandobtainingappropriatematerial To insearchingthe ensurethatstudentsgainexperience member ofamultidisciplinaryhealthcareteam To ofthestudentasa furtherassistthedevelopment skills patients, inparticularexcellentlisteningandcommunication students haverationalandempatheticinteractionswith To toensurethat practicetherangeofskillsnecessary and interpretingsimpleinvestigations including takingaclinicalhistory, performinganexamination service topatients.Studentslearnarangeofpracticalskills technical skillsessentialforthedeliveryofasafeeffective To atfirstinasetting,the furtherdevelop, laboratory worldwide in anydisciplineorareaoftheirchoicelocation one electiveineitherJulyor August whichmaybespent in groupsoftwo.Studentsarealsoadvisedtodoatleast in thefirstweekofSeptember. Studentsareteamattached withageneralintroduction team attachmentsbegin Clinical professional teamwork To formulti- andprovideopportunities encourage accurately andtoappreciatetheneeddoclinicalaudit To student’s developthe capacitytoreflectandself-assess hospital setting To studentwithexperienceofpracticeinthe providethe evidence-based medicine To facilitatethepracticeofeffective, patientcentred, earlier years to applytheskills,knowledgeandattitudesdevelopedin To environmentinwhich provideasafe,structuredclinical organism levels and consequentlydisruptfunctionatorgan,system To processesaffect detailhowdisease considerin thecell microbes inthecausationofhumanhealthanddisease To oftherole deepentheunderstanding expandand medicine. if youareinterestedinthepossibilityofacareeracademic students theopportunitytogainexperienceinscientificresearch medicine, neuroscienceandbioengineering.Bothcoursesoffer full-time programme. The subjectsundertakenaremolecular gain a1stor2:1inthird-yearmodules. The M.Sc.isaone-year sciences isalsoavailabletomedicalstudentswhosuccessfully department concerned. An intercalatedM.Sc.inBiomedical to theavailabilityofplacesandagreementhead moderatorship inscienceanapprovedsubject. This issubject to takeayearoutfromthemedicalcourseundertake After completingyearthreesuccessfully, youmaybepermitted M.Sc. inBiomedicalsciences Intercalated and Moderatorship Medical n n medicine. around Irelandandinhospitalsdedicatedtoparticularareasof however sometrainingalsotakesplaceinregionalhospitals incorporating theNationalChildren’s Hospitalin Tallaght; Hospital inDublinandthe Adelaide andMeathHospital The majorityofhospitalattachmentstakeplaceinSt.James’s ensure comprehensivecoverofimportantareasforallstudents. range ofspecialstructuredtutorialsincludedinthefinalyearto available onbothofthemajorteachinghospitalsites. There isa general andspecialistareas. There areexcellent libraryfacilities months sothateachstudentisexposedtoawiderangeof The durationofteamattachmentsvaryfromtwoweeksto inevitably involvesomeearlymorningandlateeveningwork. fully inallaspectsofthatteam’s activities. This expectationwill team towhichs/heisattachedandexpectedparticipate undergraduate studentbecomesanintegratedmemberofeach both onthewardsandatvarioushospitalconferences. The interaction withawiderangeofconsultantsandmentors important newknowledgeandmostofthisisachievedthrough years ofthecourse. There is,ofcourse,someacquisition enhancement oftheskillsandattitudesacquiredinfirstthree During thesetwoyearstheemphasisisoncontinuous The fourthandfifthmedicalyears presentation totheclass. literature anddrawupawrittenreport. They alsomakeaverbal the staff projectleader, theyworkingroupsof10toreviewthe select theprojectoftheirchoiceand,followingameetingwith titles bythevariousdepartmentsinmedicalschool.Students In thesegroupprojects,studentsareoffered achoiceofproject they maybemanaged that ariseduringgroupcollaborationandthewaysinwhich To theimportanceofteamworkandproblems understand the currentpracticeofmedicine guidance, atopicthatimpactsscientificallyorclinicallyon To toexploreatsomedepthandwith haveanopportunity
Health Sciences 183
TR914 (Mature) 15 225 In one of biology, In one of biology, In one of biology, Mathematics physics, chemistry, chemistry, physics, physics/chemistry or agricultural science physics or chemistry Mathematics O/HD3 Grade C Grade C O/HD3 TR913 25 445* B.Sc. (A.Obs.)
GCSE Note for mature applicants: by 1 February Applications must be received by the CAO are not required to You of the proposed year of entry. form submit a mature-student supplementary application you will be invited to attend a College. However, Trinity to Centre. written assessment by the Nursing Careers will be Screening (including a medical) and vaccination for organised by the health service provider responsible the practice area where you will be on placement. with regard to See page 198 for vaccination requirements Tuberculosis. Hepatitis B, Hepatits C and Garda Vetting: vetting. See Students will be required to undergo Garda page 26 for further details. Special Entry Requirements: Leaving Certificate Midwifery COURSE CODES: PLACES 2012: POINTS 2011: DEGREE AWARDED: What is a Midwife and midwifery? The term ‘midwife’ means ‘with woman’. The concept of means ‘with woman’. The term ‘midwife’ partnership between the woman and the midwife is fundamental to midwifery practice and is based on mutual trust, support and The midwife uses midwifery skills to provide care collaboration. that is individual to each woman and recognises the woman’s ownership of her birth experience. Care for women experiencing a physiological pregnancy and birth is the core of practice of The midwife is the key professional providing the midwife. continuity of care and promoting choice and control to women in pregnancy and birth, and to women and their babies following birth.
Further information Career opportunities Intern year Assessment Study abroad Study E-mail: [email protected] e www.medicine.tcd.i Medical School Office +353 1 896 1075 Tel: Trinity College Dublin College Trinity As a doctor, you will have plenty of options to choose from when As a doctor, Most people career. it comes to making a decision about your before committing to wait until their year as an intern is complete Some then enter general practice, while one area over another. many more continue their training as a general physician or you might, Alternatively, surgeon, or in a related specialist field. as others have done, prefer to work in an area such as hospital management, or make research your priority by opting for a career in academic medicine. On completion of the medical course a doctor must spend On completion of the medical course a doctor at a hospital or one year as a resident medical officer/intern being eligible for full hospitals recognised for the purpose before The University does registration with the Irish Medical Council. practise in To not assume responsibility for these appointments. with the General Great Britain and Northern Ireland, registration Medical Council in the UK is necessary. The assessment structure is wide and varied and includes The assessment structure is wide and varied skills, as well in-course assessment of practical and clinical written and oral as case studies, research projects, formal examinations. examinations and objective structured clinical From the beginning of the third year students must attend year students must attend of the third From the beginning must undertake In addition, students hospital continuously. after the third and fourth in the summers clinical electives clinic These can be undertaken in a hospital, medical years. of The School at home or abroad. or research laboratory elective links with Columbia University Medicine currently has DC), University of (Washington (NY), Georgetown University and Johns Hopkins University PA) Pennsylvania (Philadelphia at the end of the fourth medical year. (Maryland) for electives the opportunity to undertake a one-year Students may avail of France. Tours, the University of Erasmus exchange at 184 Health Sciences n n n n The programmecontentwillcoversuchareasas: laboratory practicals. of approximately6hoursperdayinlectures,tutorialsand days intheoryclasseseachweekanddaywillconsist tutorials andpracticeclasses. You willtypicallyspend3-4 Teaching methodsincludelectures,small-groupteaching, the Trinity CentreforHealthSciencesinSt.James’s Hospital. Trinity CollegeSchoolofandMidwifery, D’OlierStreetandin The theoreticalcomponentofthecoursewillbetaughtin time inCollege. you areinapositiontofullyengagewiththecourseduringyour both physicallyandemotionallysoyoushouldensurethat places extrademandsonstudents’ time.Itcanbedemanding, Like allprofessionalcoursesinhealthsciences,Midwifery midwifery practicecomponent. midwifery degreeprogramme–atheoreticalcomponentand culturally sensitivemanner. There aretwocomponentstothe meet theneedsofwomenandtheirfamiliesinanindividualised, This programmewillprovideyouwiththeknowledgeandskillsto period ofinternshipinmidwiferypractice. usual academicholidays. The finalyearwillincludea36-week hospitals andwilltakeplaceduringtheacademicyearwith learning inuniversityandmidwiferypracticethematernity and The RotundaHospital. The firstthreeyearscombine linked maternitycareproviders: The CoombeWomen’s Hospital This four-yearprogrammewillbeoffered inpartnershipwithtwo in midwiferypractice. setting. The finalyearwillincludea36-weekperiodofinternship (approximately) supernumerary practiceperweekina week clinicalplacements,which willconsistof30-35hours students willberequiredtocomplete three,fourtosix- mental health,medicalandsurgical.Inthefirstthreeyears will alsoundertakeotherclinicalplacements,forexample, University HospitalortheRotundaHospital.Midwiferystudents maternity careproviders:theCoombeWomen andInfants For thepracticecomponentyouwillbebasedinoneof n n n n Midwifery practicecomponent Theoretical component Course content Maternal and social care services inIreland social careservices Maternal and Health promotion Research Social theoryformidwiferypractice approaches sciences, psychology, pharmacology, non-pharmaceutical formidwiferypracticetoinclude:biological Knowledge base and legalissues Professional, personal,ethical skills andinterpersonal Communication andskills Midwifery practice–knowledge teaching sessions,etc. examinations andassignments,presentations,debates, the programme.Otherformsofassessmentincludewritten component oftheprogrammeandwilltakeplacethroughout Assessment oflearninginmidwiferypracticeisanimportant possible totransferyourfirstchoice. choice. A reserve listisheldandifavacancyarisesitmaybe number ofplacesavailableyouwillbeassignedyoursecond first choice,however, ifthenumberofapplicantsexceeds first-served basis.Wherepossibleyouwillbeassignedyour prefer tobelinkedwith.Requestsaredealtwithonafirst-come, asking youtoindicatewhichmaternitycareproviderwould welcome packfrom Trinity College. This packcontainsaform After youacceptanoffer tothisprogramme,youwillreceivea the maternityhospitals. approximately onedayperweekwithlecturersandmidwivesin the programme.Beforethisplacementyouwillhavespent midwifery clinicalplacementinNovemberofthefirstyear four yearsoftheprogramme. You willbeginyourfirst Midwifery clinicalplacementstakeplacethroughoutthe Tel: +35318962692 E-mail: [email protected] http://nursing-midwifery.tcd.ie/undergraduate/pre-registration worldwide. move freelywithintheEuropeanUnionandinmostcountries endless. MidwiveseducatedintheRepublicofIrelandmay management, educationandresearch. The opportunitiesare different ways;progressisalongthreebroadpathways:practice, Midwives haveanoptiontodeveloptheircareerinmany initiatives beingdeveloped. midwives whodoso. There arealsoanumberofmidwife-led can alsopracticeindependentlyandthereisasmall-groupof general hospitals,inprivatematernityetc.Midwives Service, inmaternityhospitals,unitsoflargeandsmall care settings. The majorityofmidwivespractisewithintheHealth midwife. Midwivesmaychoosetoworkinavarietyofhealth maintained by An Bord Altranais andbeginyourcareerasa entered inthemidwivesdivisionofRegisterNurses As agraduateyouwillbeeligibletoapplyhaveyourname Assessment will youtrainwith? provider care maternity Which Further information Career opportunities e / Health Sciences 185 p p e
