Rulebook 2020 La Carrera Panamericana RULE BOOK 2020
CONTENTS
I - EVENT AND DATE 05 VI - GENERAL OBLIGATIONS for Teams 14 II - INTRODUCTION 05 Article 8: Teams Suggestions 06 'H¿QLWLRQ 8.2 Minors 8.3 Licenses III - PROGRAM 2020 08 8.4 FEMADAC license coverage 15 Program & Activities 8.5 During the event 8.6 Changes of team members IV - ORGANIZATION & AUTHORITIES 10 8.7 Credential or identity cards Article 1: Organization Article 9: Entries and requirements 15 9.1 Entries Article 2: Endorsement of LCP 2020 11 9.2 Requirements 16 9.3 Competitors registered outside Mexico V - GENERAL CONDITIONS 11 9.4 Transportation and entry of cars into Mexico Article 3: Description of LCP 2020 9.5 Recommended custom brokers 17 3.1. Stages and types of sections Article 10: Starting order and Article 4: Eligibility of competing cars 11 Competition numbers 17 10.1 Groups and categories 10.2 Qualifying Stage 18 Article 5: Eligibility of the competitors 12 10.3 Starting order 5.1. Eligibility of the competitors 10.4 Competition numbers 5.2. Non-compliance 10.5 The absense of competititon numbers 5.3. Spare driver/co-driver &RQ¿UPDWLRQRIUHJLVWUDWLRQDQGDVVLJPHQW 2ႈFLDOFORWKLQJVSDUHGULYHUVFRGULYHUV of the numbers ,GHQWL¿FDWLRQRIWKHWHDP Article 6: Amendments and 12 on the competing car 19 supplements to the rules 6.1 Regulatory bulletins $UWLFOH 7UDႈFUHJXODWLRQV 6.2. Publication of bulletins 0RGL¿FDWLRQVWRWKH5XOH%RRk Article 12: Repairs 19 2ႈFLDODUHDV Article 7: Application and 12.2 External assistance interpretation of the Rule Book 13 12.3 Forbidden acts 20 7.1. Responsibility 7.2. Protests Article 13: Support Vehicles 20 'H¿QLWLRQV 13.1 Registration and insurance 7.4. The responsibility of the entrant 13.2 Circulation of the service vehicles 7.5. Judge-Steward of the Meeting 7.6. Penalties 13.3 During the Speed Sections 7.7. Use of the trademark "La Carrera Panamericana" Article 14: Advertising 21 7.8 Hotel Accommodations 14 14.1 Advertising and sponsors 14.2 Exclusion 14.3 Penalties
2 La Carrera Panamericana RULE BOOK 2020
CONTENTS
VII - ELIGIBILITY AND CATEGORIES 18.20 Authorizathion to take part in OF THE COMPETING CARS 22 La Carrera Panamericana 48 Article 15: Eligibility of the Article 19: Non-eligible competing cars cars Exclusions 48 Article 16: Categories 22 19.1 Turismo de Producción and Sport Menor 16.1 "Turismo de Producción" (#1 to #99) 23 19.2 Turismo Mayor and Sport Mayor 16.2 "Turismo Mayor" (#100 to #149) 25 19.3 Historic Cars Group 16.3 "Sport Menor" (#150 to #199) 29 &ODVVL¿FDWLRQLQWKH([KLELWLRQ&DWHJRU\ 16.4 "Sport Mayor" (#200 to #249) 30 19.5 Refund of the entry fee 16.5 "Original Panam" (#400 to #449) 31 16.6 "Historica A" (#250 to #279) 33 16.7 "Histórica A Plus" (#280 to #299) 35 VIII - SAFETY EQUIPMENT 49 +LVWyULFD% WR Article 20: Mandatory +LVWyULFD%3OXV WR safety equipment 16.10 "Histórica C" (#350 to #399) 38 20.1 Hood pins 16.11 "Historic Road/ Rally Racing Cars" 41 20.2 Fire extinguishers 16.12 "Exhibition Cars" (#450 to #499) 43 20.3 Roll-Cage 20.4 Arm protection elements 50 Article 17: Fuel 43 