Governance in practice midwifery to midwifery practice Expectant approach Health care quality and informatics Communication and the facilitation midwifery of learning in practice Research methods Further information Course structure Course Course content Assessment http://nursing-midwifery.tcd.ie/undergraduate/post- registration/undergrad-bms-hons.ph http://nursing-midwifery.tcd.ie/undergraduate/post- registration/undergrad-online-acess.ph +353 1 896 2692 Tel: E-mail: [email protected] This course takes place over one academic year on a part- academic year on takes place over one This course for one attend the University will be required to You time basis. a week the course and one day at the beginning of study week Although there is no specific terms. throughout the teaching are expected to be practising clinical component, students the course and will undertake an midwifery whilst undertaking a particular practice-based focus. assignment which has five modules: The course comprises n n n n n both an analytical Assessment methods are designed to require own practice. student’s approach to reading and reference to the combination of essays, projects and group work is used and a A methods module. research proposal forms part of the research B.M.S.
y for application details. develop students’ knowledge of the nature of midwifery develop students’ enable students analyse the midwife’s to full extent of the role and to consider a range of issues relevant to contemporary midwifery practice thinking and assumptions about the challenge students’ profession Registered nurses and midwives in the employment of Registered nurses and midwives in the employment their health public health care agencies may apply to of Health service employer for inclusion in the Department Where fees are not part-time fees initiative. and Children’s students registered paid by the health service employer, fees. for the B.M.S. will be required to pay tuition numbers of This course will only run if there are sufficient suitable applicants. Application Procedure: applications are made directly This is not a CAO course, run in 2013, the next This course will not to the University. 2014 (if there are sufficient intake will be for September numbers of suitable applicants). of Nursing and Midwifery Please consult the School website for further details. Access to degree programme (see below) The Note: run in 2013. See www.tcd.ie/Admissions/ WILL undergraduate/appl DEGREE AWARDED: DEGREE Bachelor in midwifery studies midwifery Who is eligible to apply? Course overview Midwives already holding registration as a midwife with An Bord Midwives already holding registration as a midwife with Altranais but without the Diploma in Midwifery (or equivalent) Access to may apply for admission to a one-year part-time degree programme which, on successful completion, will allow access to the beginning of the degree year. Midwives who hold registration as a midwife with An Bord Midwives who hold registration as a midwife with Altranais, the Irish nursing board, and who qualified with the Diploma in Midwifery (or equivalent), may apply for admission into this one-year programme leading to a Bachelor in midwifery studies honors degree. n n n This degree programme aims to provide practicing midwives This degree programme aims to provide practicing and attitudes about with an increased level of knowledge, skills The programme will: the principles and processes of practice. Contemporary trends and developments in the delivery of health Contemporary trends and developments in profession in terms of care present a challenge to the midwifery role and responsibilities. reclaiming and expanding the midwife’s 186 Health Sciences GCSE ‡ Leaving Certificate Special EntryRequirements: DEGREE AWARDED: applicants): general integrated(mature TR912 Children’s and general integrated: TR911 Children’s and (mature applicants): TR098 Intellectualdisability TR097 Intellectualdisability: applicants): TR096 Psychiatric(mature TR095 Psychiatric: (mature applicants): TR094‡ General, Adelaide TR093‡ General, Adelaide: applicants): TR092 General(mature TR091 General: TR913/914: Midwifery, page183 See also: page 26forfurtherdetails. Students willberequiredtoundergo Gardavetting.See Garda Vetting: page 198. the practiceareawhereyouwillbeonplacement.See organised bythehealthserviceproviderresponsiblefor Screening (includingamedical)andvaccinationwillbe written assessmentbytheNursingCareersCentre. to Trinity College.However, youwillbeinvitedtoattenda submit amature-studentsupplementaryapplicationform of theproposedyearentry. You arenotrequiredto Applications mustbereceivedbytheCAO1February Note formatureapplicants: nursing integrated general and Children’s nursing, disability Intellectual nursing, Psychiatric nursing, General Nursing: Seenote16,page32.
O/HD3 Grade C Grade C O/HD3 B.Sc. (Cur.) 5 15 13 17 25 20 4 29 14 92 2012: PLACES Mathematics chemistry physics or science or agricultural physics/chemistry physics, chemistry, Mathematics In oneofbiology, In oneofbiology, 232 480* 188 375* 203 375 226 395* 220* 415* 2011: POINTS
n Psychiatric nursing n n General nursing hospital. Trinity College’s sixlinkedhealthserviceprovidersare: duration oftheirprogrammeandbecomeanintegralpartthe Students remainwiththesamehealthserviceproviderfor years) isoffered inpartnershipwithsixhealthserviceproviders. This four-yearnursingprogramme(Children’s andgeneralis4.5 never farfromthecentreofstudentlife. proximity to Trinity College’s maincampus,Nursingstudentsare opportunity tomeetandinteractwiththeirclassmates.Withits and MidwiferybuildingonD’OlierStreet,offering studentsan students aretaughtpredominantlyintheSchoolofNursing discipline asyouspecialisewithinyourchosenarea.Nursing study coremodules,andformcohesiveclasseswithinyourown community. You willmeetstudentsfromalldisciplinesasyou in Trinity College,youwillbecomepartofavibrantstudent With overonethousandundergraduatenursingstudents component. degree course–atheoreticalcomponent andaclinical choose tofollow. There aretwocomponentstothenursing and caringnursingpracticeinthe disciplineofnursingyou professional valuesnecessary to providehigh-quality, competent This coursewillgiveyoutheknowledge, skills,attitudeand in College. are inapositiontofullyengagewiththecourseduringyourtime physically andemotionallysoyoushouldensurethat extra demandsonstudents’ time.Itcanbedemanding,both Like allprofessionalcoursesinhealthsciences,nursingplaces nurse. understanding personalityandoutlooktoenjoyworkingasa capable ofworkingaspartateam,andhavecaring You willneedtohaveakeeninterestinhealthcare, be n Children’s &generalintegratednursing n n Intellectual Disabilitynursing n Course overview Course content Is thistherightcourseforyou? Health Service Executive Dublin Mid-Leinster Health ServiceExecutiveDublin St. James’s Hospital National Children’s Hospital(AMNCH)at Tallaght The and MeathHospitals,incorporatingthe Adelaide National Children’s Hospital(AMNCH)at Tallaght The and MeathHospitals,incorporatingthe Adelaide Abbey St. Anne’s SistersofCharityJesusandMary, Moore Stewart’s HospitalServicesLtd,Palmerstown St. Patrick’s Hospital Health Sciences 187 – e.g. training, – including a of infants and children – specialising in the care of – specialising in the of infants, children and adolescents (e.g. addiction studies, child and studies, child and (e.g. addiction Medical nursing of infants, children and adolescentsMedical nursing and specialist within a family-centred framework (general placements) Surgical nursing and specialist within a family-centred framework (general placements) Emergency nursing Accident and within a family-centred framework nursing of infants, children and Operating theatre adolescents within a family-centred framework Mental health issues for children and adolescents and their families within a family-centred framework Community nursing Maternity and neonatal care within a family-centred framework Education and development of the adult Education and development living areas work, activation and behaviour Disorders of human including those persons with disorders of human behaviour, with intellectual disability Acute nursing – specialising in the care of persons with intellectual acute nursing needs, including those with disability who have physical disability/illness communication, Specialist areas – e.g. physiotherapy, speech and language, and physical education Management Specialist areas Specialist behaviour therapy special care units, psychiatry, adolescent psychiatry) and forensic person older Care of the nursing Adult general Management of the child Education and development developmental experiences across a balance of caring and specialist settings variety of generic and Which health service provider will you train with? Children’s and General nursing Children’s n n n n n n n will you disciplines nursing the of one to offer an accept you After This pack contains College. Trinity receive a welcome pack from a form asking you to indicate which health service provider you would prefer to be linked with. Requests are dealt with on a first- come, first-served basis. Where possible you will be assigned if the number of applicants exceeds your first choice; however, the number of places available you will be assigned your second reserve list is held and if a vacancy arises it may A choice. be possible to transfer to your first choice. Most students are allocated their first choice of health service provider. n n n n nursing Intellectual disability n n n n n n (including primary health care, – general/specialist (including day care, – general/specialist (including day care, Psychiatric nursing (acute and long-term care in mental health) Community-based care and rehabilitation Home nursing/community voluntary and statutory agencies, intellectual disability) Operating theatre Maternity care Surgical nursing Accident & Emergency and outpatients nursing Children’s Mental health nursing person Care of the older Medical nursing outpatients, coronary care, high dependency units) outpatients, coronary care, high dependency units) n n Psychiatric nursing n n n n n n n n General nursing n As the course progresses, you will undertake a number of As the course progresses, you will undertake These clinical placements in your chosen discipline. different include: Clinical component with one of the For the clinical component you will be linked clinical placements health service providers and will also have Psychiatric & in a variety of clinical settings. For General, of 48 weeks Intellectual disability disciplines, this will consist weeks in each year taking place in blocks ranging from 4 to 14 of the programme you of the programme. During the fourth year The placement. will undertake a 36-week roster of continuous course will consist of 58 weeks and general integrated Children’s roster of continuous of clinical placements along with a 36-week The rostered placement spans the fourth and fifth placement. years of the course. For the theoretical component, students will undertake modules students will undertake modules For the theoretical component, with all nursing disciplines and modules of study that are shared Nursing, The subjects of study are that are discipline-specific. with the and Sociology, Biological sciences, Psychology (see the table below for module emphasis being on Nursing two students will concentrate on nursing, titles). In years one and In years three, four biological, behavioural and social sciences. develop and enhance and five (where applicable), students will nursing their knowledge, skills and attitudes for professional practice. Theoretical component Theoretical will be of the course of the theoretical component The majority of Nursing and Midwifery College School Trinity taught in the from the Street, minutes is located on D’Olier building, which the held on other sites including Classes are also main campus. Centre for Health Trinity and in the College campus Trinity main methods include Teaching Hospital. Sciences in St. James’s classes, clinical skills laboratories, lectures, tutorials, practical learning and reflective workshops. group teaching, web-based 188 Health Sciences The Freshman(firstandsecond)years The firstclinicalplacementofthecoursetakesplaceafter Christmasvacationinthefirstyear individual study. When notonclinicalplacementyoucanexpecttospendatleast 25hourseachweekinguidedstudyandapproximately10 Elective/Broad Curriculum(seepage14)(yr2) Psychological themesfornurses(yr2) Advanced anatomyandphysiology(yr2) Professional conceptsfornursing(yr2) The sociologyofhealthandillness(yrs12) Introduction topsychology(yr1) Scientific basisfornursing(yr1) Historical, legalandtheoreticalfoundationsofnursing(yr1) Communication andessentialskillsfornursingpractice(yr1) Health promotionandresearch(yr1) Shared learningmodules(Alldisciplines) Modules ofstudy Healthcare needsofchildandfamily(yr2) The sickchild(Part A) (yr2) Introduction tochildren’s nursing(yr1) All modulesaspergeneralnursing,plus: Children’s andgeneralnursing: Foundations ofdiseaseandpharmacologicalintervention(yr2) perspectives (yr2) Frameworks forintellectualdisability:policyandpractice Approaches tonursingpractice(yrs1&2) Holistic understandingsofcare(yr1) Concepts ofintellectualdisability2(yr2) The lifespanofthepersonwithintellectualdisability(yr2) Introduction tothepersonwithintellectualdisability(yr1) Intellectual disabilitynursing: Psychopharmacology (yr2) Facilitating physicalhealthandwell-beinginmental problems (yr2) nursing (yr2)Working withpeopleenduringmentalhealth Clinical riskassessmentandmanagementinmentalhealth Psychotherapeutic approachesandmentalhealthnursing(yr2) Psychotherapeutic skillsandmentalhealthnursing(yr1) Recognising mentaldistress/illness(yr1) The natureofmentalhealthnursing(yr1) Theoretical perspectivesonmentalhealth/illness(yr1) Psychiatric nursing: Foundations ofdiseaseandpharmacologicalintervention(yr2) General nursing4(yr2) General nursing3(yr2) General nursing2(yr2) General nursing1(yr2) Community nursingandcareoftheolderperson(yr1) Nursing inspecialistservices(yr1) Introduction togeneralnursing(yr1) General nursing: Discipline-specific modules . Health Sciences 189 /
e Further information http://nursing-midwifery.tcd.ie/undergraduate/pre-registration In spite of the economic climate there are many nursing vacancies in both public and private healthcare institutions top School degree from Ireland’s A in Ireland and worldwide. of Nursing & Midwifery will of course assist you in finding the will also be qualified to You right job in your chosen career. continue your education and to further specialise should you range wide a offers Nursing of School Trinity The so. do to wish of postgraduate courses for furthering your studies. Nurses of healthcare products. E-mail: [email protected] +353 1 896 2692 Tel: also take up careers in industry, particularly in the marketing also take up careers in industry, Discipline-specific modules Discipline-specific General nursing 3) General nursing 5 (yr 3) General nursing 6 (yr 3) Acute care nursing (yr sciences and clinical skills (yr 3) Advanced biological (yr 4) rehabilitation, palliative care and pain management Disability, Psychiatric nursing of specialist client groups (yr 3) Introduction to the needs in the community (yr 3) Mental health nursing with the older person (yr 3) Working with people who experience multiple and complex needs and Working clinical skills (yr 3) (yr 4) Contemporary issues in mental health nursing Intellectual disability nursing Therapeutic interventions for care 2 (yr 3) 2 (yr 3) Frameworks for intellectual disability practice A) (yr 3) disability 2 (Part Physical health in persons with an intellectual disability 2 (Part B) (yr 3) Physical health in persons with an intellectual nursing (yr 4) Contemporary issues in intellectual disability and general nursing Children’s All modules as per general nursing, plus: The sick child (Part B) (yr 3) child (yr 4) The adolescent and their family – the healthy nursing (yr 4) Contemporary aspects of children’s (yr 4) nursing) Continuing healthcare (children’s practice (yr 5) Growth and development for professional Research (yrs 3 and 4) Research applied to nursing (yr 3) Psychology and sociology (see page 14) (yr 3) Elective/Broad Curriculum for professional practice (yr 4) Growth and development you will be on a 36-week roster of continuous clinical placement where applicable), During fourth year (and fifth year, Career opportunities Assessment Management and health policy (yr 4) Management and health Shared learning modules (All disciplines) modules (All Shared learning As a graduate you will be eligible to apply to have your name entered in the relevant division(s) of the Register of Nurses Altranais and work as a nursing An Bord maintained by and The Children’s professional in your chosen discipline. general nursing programme combines the general programme which results in a programme and integrates a children’s programme which spans the seven ages of man and allows for An a general nurse with and registration as both a children’s Altranais. Bord A combination of examinations, essays, clinical projects, clinical combination of examinations, essays, clinical A skills, laboratory techniques, literature reviews (review of past and current literature relating to the subject matter), reflective practice (thinking about an experience and reflecting on its meaning) and clinical assessments is used. The Sophister (third, fourth & fifth) years fourth & fifth) (third, The Sophister 190 Health Sciences profession. and challengetheirthinkingassumptionsabout develop students’ knowledgeconcerningthenature ofnursing principles andprocessesofpractice. The programmewill increased levelofknowledge,skillsandattitudesaboutthe This degreeprogrammeaimstoprovidenurseswithan graduate level. to providethenursewithadepthandbreadthofknowledgeat responsibilities. These developmentshaveresultedintheneed care havebroughtaboutanexpansionofthenurse’s roleand Contemporary trendsanddevelopmentsinthedeliveryofhealth beginning ofthedegreeyear. which, onsuccessfulcompletion,willallowaccesstothe admission toaone-yearpart-time Access todegreeprogramme without theDiplomainNursing(orequivalent)mayapplyfor Nurses alreadyholdingregistrationwith An Bord Altranais, but degree. year programmeleadingtoaBachelorinNursingstudieshonors studies (orequivalent),mayapplyforadmissionintothisone- nursing boardandwhoqualifiedwiththeDiplomainNursing who holdregistrationwith Candidates An Bord Altranais, theIrish Who iseligibletoapply? Course overview DEGREE AWARDED: Bachelor innursingstudies suitable applicants. This coursewillonlyruniftherearesufficientnumbersof for theB.N.S.willberequiredtopaytuitionfees. paid bythehealthserviceemployer, studentsregistered and Children’s part-timefeesinitiative.Wherearenot service employerforinclusionintheDepartmentofHealth public healthcareagenciesmayapplytotheir Registered nursesandmidwivesintheemploymentof undergraduate/appl WILL runin2013.Seewww.tcd.ie/Admissions/ Note: The Access todegreeprogramme(seebelow) website forfurtherdetails. Please consulttheSchoolofNursingandMidwifery numbers ofsuitableapplicants). intake willbeforSeptember2014(iftherearesufficient to theuniversity. This coursewillnotrunin2013,thenext This isnotaCAOcourse,applicationsaremadedirectly Application Procedure: y forapplicationdetails B.N.S. must beachievedineachmodule. (assignments). To achieveanoverallpassaminimumof50% All modulesareassessedbycontinuousassessment n n n n n care. which addresscurrentissuesinnursingpracticeandhealth The programmeiscomposedoffivecompulsorymodules, in theawardofaBachelornursingstudiesdegree(B.N.S.). College. Successfulcompletionoftheprogrammewillresult is onestudyweekatthestartofacademicyearin Trinity programme. Lecturesareprovidedonedayperweekandthere The Bachelorinnursingstudiesisapart-timemodular E-mail: [email protected] Tel: +35318962692 registration/undergrad-online-acess.ph http://nursing-midwifery.tcd.ie/undergraduate/post- registration/undergrad-bns-hons.ph http://nursing-midwifery.tcd.ie/undergraduate/post- Assessment Course structureandcontent Further information Research methods practice issuesinnursing Contemporary practice oflearninginnursing andthefacilitation Communication Health carequalityandinformatics nursingpractice managementin Leadership and
e p p
Health Sciences 191