20.5 Safety belts 20.6 Seats 51 20.7 Electric equipment 52 $UWLFOH 0RGL¿FDWLRQVWRWKH 20.8 Mandatory emergency equipment competing cars 43 20.9 Helmets & Head and Neck Support Device 20.10 Clothing/ Overall 53 A) Panamerican Cars Group 20.11 Compliance 18.1 Fuel Tank 18.2 Suspension Article 21: Safety Recommendations 53 %RG\ZRUN 21.1 Ground clearance 18.4 Engine 44 21.2 Fog Lights 18.5 Radiators and oil coolers 21.3 Navigation equipment 18.6 Engine induction 7UDQVPLVVLRQDQGGLႇHUHQWLDO IX - RUNNING OF THE EVENT 54 18.8 Tires 18.9 Steering Article 22: Start 22.1 Starting order and intervals between cars 18.10 Shock absorbers 22.2 Passing Time Controls and lateness 55 %UDNHV 2ႈFLDOWLPH 18.12 Weight 22.4 Route 3HUPLWWHGPRGL¿FDWLRQV $XWKRUL]DWLRQRIWKHPRGL¿FDWLRQV Article 23: Controls -
General provisions 55 Original Panamerican Cars 45 23.1 Control signals 0RGL¿FDWLRQVSHUPLWHG 23.2 Signaling at the Time Controls $XWKRUL]DWLRQRIWKHPRGL¿FDWLRQV and Speed Sections 56 23.3 Control areas B) Historic Cars Group 46 23.4 Time within a control area 3HUPLWWHGPRGL¿FDWLRQV 23.5 Entrance to a control area $XWKRUL]DWLRQRIWKHPRGL¿FDWLRQV 23.6 Time cards and actual time recorded 23.7 Opening and closing of control post 57 D) Exhibition Cars 47 23.8 Instructions from the post marshals 3HUPLWWHGPRGL¿FDWLRQV ,GHQWL¿FDWLRQRIWKHSRVWPDUVKDOV 3 La Carrera Panamericana RULE BOOK 2020
INDEX
Article 24: "CH-P" Passage controls XI - PENALTIES AND REPRIMANDS 71 6WDUWDQG¿QLVKDUFKHVRIDVWDJHDQG Article 30: Summary of penalties Transit Sections) - and reprimands Delay / Abandonment 58 30.1 Penalties 24.1 Passage Controls "CH-P" 30.2 Warnings 76 24.2 Time Controls 24.3 Delay/ Abandonment 60 XII - PROTEST AND APPEALS 77 Article 31: Protest and appeals Article 25: Speed sections 61 31.1 The right to protest 'H¿QLWLRQ 31.2 Fee for protest 78 25.2 Required safety equipment 31.3 Additional expenses 25.3 Direction of the event 31.4 Unfounded protest 25.4 Start of a Speed Section 31.5 Inadmissible protest 79 25.5 Delay of a start 62 31.6 Rights of claimant 25.6 False start 5HTXHVWIRUFODUL¿FDWLRQRIUHVXOWV 25.7 End of a Speed Section 31.8 Appeals 25.8 Time not recorded 25.9 Time format 63 XIII - CLASSIFICATION AND TROPHIES 80 25.10 Assistance from third parties 25.11 Starting intervals $UWLFOH &ODVVL¿FDWLRQ 25.12 Interruption of a Speed Section 2YHUDOOFODVVL¿FDWLRQ 25.13 Not starting a Speed Section 32.2 Tie 25.14 Maximum time assigned to a Speed Section 32.3 Posting of results )LQDOFODVVL¿FDWLRQ 32.5 Provisional stage results Article 26: Parc fermé 64 5HTXHVWIRUFODUL¿FDWLRQDQGSURWHVWV 'H¿QLWLRQ 26.2 Rules for the "parc fermé" 26.3 Exceptions Article 33: Trophy presentation. award 26.4 Assistance from third parties dinners and Drivers meetings 81 26.5 "Parc ferméDW¿QDOVWDJH 33.1 Trophies presentation 26.6 Penalty 68 33.2 Overall trophies 33.3 Category trophies X - SCRUTINEERING 68 33.4 Awards per stage 33.5 Award dinners and drivers´ meetings Article 27: Requirements APPENDIX 1 - GLOSSARY 82 Article 28: Before the start and during the event. 