Working with people with depression with people and schizophrenia Working a meal to foster a sense such as cooking using activities skills and facilitate develop personal of achievement, experiences. successful the play and movement activities to improve Using play cerebral palsy. skills of children with Running life-skills programmes that enable people with develop skills such as budgeting so intellectual disabilities independently in the community. that they can live more groups aboutAdvising community ways to promote health in their lives. and maintain activity use equipment Enabling people and effectively to select wheelchairs, dressing aids, and appliances, including their to increase assistive technology, computers and other independence. brain injury Assessing the ability of someone with acquired work (the to return to work and then modify that person’s where possible, job itself and the workplace) to enable this, to happen. Occupational therapy College at Trinity Course content Is this the right course for you? Is this the right course for good understanding of what is involved in this profession. good understanding of what is involved in for Health Centre Trinity Occupational therapy is based in the in the grounds Sciences in a new purpose-built complex Hospital. State-of-the-art teaching facilities of St. James’s tele-conferencing. school include a capacity for at the O.T. disciplines Centre houses other health sciences Trinity The therapeutic including students studying medicine, physiotherapy, a multidisciplinary This gives radiography and nursing. dimension to studying and working with other health The centre is about 2 miles from the main professionals. between running line the on station Luas a beside is and campus Courses which and Connolly Station in the city centre. Tallaght take place on the main campus in College Green, for example expose students to the anatomy and social policy, psychology, College. Trinity wider facilities of This four-year degree course incorporates a practical approach to solving problems and fosters a research-oriented and reflective attitude. n n n n n n creative thinker who is open to finding solutions if you are a Yes, with people with to a multitude of problems and if working find stimulating. diverse abilities is something you enjoy and an occupational therapy department will give you a Visiting
chemistry, biology, biology, chemistry, physics/chemistry or agricultural science chemistry or biology In one of: physics, In one of: physics, TR054 40 500* Occ.) B.Sc. (Cur. HC3 Grade C
– improving or maintaining their level
– examining the self-care, leisure and and safer for him/her to use. Adapting the home of an elderly person to make it easier The occupation The environment – manipulating or adapting the physical environment so that it does not impede but, if possible, enhances performance; and influencing the social, cultural and institutional environment in ways that enable people to live as independent a life as possible and reach their full potential. The individual person The individual (emotional) and of physical, cognitive (thinking), affective social ability. work-related activities people value in their daily lives and making changes to these activities so that they better meet abilities. the individual’s Special Entry Requirements: Leaving Certificate Garda Vetting: vetting. See Students will be required to undergo Garda page 26 for further details. Advanced GCE (A-Level) page 198. See Precautions against infectious diseases COURSE CODES: COURSE PLACES 2012: POINTS 2011: AWARDED: DEGREE Occupational therapy Occupational What is Occupational therapy? Occupational therapists work in a variety of settings, including hospitals, rehabilitation units, schools, and, reform community, centres. Examples of what occupational therapists do include: n n n n Occupational therapy interventions consider: The World Federation of Occupational Therapy maintains that Therapy maintains that Federation of Occupational The World with promoting Occupational therapy is a profession concerned The main goal health and well-being through occupation. to participate in of occupational therapy is to enable people example self care, meaningful activities of everyday living, for believe that work and leisure activities. Occupational therapists supported or restricted participation in everyday activities can be environments. By by physical, social, attitudinal and legislative hold meaning for enabling people to engage in activities that people to improve them, occupational therapists aim to enable their day-to-day quality of life. 192 Health Sciences trained inBelgium,Scotland, Australia, andCanada. practice trainingblocksabroad. To datestudentshavestudied/ Students mayelecttospendoneormoreoftheirprofessional assessment whileonsupervisedpracticeeducation. work, presentations,aresearchproject,andcompetencybased Assessment includeswrittenexaminations,essays,project in supervisedprofessionalpractice. course ofthesetwoyears,youwillspendatotal and researchskills,whicharekeyareasforpractice.Overthe have opportunitiestodevelopimportantself-directedlearning will beexpectedtocompletea incorporates apeereducationmethodology. Additionally, you an evidenced-basedmanner. Servicelearningiscontinuedand care systemsandpoliciesoftheimportancepracticingin of occupationaltherapy;gainanunderstandinghealth/social develop yourknowledgeofthetheories,principlesandpractice During theSophister(thirdandfourth)yearsyouwillfurther The Sophisteryears health andcommunitycarefacilitiesaroundthecountry. 11 weeksinsupervisedprofessionalpracticeavarietyof your choice.Duringthefirsttwoyears,thereareatotalof group worktodevelopknowledgeandskillsinanactivityof through voluntaryworkandwilluseexperientiallearning technology. You willberequiredtoengageinservicelearning professional andtechnicalskillsofpracticesuchasassistive and creativeproblemsolvingincoursesthatteachthe related topersonaldevelopmentsuchascommunications statistics. You willbeencouragedto‘learnbydoing’ insubjects physiology, psychology, disabilitystudies,researchmethodsand interventions withpeoplefromchildrentoolderadults,anatomy, the studyofoccupation,occupationaltherapytheoriesand The coursesstudiedintheFreshman(firsttwo)yearsinclude The Freshmanyears and workwithpeople whoarehomelessandpeople whoarein Other examples includeworkinschoolsand privatepractice, school settingsandinprimarycare communitypracticesareas. Work opportunitiesinIrelandareexpanding,particularly in services fortheelderlyandcommunity occupationaltherapy. mental health,handtherapy, intellectualdisability, paediatrics, specialised expertiseinareassuch asphysicalrehabilitation, of theworld.Mostoccupationaltherapists,overtime,develop graduates fromthe Trinity Collegecourseareworkinginallparts an occupationaltherapistinIrelandaswellabroad.Many soon asyoucompleteyourdegreearequalifiedtowork Occupational Therapists (www.wfot.org.a settings. The courseisapproved bytheWorld Federationof working withpeopleofallagegroupsinawiderangeservice you willbewellequippedtopursueaveryrewardingcareer As aqualifiedoccupationaltherapistfrom Trinity College,Dublin, Career opportunities Study abroad Assessment group researchproject. You will u), whichmeansas 20 weeks Tel: +35318963210 E-mail: [email protected] www.medicine.tcd.ie/occupational_therap opportunities forfurtherstudy. social carerelatedservices. Additionally, thecourseoffers many managing occupationaltherapydepartmentsorotherhealth/ A numberofoccupationaltherapistsmoveintomanagement– prison; othersrunhealthylivingandstressmanagementclinics. Further information n Did youknow? students withmentalhealthdifficulties. nursing home and occupation-focused services for involved in leisure-based groups for residents of a project for people with intellectual disabilities and are For example, students facilitate a staff-led advocacy research and service delivery in new areas of practice. and staff collaborate on projects that involve both learning, as well as more traditional methods. Students methodologies, e.g.peereducation,problem-based Ireland andabroad.Itusesmanyinnovativeteaching has an excellent track record of employment in based occupational therapy course in Ireland and The courseisthelongestestablisheduniversity- e y Health Sciences 193
Teaches Teaches Deals with aspects of the Deals with the theory and Covers the principles of drug design The biology of the human body is an essential The biology both mathematics and data handling to assist you with the the with you assist to handling data and mathematics both and statistics. application of both in pharmaceutical calculations Pharmacology: Develops knowledge about how drugs biochemical and cellular level that is work at the molecular, to treat disease essential if drugs are to be used effectively The course also gives an in humans and in animals. the therapeutic benefits appreciation of factors affecting and adverse risks of medicines. by interacting with basic systems within cells and tissues. by interacting with basic systems within cells Pharmaceutical calculations and data handling: Medicinal chemistry: and isolation. Pharmaceutical analysis: practice of pharmaceutical analysis. Physical pharmacy: Covers the fundamental importance to physiochemical principles of pharmacy of formulation design, performance and stability. Pharmaceutical chemistry: sources, identification, analysis and stability of the materials Additional topics include advanced drug used in medicines. discovery and design, molecular mode of action of drugs and the chemistry of drug metabolism. Develops an Pharmaceutical biotechnology: understanding of how genetics and biotechnological methods can be used to develop new drugs, especially proteins. Pharmaceutics and pharmaceutical technology: This subject is concerned with the formulation, production and evaluation of all types of medicines such as tablets, creams and injections. as well as animals, and plants of study The Pharmacognosy: substances extracted from them, which are used in pharmacy and are active in the treatment and prevention of diseases. A basic introduction to the molecular basic introduction to the and cellular A Biology: can better appreciate how drugs basis to life so that you It also includes introductory genetics, and medicines work. biology. microbiology and developmental Physiology: covers Physiology of pharmacology. prerequisite to the study of all the major body systems, the anatomy and physiology systems. such as blood, the heart, digestive and nervous basic introduction to the ways in which A Biochemistry: cause toxicity drugs are metabolised and how they act or These Studies bacteria, fungi and viruses.Microbiology: these are particularly important in pharmacy because medicines must organisms cause so many diseases. Some or by being be made free of microbes by either sterilisation prepared aseptically. Course content Course n n n n n n n n n The Pharmacy syllabus has been designed to provide you with an an with you provide to designed been has syllabus Pharmacy The sciences, pharmaceutical and basic the both in education all-round 16 approximately are There itself. pharmacy of practice the in and over week per tutorial 1 and sessions laboratory 6 lectures, of hours Freshman (first) year. the course of the Junior during the four years of the course are: Some of the subjects covered n n n n
In one of In one of Chemistry Mathematics physics, biology, physics, biology, mathematics, geology, geography or applied mathematics physics, biology, physics, biology, mathematics, applied mathematics, geography, geology or agricultural science Chemistry Mathematics TR072 75 545 B.Sc. (Pharm.) Grade C Grade B Grade C
HC3 HC3 OC3 or HD3
y for further details.