28.1 Scrutineering APPENDIX 2 - SAFETY 84 28.2 Items checked during scrutineering 28.3 Safety equipment of the competitors APPENDIX 3 - Sequence of Control and the competing car 69 Signals and the "A" Control Blackboard 91 28.4 Additional checks 28.5 Marks and stickers on car APPENDIX 4 - Reference drawing 28.6 Fraud to build a new chassis 95 Article 29: Final control 70 29.1 Final "parc fermé" 29.2 Absense of marks or stickers 29.3 Final inspection of winning cars 29.4 Cost of dismantling car 29.5 Further inspection * Revised: May 8th, 2020 MGM 4 La Carrera Panamericana RULE BOOK 2020
I.- EVENT AND DATE
The Ministry of Tourism (SECTUR), the National km and will consist of 7 stages using paved roads, Sports and Physical Culture Commission starting in Oaxaca and passing through the cities (CONADE), the Mexican Organization of of Veracruz, Mexico City, Querétaro, Morelia, International Motorsports (OMDAI), Motorsports *XDQDMXDWR=DFDWHFDVWR¿QLVKLQ'XUDQJR Federation (FEMADAC), the National Rally Commission (CNRM) and the Rally Automobile Certain sections of the route will be closed to Club (RAC) are pleased to announce the regular transit to allow timed speed stages. The international historic car rally, La Carrera accumulated time will determine the starting order Panamericana 2020. of the following stage and the overall winner of La Carrera Panamericana 2020. The event will take place from October 16th - 22th, 2020. The route will cover approximately 3,000
II.- INTRODUCTION
These rules state the requirements to compete until 5:00 p.m. October 15th, 2020 and at the in La Carrera Panamericana 2020 and all other Drivers'´ Meeting on October 15th. related events. The awards delivery venues by stage will be These rules are valid for La Carrera Panamericana SXEOLVKHGGXULQJWKHHYHQWRQWKHRႈFLDOERDUGV DQG FDQ RQO\ EH PRGL¿HG WKURXJK GXO\ at the host hotel the day before the bulletin is numbered and dated bulletins authorized by the HႇHFWLYH Clerk of the Course, together with the Steward of the Meeting. The bulletins are published in (YHU\VLWXDWLRQQRWIRUHVHHQLQWKLV5XOH%RRNPXVW Spanish and English to ensure that all competitors be analyzed and resolved based on agreements DQGRႈFHUVDUHDZDUHRIWKHDGGLWLRQDOLQIRUPDWLRQ between the Clerk of the Course and the Steward DQGPRGL¿FDWLRQVWRWKLV5XOH%RRN of the Meeting. These agreements are not subject to appeal and the decision of the Steward of the The bulletins can be: 0HHWLQJZLOOEHGHHPHG¿QDO 1. Informative: about events or schedules. 2. Regulatory:DERXWPRGL¿FDWLRQVWRWKHUXOHV 7KLV5XOH%RRNDQGWKHEXOOHWLQVGHVFULEHGDERYH the route, or results. DUHSXEOLVKHGIRUWKHFRPSHWLWRUVDQGRႈFHUVRI the event in both, Spanish and English. In case In both cases, it is important that all competitors RI D FRQÀLFW LQ WKH LQWHUSUHWDWLRQ RI WKHVH UXOHV DQGRႈFHUVRIWKHHYHQWUHFHLYHDQGUHDGWKHVH and the information in the bulletins, the Spanish EXOOHWLQV ZKLFK ZLOO EH SXEOLVKHG RQ WKH RႈFLDO version will prevail. website https://lacarrerapanamericana.com. mx/competition-bulletins/ before the start and during the event.