Special Entry Requirements: Leaving Certificate
Advanced GCE (A-Level)
See www.tcd.ie/Admissions/undergraduate/apply/ entry-pharmac Graduate Entry: graduate entry route to this degree is also available. A GCSE COURSE CODES: COURSE PLACES 2012: POINTS 2011: AWARDED: DEGREE Pharmacy Is this the right course for you? What is Pharmacy? As much of the course is scientifically led, a strong interest in this area will be important and will make your four years of study more enjoyable. While this degree is an essential requirement if you wish to practise as a community or hospital pharmacist, Pharmacy at opens a wide variety of professional opportunities College Trinity in both industry and the healthcare sector. Pharmacy is the study of all aspects of drugs, both natural Pharmacy is the study of all aspects of drugs, their uses in and synthetic in origin, including their chemistry, Pharmacists medicines, and how they work within the body. work in a variety of settings – community pharmacies, hospitals, long-term care facilities, and within the pharmaceutical industry role as a key In many respects, their to name just a few. results best help people achieve the to healthcare professional is from their medications. 194 Health Sciences n n n n n n n n n n n year students)submitadissertationbasedontheirprojects. an importantmeansofassessment.SeniorSophisters(fourth- end-of-year examinationsisused.Practicalarealso A combination of continuous assessment and oral and written either fundedbytheErasmusprogrammeorSchool. as partoftheirundergraduatedegreeprogramme. The studentsare carry out their research projects abroad over theThis summer programme, (12 weeks) including Erasmus, allows pharmacy students to undertake thesummerresearchplacementprogramme. We encourageourstudents(2ndand3rdyearstudents)to students haveundertakeninthepast: The followingaresomeexamplesofresearchprojectswhich linked toacommunity, hospitalorindustryoptionofyourchoice. also prepareadissertationonanaspectofpharmacypractice In thefinalyear, youwillundertakea Assessment programme Summer researchplacement cancer chemotherapy. compounds asdualtargetingagentswithapplicationsfor ofnovelbioactiveconjugate Design andcharacterisation indazole heterocycles. proliferation: chemistryandbiologicalactivityofnovel forproteinswhichregulatecancercell Molecular probes lung cancer. diagnosticbiomarkersfor MicroRNAs asminimally-invasive brain associatedwiththerecreationaldrugMDMA “Ecstasy”. bloodflowchangesinthe Use ofMRItodeterminecerebral of inflammatorymarkersinthebrain? promotetheexpression Does inflammationinthebowel Shopdrugs. Chemical InvestigationofHead process. Investigating thetransferandscale-upofaspraydrying nanocarriers suitablefortheoraldeliveryofinsulin. Feasibility studiesontheformationofcarrageenan-based incident reportingandlearningincommunitypharmacy. Identification ofthefactorsthatimpactonmedication ill patients. Assessing thepotentialfordruginteractionsincritically of thehealthservice. sociological andpsychologicalsubjectsaswellastudy families andothersinthehealthserviceitalsoincludes and becausethisinvolvesworkingwithpatients,their pharmacists doineachoftheareasprofessionalpractice Practice ofpharmacy: This subjectexamineswhat research project and will
Tel: +35318962809 E-mail: [email protected] www.tcd.ie/Pharmacy http://pharmacy.tcd.ie/postgraduate courses inhospital,industrialorcommunitypharmacy. See research, orapplyforentrytooneofthepostgraduate medicines licensing.Inaddition,youcanopttoundertake industrial pharmacy, aswellinstateservicessuch Employment opportunitiesexistincommunity, hospitaland Your careerprospectsasaPharmacygraduateareexcellent. Further information Career opportunities learning integrated into the five years. degree after a five year programme, with work-place institutions (HEIs).StudentswillgraduatewithanMPharm becomes the responsibility of the higher education whereby the full five years of pharmacist education education and develop a five year integrated programme all themajorstakeholderstochangemodelofpharmacy schools ofpharmacyinIreland(TCD,UCCandRCSI) (the National Pharmacy Forum) is working with the three A National Forum on Pharmacy Education and Accreditation Pharmacy (MPharm),requiredforregistrationwiththePSI. of the internship year results in the award of a Masters in final Pre-registrationExamination.Successfulcompletion comprises taught modules, continuous assessment and a the supervisionofatutorpharmacist. The yearalso and industrialenvironments,whereyouwillworkunder pharmaceutical settings including hospital, community The internship training year may be taken in a range of is delivered by the Royal College of Surgeons in Ireland. Pharmaceutical SocietyofIreland(PSI)and,atpresent, year’. The internship year is under the auspices of the as the‘pre-registrationyear’or‘pharmacyinternship to undertakeafurtheroneyeartrainingperiod,known After thefouryearsin Trinity Collegestudentsarerequired as apatient-facingpharmacist. The Pharmacydegreealonedoesnotentitleyoutopractice professional qualification The Pharmacydegreeand / forfurtherdetails.
Health Sciences 195
In the third and fourth years students – the use of exercise in prevention and research project. re-educate muscles. Electrotherapy procedures – includes the use of electrotherapy to alleviate pain, improve circulation and Manipulative procedures – includes the use of soft tissue massage and manipulations to improve mobility and improve circulation. Exercise therapy treatment. to improve strength, mobility and balance. Physiology Anatomy Physics Chemistry Pathology Biomechanics and movement – includes procedures Physiotherapy at Trinity College at Trinity Physiotherapy Course content You will also start to study various conditions and specialities You frequently seen in physiotherapy such as respiratory conditions and musculoskeletal conditions. clinical the end of second year you will start placements under At These may the supervision of skilled and experienced tutors. be taken in hospitals, clinics, day centres or within private and community practice. The Freshman years you will have As a Freshman (first and second year) student week divided between approximately 20 hours of teaching each lecture and practical classes. Courses covered in the first two years include: n n n n n n n n n Physiotherapy is based in the Trinity Centre for Health Sciences Centre for Health Sciences Trinity is based in the Physiotherapy This Hospital. James’s built complex at St. in a purpose allows disciplines and other health science complex houses to share courses with those in the other physiotherapy students a multidisciplinary approach to studying health sciences to give and working. miles from the main campus and is beside The centre is about 2 Connolly and Tallaght line running between a Luas station on the Station in the city centre. this four-year course is to enable you The major objective of the ability to work to become a competent professional with independently with patients. theory and There are two components to Physiotherapy: is on laying clinical practice. In the first year the emphasis the second year a foundation of theoretical knowledge and procedures used introduces students to the clinical skills and taught mainly in the by physiotherapists. Clinical sciences are second and third years. on clinical placement. spend up to fifty percent of their time to develop In the fourth-year students have an opportunity physiotherapy and specialist knowledge in a particular area of undertake a
In two of physics, Mathematics chemistry, biology, biology, chemistry, physics/chemistry, mathematics or agricultural science biology, chemistry, or mathematics Mathematics In two of physics, TR053 40 535 B.Sc. (Physio.) Grade B Grade C
HC3 OC3 or HD3
Special Entry Requirements: Leaving Certificate Advanced GCE (A-Level)
Garda Vetting: vetting. See Students will be required to undergo Garda page 26 for further details. See Precautions against infectious diseases, page 198 See Precautions against infectious diseases, GCSE Combinations of subjects not permitted: Physics/chemistry with physics or chemistry Agricultural science with biology COURSE CODES: COURSE PLACES 2012: POINTS 2011: AWARDED: DEGREE Physiotherapy Is this the right course for you? What is Physiotherapy? of what exactly is involved. Physiotherapy is both physically and academically demanding and you will need to have considerable emotional stability. a local general hospital or other area where Visiting physiotherapists work will give you a good understanding Physiotherapists may be part of a multidisciplinary medical team that includes physicians, nurses, speech and language therapists, psychologists, occupational therapists and social work from clinics Alternatively they may workers among others. or specialise in particular areas of the discipline. Physiotherapy – or physical therapy – places full and functional Physiotherapy – or physical therapy – places It be healthy. movement at the heart of what it means to range of illnesses involves treating patients of all ages with a and conditions, including those with back and neck problems, sports injuries, arthritis, or those recovering from strokes and The methods employed include exercise therapy, operations. manipulative procedures, and a variety of electrical treatments. 196 Health Sciences research, education,managementorprivatepractice. therapy, sportsinjuries,neurology, cardiology, respiratory, develop yourskillsandexpertiseinareassuchasmanipulative as youwish. There isalsogreatscopeforyoutocontinue be abletoworkwithawiderangeofconditionsorspecialise, Physiotherapists aresoughtthroughouttheworldandyouwill accrediting bodyforphysiotherapyinIreland. of theIrishSocietyCharteredPhysiotherapists, Successful completionofthecourseentitlesyoutomembership while onaclinicalplacement. element ofthecourse,includingyourassessmentapatient clinical placementandwillhavepracticalexamsontheskills In addition,youwillbecontinuouslyassessedduringyour such asanatomy, makeupthetheoreticalassessmentstructure. End-of-year writtenexaminationsandtestsincertainsubjects, elderly, paediatrics,women’s health,sportsinjuriesandpain. Examples ofsubjectchoicesavailableincludecarethe conjunction withadvancedstudyinanareaofyourchoice. investigative projectonatopicrelatedtophysiotherapyin In theSeniorSophister(fourth)year, youwillundertakean a varietyofsettingsbothwithinandoutsidetheDublinarea. academic studiesandtheotherhalfonclinicalplacementsin In theJuniorSophister(third)yearhalfoftimeisspenton The Sophisteryears Tel: +35318962110 /1 www.medicine.tcd.ie/physiotherap Further information Career opportunities Assessment n Did youknow? and out-patients. orthopaedics, women’s health, care of the elderly, sports including neurology, respiratory care, coronary care, in some of the specialist areas of physiotherapy These placements allow students to gain experience established expertise in most areas of physiotherapy. James’s and AMNCH in Tallaght wherethereisan College’s associated teaching hospitals of St. All students will have clinical placements at Trinity y
entering theprofession. role oftheradiationtherapist,makingthisanexcitingtimetobe in Irelandsoistheopportunityfordevelopmentoftraditional in manyaspectsoftheircare. As radiationtherapyisexpanding for thepatientduringcourseoftheirtreatmentandinvolved graduate radiationtherapistyouwillbethemainpointofcontact you willalsocareforthepatientduringthistreatment. As a plan anddeliverthebestcourseofradiationtherapyforpatients, When youqualify, youwillworkwithinamultidisciplinaryteamto of acourseradiationtherapy. team members,isresponsibleforthepreparationanddelivery radiation therapist–thepractitionerwho,togetherwithother patients withcancer. This coursequalifiesyoutoworkasa Radiation therapyisoneofthemainmethodsusedtotreat course atahigh standinginternationally. treatment unit. This equipmentandtechnology placesthis and internationallyavirtual (simulator)radiationtherapy teleconferencing systemthatfacilitates linksbothnationally localisation andplanninglaboratory inEurope;asophisticated Therapy includethelargestacademic radiationtherapy State-of-the-art teachingfacilities attheDisciplineofRadiation Sciences inapurposebuiltcomplexatSt.James’s Hospital. Radiation therapyinbasedthe Trinity CentreforHealth you tohavegoodinterpersonalandtechnicalskills. in patientcare.Working as aradiationtherapistwillalsorequire development ofyourclinicalskillsrequiresyoutobeinterested to haveakeeninterestinbiology, physicsandchemistry. The Your degreewillcovermanysciencesubjectssoyouneed maturity. The radiationtherapistrequiresveryspecialist skills. demanding andyouwillneedtohaveconsiderableemotional Radiation therapyisbothphysicallyandacademically What isRadiationtherapy? Radiation therapyatTrinity College Is thistherightcourseforyou? DEGREE AWARDED: POINTS 2011: PLACES 2012: COURSE CODES: Radiation therapy page 26forfurtherdetails. Students willberequiredtoundergoGardavetting.See Garda Vetting: Advanced GCE(A-Level) Leaving Certificate Special EntryRequirements:
HC3 Grade C B.Sc. (Ther. Rad.) 515* 30 TR055 In oneofphysics, In oneofphysics, biology chemistry or physics/chemistry chemistry, biology,
Health Sciences 197
are held throughout the year for for year the throughout held are e Information days students interested in finding out more about radiation please For details of the next information day, therapy. contact Daléne Dougall on: + 353 1 896 3234 Health care management Research project Clinical practice (clinical placement) 4 Principles andPrinciples care 2 practices of cancer Radiographic anatomy andPsychology communication 2 methodology and statisticsResearch Clinical (clinical placement) practice 2 Principles and of cancer care 3 practices therapy 3 Physics for radiation Radiobiology Radiation therapy treatment planning localisation and verification Treatment Research methodology and statistics Clinical practice (clinical placement) 3 Principles and practices of cancer care 4 planning Radiation therapy treatment simulation and Did you know? n Further information Assessment Career opportunities y www.medicine.tcd.ie/radiation_therap + 353 1 896 3248 / 3234 Tel: E-mail [email protected] n n n and clinical This course assesses both the theoretical written end-of-year subjects by a variety of methods including and group examinations, continuous assessment, individual and case project work, oral examination, practical exams are a substantial clinical portfolio and research project A studies. component of the assessment processes in your final year. The broad There is a worldwide need for radiation therapists. scientific content of the degree also means that you will be well qualified to start a career in research and development, medical or the marketing of products associated with cancer technology, and in the health sector generally. medicine in particular, n n n n n years The Sophister and fourth) years, you will study more In the Sophister (third are specifically related to cancer and specialist subjects that a research project in this area. patient care, and complete year The Junior Sophister cover the following areas Third-year subjects will n n n n n n n The Senior Sophister year areas Fourth year subjects will cover the following n n
Biochemistry Physiology Anatomy 2 Physics for radiation therapy 2 Anatomy 1 Physics for radiation therapy 1 Principles and practices of cancer care 1 Psychology and communication 1 Clinical practice (clinical placement) 1 Biological principles and practices Chemical principles and properties Course content Course n n n n The Senior Freshman year Second year subjects will cover the following areas n n n First year subjects will cover the following areas n n n 20-30 hours per week in class. n The Junior Freshman year approximately there are In the Junior Freshman (first) year, A clinical component (clinical placement) will introduce you to clinical component (clinical placement) will A radiation therapy and will develop your understanding of the complexities of the cancer patient pathway. The Freshman years the course covers the In the Freshman (first and second) years, will also You basic sciences – physics, chemistry and biology. body through study the structure and function of the human biochemistry and genetics, and will be physiology, anatomy, psychology, areas: following the in covering modules to introduced medicine, cancer statistics, and methodology research pathology, and skills. radiation physics and professional attitudes The duration of the clinical placement is 1 month in Junior The duration of the clinical placement is 1 2 months in Senior Freshman (second) Freshman (first) year, 3 months in Junior Sophister (third) year and 5 months year, placement Part of the clinical in Senior Sophister (fourth) year. clinical placement takes place during the vacation periods and consists of 35 hours per week. A significant clinical component is integral to this course. significant clinical component A the radiation therapy departments attached The clinical sites are Luke’s, Radiation Oncology Network at St to the St. Luke’s and Beaumont Hospitals in Dublin; Cork University St. James’ the Mater Private Hospital; University College Hospital Galway; Private Hospital, Dublin; the Hospital, Dublin; St. Vincent’s the Hermitage Galway Clinic; the Limerick Clinic; the Beacon; Clinic and Whitfield Clinic. This four-year honours degree gives you a broad academic base gives you a broad academic honours degree This four-year It skills of radiation therapy. develop the clinical on which to decisions and make clinical to analyse, evaluate qualifies you in and encourage research in cancer and to initiate, participate and clinical There are both theoretical and radiation therapy. the emphasis being more on the components to this degree, in the first two years and more on the theoretical component The component in the last two years. clinical and research in this course and the subjects are taughtcontact hours are high practical sessions, workshops,through lectures, laboratory-based in the hospital setting. tutorials and clinical placement 198 Health Sciences medical studentsisavailableon theSchoolofMedicinewebsite. are availableattheMedicalSchool office. TheBBVpolicyfor and thebloodborneviruses(BBV) policyformedicalstudents members ofthepublic.Details of thevaccinationprogrammes the studentsandtheircolleagues, butalsothepatientsand and appropriatemeasuresaretakennotonlytosafeguard this context,theSchoolisobligedtoensurethatreasonable the publicwithwhommedicalstudentsareinclosecontact.In students applyingforentryandouroverridingdutyofcareto a balancebetweenourpastoralresponsibilitytoindividual diseases, theSchoolofMedicineat Trinity CollegeDublinstrikes Medicine: Withregardtothetransmissionofinfectious of vaccination. commence clinicalpracticeuntiltheyhavecompletedacourse Trinity College,Dublin2.Studentswillnotbepermittedto may beobtainedonrequestfromtheDentalSchoolOffice, a courseofvaccination.Detailsvaccinationprogrammes deemed tobeimmunehepatitisBwillrequiredundergo Students admittedtothedentalcourseswhoarenotalready right toretestprioradmission. Office assoonpossiblethereafter. TheCollegereservesthe their homecountryandtoforwardtheresultDentalSchool College. Internationalstudentsareadvisedtoundergotestingin months priortoentry, beforebeingpermittedtoregisterwiththe PCR testforHepatitisCRNA)carriedoutnotmorethansix negative HepatitisCantibodytest(andifpositivea HBeAg andnegativeHBV-DNA whereapplicable)anda and Anti-HBc orinthepresenceofapositiveHBsAg,negative negative hepatitisBvirusinfectionresult(i.e.HBsAg Students inDentalscienceandhygienemustproducea tuberculosis, chickenpox,measles,mumpsandrubella. could includebutarenotlimitedto;HIV, hepatitisB,C, transmitted toapatientorfellowhealthworker. Suchconditions free ofanylife-threateninginfectiousconditionthatcouldbe hygiene, Dentalnursing,andtechnologymustremain technology: Dental science,hygiene,nursing,and right toretestprioradmission. office assoonpossiblethereafter. TheCollegereservesthe in theirhomecountryandtoforwardtheresultrelevant International applicantsareadvisedtoundergotheHBsAgtest test withanegativeresultwillberequiredbeforeregistration. positive resultfromtheabove,aHepatitisBe-antigen(HBeAG) before being permitted to register for this course. In the case of a (Anti-HBc) testresultcarriedoutwithinsixmonthspriortoentry Hepatitis Bs-Antigen(HBsAG)and Anti HBCore Antigen and membersofthepublic.Studentsmustproduceanegative to safeguardstudentsandtheircolleagues,butalsoclients that reasonableandappropriatemeasuresaretakennotonly students maybeinclosecontact,weareobligedtoensure of careistothepublicwithwhomspeechandlanguagetherapy Clinical speechandlanguagestudies: IMPORTANT: PLEASEREADTHISSECTIONCAREFULLY. Precautions againstinfectiousdiseases RegisteredstudentsinDentalscience, As ouroverridingduty the DisciplineofPhysiotherapy(see below). information relating to vaccination requirements is available from and to forward the result to the Discipline of Physiotherapy. Further applicants areadvisedtoundergo testingintheirhomecountry B willberequiredtoundergoacourse ofvaccination.Overseas are negative but not already deemed to be immune to Hepatitis six monthspriortoentry. Studentsadmittedtothiscoursewho a negative PCR test for hepatitis C RNA) carried out not more than applicable) and a negative Hepatitis C antibody test (and if positive positive HBsAg, negative HBeAg and negative HBV-DNA where virus infection result (i.e. negative HBsAg or in the presence of a Students in Physiotherapy must produce a negative Hepatitis B tuberculosis, measles,rubellaandchickenpox. to certifytheirHepatitisstatus,vaccinationstatusorimmunity to, Service ortheirmedicalpractitionerinthefirstsemesterofstudy disease, allnewentrantsmustattend Trinity CollegeHealth interests ofreducingtherisktransmissioninfectious infection orpreviousvaccinationhasbeendocumented.Inthe tuberculosis andvaricellaunlessimmunityasaresultofnatural immunised againstHepatitisB,C,measles,rubella, Physiotherapy programme,priortoadmission,mustbe Physiotherapy: Studentsacceptedontotheundergraduate has beendocumented. immunity asaresultofnaturalinfectionorpreviousvaccination Hepatitis B,measles,rubella,tuberculosisandvaricellaunless prior tothefirstpracticeplacement,mustbeimmunisedagainst registration undergraduateOccupationaltherapyprogramme, Occupational therapy:Studentsacceptedontothepre- be screenedforadditionalconditions,exampleMRSA. practice. Somehealthserviceprovidersmayrequirestudentsto be organised by the health service provider where the student will documented. Screening(includingmedicals)andvaccinationwill as aresultofnaturalinfectionorpreviousvaccinationhasbeen B, measles,rubella,tuberculosisandvaricellaunlessimmunity Midwifery programmesmustbeimmunisedagainstHepatitis students onthepre-registrationundergraduateNursingand Nursing andMidwifery: booklet) andareavailableatalltimesintheMedicalSchooloffice. of theadmissionsprocess(ininfectiousdiseasesinformation programmes available are communicated to applicants as part Details of specific investigations required and the vaccination to hepatitis B will be required to undergo a course of vaccination. are hepatitis B negative but not already deemed to be immune confirmation that they do not have active disease. Students who evidence of their hepatitis B and C status and where appropriate rubella andchickenpox.Inaddition,studentsmustproduce vaccination statusorimmunitytotuberculosis,measles,mumps, the CollegeHealthServicepriortoregistrationcertifytheir new entrants must attend their regular medical practitioner or diseases from patients to students, or student to patient, all the interestsofreducingrisktransmissioninfectious All health care professionals have a duty of care to the public. In Prior to the first practice placement, Priortothefirstpracticeplacement, Health Sciences 199
Some health service providers may require students to to students require may providers service health Some Physiotherapy: Department of Physiotherapy for Health Sciences Centre Trinity Street James’s Dublin 8 +353 1 896 2110 Tel: Occupational therapy: Discipline of Occupational therapy for Health Sciences Centre Trinity Hospital St. James’s Street James’s Dublin 8 +353 1 896 3210 Tel: Nursing and Midwifery: Allocations Office The The School of Nursing and Midwifery 24 D’Olier Street Dublin 2 +353 1 896 2031 Tel: Medicine: School of Medicine Biomedical Sciences Institute College Trinity Dublin 2 +353 1 896 1075 Tel Dental science: The Dental School Office Lincoln Place College Trinity Dublin 2 +353 1 896 1789 / 1690 Tel: Clinical speech and language studies: Studies Department of Clinical Speech and Language College Trinity Dublin 2 +353 1 896 1588 Tel: Details of vaccination requirements will be provided to all Details of vaccination full details of all requirements regarding incoming students, and diseases may be obtained on precautions against infectious offices: request from the following If Irish law or regulatory practice changes between the date of changes between the or regulatory practice If Irish law and the date of registration for new publication of this document College reserves the right Trinity entrants to these courses, adopted by law and/or regulation in to require that the criteria to practice clinically in Ireland be satisfied relation to the ability permitted. before registration is be completed at the clinical site. All costs associated with tests for which will for example MRSA, for additional conditions, be screened for tests with associated costs All site. clinical the at completed be student. must be met by the and vaccination infectious diseases General: Index
A D
Access services 12 Deaf studies 52 Accommodation 8 Dental hygiene 171 Acting 57 Dental nursing 172 Admission requirements 24 Dental science 174 Alert list 203 Dental technology 176 An Ghaeilge 9 Disability Service 12 Ancient and medieval history and culture 74 Drama studies 55 Ancient history and archaeology 77 Drama and theatre studies 55 Arts courses at Trinity College 35 E B Early and modern Irish 80 Biochemistry 144 Early Irish 80 Biomedical engineering 129 Earth sciences 161 Broad curriculum 14 Economics Business Within BESS 37 Within BESS 37 Within PPES 99 With Computer science 118 Within TSM 59 With a language 41 Education 61 With Law 92 Electronic engineering 133 Business, economic and social studies (BESS) 37 Electronic and computer engineering 135 Further Information Business studies and a language 41 Engineering (Integrated) 125 Biomedical 129 C Civil, structural and environmental 130 Computer 132 Careers Advisory Service 10 Electronic 133 Catholic theological studies 106 Electronic and computer 135 Chaplaincy 11 Mechanical and manufacturing 136 Chemistry 145 Engineering with management (Integrated) 137 Chemistry with molecular modelling 160 English literature 62 Children’s and general integrated nursing 186 English studies 62 Civil engineering 130 Environmental engineering 130
Classical civilisation 45 Environmental sciences 146 Classics 43 European studies 64 Clinical speech and language studies 49 Computer engineering 132 Computer science 117 Computer science and business 118 Computer science and language 120
200 F Integrated engineering with management 137 Intellectual disability nursing 186 Fees information 23 Irish Film studies 67 Early and modern Irish 80 French Within Computer science and language 120 With Business studies 41 Irish studies 82 Within Computer science and language 120 IT services for students 13 Within European studies 64 Italian With Law 90 Within European studies 64 Within TSM 68 Within TSM 85 Functional biology 147 J G Jewish and Islamic civilisations 86 Gallery, Douglas Hyde 7 Garda vetting 26 L Genetics Within Science 148 Latin 48 Human genetics 162 Languages General nursing 186 Optional courses 14 Geography Within TSM 36 With Political science 102 Law 87 Further Information Within Science 141 With French 90 Within TSM 69 With German 90 Geology 150 Law and business 92 German Law and political science 94 With Business studies 41 Library 13 Within Computer science and language 120 Within European studies 64 M With Law 90 Management science and information systems studies Within TSM 70 (MSISS) 124 Greek 46 Manufacturing engineering 136 Mathematics 164 H Matriculation examination 26
Health Service 11 Mature students officer 12 History 72 Mechanical engineering 136 History and political science 75 Medicinal chemistry 165 History of art and architecture 79 Medicine 179 How to apply 19 Microbiology 152 Human genetics 162 Midwifery 183 Human health and disease 177 Bachelor in midwifery studies 185 Human nutrition and dietetics 178 Modern Irish 80 Molecular medicine 153 Music 95 I Music education 95 Immunology 151 Information systems (Diploma and Degree) 122 Integrated engineering 125
201 N S
Nanoscience, physics and chemistry of advanced materials 167 Scholarships and awards 17 Neuroscience 154 Science 140 Nursery 11 Social studies (social work) 110 Nursing 186 Sociology Bachelor in nursing studies 190 Within BESS 37 Within PPES 99 O Within TSM 112 Sociology and social policy 113 Occupational therapy 191 Spanish One-year/one-term students 23 With business studies 41 Open Days 15 Within European studies 64 Optional courses 14 Within TSM 115 Sports centre and sports clubs 7 P Sports scholarships 17 Stage management and technical theatre 58 Pharmacy 193 Structural engineering 130 Philosophy 98 Student counselling service 11 Within PPES 99 Student entertainment and media 5 Philosophy, political science, economics and sociology (PPES) 99 Student societies 6 Physics and astrophysics 155 Students’ Union 6 Physiology 157 Subject requirements Physiotherapy 195 TSM 27 Plant sciences 158 Degree courses 29 Polish Ordinary degree and diploma courses 32
Further Information With Business studies 41 Within European studies 64 T Within Russian 109 TAP (Trinity Access Programmes) 12 Political science 101 Theatres 7 With Law 94 Theoretical physics 168 Within BESS 37 Transition year programmes 16 Within PPES 99 Trinity Publications 5 and Geography 102 Tutors 10 and History 75 Two-subject moderatorship Psychiatric nursing 186 Permitted combinations 36 Psychology 104 Subject requirements 27
R V Radiation therapy 196 Vaccinations 198 Restaurants and coffee shops 8 Russian With Business studies 41 W
Within European studies 64 World religions and theology 107 Within TSM 109 Z
Zoology 159
202 Alert list – 2013
New course TR030 Catholic theological studies Places: 15
Catholic theological studies is designed to provide students with knowledge of the Catholic theological, intellectual and cultural tradition and the critical issues that arise in the study of its origins, formative periods, and foundational documents. Students will be provided with the skills and ethical understanding to participate in current debates about the place of the Catholic intellectual tradition in a globalised world.
New course (introduced in 2012) Stage management and technical theatre (non-CAO) Places: 15
Admission requirements: This course is not part of the CAO application system. Entry is by interview. Applicants should prepare a portfolio highlighting their theatre experience to date. The final date for receipt of applications is 1 February 2013. Interviews will be held between February and April 2013.
This is a two-year Level 8 course that aims to equip students of exceptional talent with the skills necessary for a career as a stage manager and/or technical specialist in professional theatre and related industries through the development of skills, professional practices and creative approaches to theatre production.
New course titles Further Information TR032 ‘Engineering’ has been renamed ‘Integrated engineering’. TR038 ‘Engineering with management’ has been renamed ‘Integrated engineering with management’.
The two new course titles emphasise the integration of the (optional) fifth year, which may lead to a Masters degree (M.A.I.), see pages 126 and 138.
New course option TR032 ‘Integrated engineering’ – Biomedical engineering option
The Integrated engineering degree programme is based on two years of general engineering, followed by two years of specialisation, and an optional 5th year. Students may choose 1 of the 6 specialisations for their 3rd and 4th years, including the new option: Biomedical engineering. See page 129 for further details.
203 Important dates for applicants
1 December 2012 TCD Open Day.
20 January 2013 Closing date for registration for the HPAT-Ireland test for entry to Medicine.
20 January 2013 Final date for CAO online discounted application fee.
23 January 2013 DARE application clinic – for students with disabilities. See page 20.
1 February 2013 n Normal closing date for CAO. n Applications to restricted entry courses and applications from mature students must be made to the CAO by this date. n Closing date for submission of mature students supplementary application forms (for all full-time courses except Nursing or Midwifery). n Applications from non-EU students wishing to pursue a full degree should be submitted to the Admissions Office, Trinity College, Dublin 2, Ireland.
2 March 2013 Date of HPAT-Ireland test for entry to Medicine.
1 March 2013 n Closing date for applications to sit the University matriculation examination. n Applications from EU and non-EU students wishing to study as a visiting student for up to one academic year should be submitted online.
23 March 2013 Provisional date for Music and Music education entrance examination.
1 May 2013 n Late closing date for CAO. n Late applications to restricted entry courses will not be considered. n Late applications from mature students will not be considered. Further Information 31 May 2013 Closing date for receipt of applications for the Reid Entrance Exhibition.
1 July 2013 Closing date for submission of a ‘Change of Mind’ to CAO.
See www.tcd.ie/calendar/term-dates for Term Dates 2013-2014
204 View Trinity’s 2011 Open Day Videos
on
Nursing and Midwifery - Open Days 2011 Nursing and Midwifery - Undergraduate Open Days December 2011
WATCHED 2,172 views
SCIENCE “Overview of Science Courses” - Open Day 2011 A talk from SCIENCE “Overview of Science Courses” at the 2011 Open Day Videos on YouTube Undergraduate Open Day Dec 2011, Trinity College Dublin
WATCHED 78 views
Dentistry, Open Day 2011, Trinity College Dublin School of Dental Sciences, Open Day 2011, Trinity College Dublin
WATCHED 1,474 views
Computer Science and Statistics, Open Days 2011 Computer Science and Statistics at Trinity College Dublin, Open Days December 2011
WATCHED 638 views
Geology - Open Day 2011, Trinity College Dublin Geology - Undergraduate Open Days December 2011, Trinity College Dublin
WATCHED 390 views
www.youtube.com/trinitycollegedublin 205 Notes Notes
206 Notes Notes
207 Notes Notes
208 Welcome from the Provost
Our safe and friendly campus provides an ideal environment for studying, learning, relaxing and living. Located in the heart of Ireland’s capital city, it has state-of-the-art facilities such as a modern Sports Centre, the Science Gallery and the Trinity College Library, the largest research library in Ireland with almost 5 million books and over 70,000 journals.
Trinity has over 112 diverse and colourful societies and 50 sports clubs; the clubs and societies accept new members each year during ‘Orientation Week’ in September.
There are also opportunities to take a semester abroad while progressing in your course through Trinity College’s partnership agreements with leading universities in other countries.
I hope that you will consider joining us as a student at Trinity Employers worldwide hold Trinity graduates in high esteem. College Dublin. Trinity is recognised as Ireland’s top university.* The College has produced generations of outstanding We are well-known globally for the excellence of our courses graduates. Some of the most famous people in Irish history and the commitment of our staff. have been educated here: writers like Oscar Wilde and Samuel Beckett; scientists like William Rowan Hamilton and E.T.S. Trinity was founded in 1592 and is Ireland’s oldest university. Walton (the winner of the Nobel Prize for splitting the atom), Today the College has a vibrant cosmopolitan community of as well as two Irish presidents and many industry leaders. students representing every county in Ireland and some 122 nationalities. I hope you will consider Trinity as your first choice for undergraduate study for an exciting new journey that will open At Trinity you will learn from professors who are world leaders in your mind to new experiences, ways of thinking and friendships, their fields of study. You can chose from over 400 undergraduate many of which will last for a lifetime. degree courses across a range of disciplines in the Arts, Humanities, Engineering, Science, Business, Technology, Social Sciences, and Health Sciences. The Trinity curriculum is aimed at not just acquiring knowledge but at developing critical faculties of the human mind. Freedom of expression, willingness to engage in debate and express diverse points of view are valued and welcomed. Patrick Prendergast Provost Solid academic and pastoral support is provided throughout your time in the university. Each incoming student is assigned July 2012 a Tutor, a member of the academic staff, who is there to advise * Trinity College Dublin is ranked 1st in Ireland, and in 65th position in the top you and help if any personal problem arises. Our tutorial system 100 world universities and 21st position in the top European universities by is unique in Ireland. There is also a student-to-student mentoring the QS World University Rankings 2011. In the Times Higher Education World programme for first year students. We offer a wide range of high University Rankings, TCD is ranked 1st in Ireland, 117th in the top 200 world quality services to all students such as the Careers Advisory universities and 42nd in the top European universities. Service, the Health Centre and a Counselling Service. OPEN DAY 2012
Saturday 1st December 2012
The exciting and informative programme of events will include: n Course specific presentations n Individual stands for each course, where you can meet our academic staff and current students to obtain detailed course information UNDERGRADUATE PROSPECTUS n Demonstrations and laboratory tours n Presentations about student sports, societies and the Students’ Union n Specific sessions for mature students, access students, and parents n Campus tours and tours of College facilities, including the sports centre
Full details will be available at www.tcd.ie/Admissions/undergraduate in November. WE LOOK FORWARD TO MEETING YOU AT OUR OPEN DAY!
ONLINE INFORMATION
Courses: www.tcd.ie/courses Admissions: www.tcd.ie/Admissions/undergraduate 2013 CAO Points: www.tcd.ie/Admissions/undergraduate/requirements/entrypoints Copies of this publication are available Accommodation: www.tcd.ie/accommodation/StudentsandStaff/ free of charge from Students/TrinityHall Main TCD website: www.tcd.ie The Admissions Office Trinity College Virtual tour: www.tcd.ie/virtualtour Dublin 2, Ireland Student life: www.tcdlife.ie Telephone: +353 1 896 4444 Sports clubs: www.ducac.tcdlife.ie Fax: +353 1 872 2853 Sports facilities: www.tcd.ie/sport Email: [email protected] Student societies: www.trinitysocieties.ie Website: www.tcd.ie/admissions/undergraduate
www.facebook.com/trinitycollegedublin The Board of Trinity College is not bound www.youtube.com/trinitycollegedublin by errors in or omissions from this publication http://itunes.tcd.ie UNDERGRADUATE http://twitter.com/#!/tcddublin PROSPECTUS 2013