In addition, from Tuesday, October 13th the EXOOHWLQV ZLOO EH SRVWHG RQ WKH RႈFLDO ERDUG located at the Registration Park in Oaxaca and 5 La Carrera Panamericana RULE BOOK 2020
SUGGESTIONS
IMPORTANT NOTES RELATED TO THE PROGRAM
1. **RECONNAISSANCE OF THE ROUTE: La Carrera Panamericana will be explained, The Organizing Committee has not planned and LQFOXGLQJGHWDLOVRIWKH5RXWH%RRNDQGLPSRUWDQW will not organize any sort of reconnaissance of recommendations that the competitors and their the speed stages. Any previous reconnaissance service team must know. It is mandatory for all has to be planned by the competitors on their co-drivers (navigators) to attend at least one of own time and at their own risk. these meetings. Not attending these meetings will cause a penalization of 30 seconds. 2. **REGISTRATION CARD OF COMPETITORS: It is mandatory to collect the 6. **INSTRUCTIONS FOR DRIVERS’ 5HJLVWUDWLRQ&DUGDW6WDWLRQ7KLVLVWKH¿UVW MEETING: VWHSRIWKHUHJLVWUDWLRQSURFHVVDQGWKH¿UVWRI In this meeting it will be explained to the drivers the obligatory checks. It must be signed and the manner that a Speed Section will be indicated stamped by each and all area representatives at Control "A" just before starting it; there so that at the end it may be exchanged at the will also be signs at the service controls. It is Permanent Secretariat for the authorization mandatory for all drivers to attend this meeting. sticker (OK) to participate in the event. Co-drivers are not permitted to attend. A driver not attending this meeting will be penalized with 3. **COMPULSORY OFFICIAL STICKERS 30 seconds. AND ADVERTISING: ,W LV PDQGDWRU\ WR SODFH WKH RႈFLDO VWLFNHUV RI 7. **GENERAL DRIVERS' MEETING: the sponsors on the competing car, as well as During this meeting, the list of admitted teams on all service or support cars of a team. The and the starting order will be published and both Organizing Committee will provide these. The competitors (driver and co-driver) must attend. absence of the compulsory advertising on the The absence of one of them will be penalized competing car, as well as on the service or with 30 seconds in accordance with Article support cars will incur a penalization, which may 33.5. After the meeting there will be a welcome OHDGWRWKHGLVTXDOL¿FDWLRQRIWKHSDUWLFLSDQWIURP cocktail party for all the participants. the event (Article 14). 8. **PRESS MEETING: 4. **MEDICAL EXAM: All the press representatives and drivers of the Each competitor must pass the medical exam media cars are requested to attend in order and obtain medical authorization to participate to receive recommendations and instructions in the event (this exam may take up to 20 about the route, hours, restrictions, etc. minutes). The competitor that does not have medical authorization will be excluded from the 9. **SUPPORT CARS' MEETING: event. All the people that will carry out service tasks on the competing cars, especially the drivers of 5. **CO-DRIVERS’ MEETINGS: the service or support vehicles are requested to In these meetings the manner to compete in attend this meeting to receive recommendations 6 La Carrera Panamericana RULE BOOK 2020 and instructions. If the service people do not 14. **CLOSING CEREMONY AND FINAL attend the competing car they serve will be TROPHY AWARD: penalized with 1 minute. 7KH ¿QDO UHVXOWV ZLOO EH DQQRXQFHG DW WKH closing ceremony that will take place in the city 10. **CEREMONIAL START: of Durango. All teams must be present at this On Thursday, October 15th, 2020 a ceremonial ceremony (at least one member of the team start will take place in downtown Oaxaca All must be present). Regardless of the reason, if a competing cars must attend, along with at least team is not present, it will lose its right to receive one of the team members on board. Failure to its corresponding trophy and also forfeit their attend will cause a penalization of 1 minute. right to protest and appeal.
11. *OFFICIAL PHOTO: 15. *"THE THREE MOST BEAUTIFUL CARS All competitors are requested to attend the AWARD: photo shoot according to the schedule set forth A trophy will be awarded to the three most beautiful in the program (at least one member of each cars of the event, according to the competitors' team shall attend). vote during the general drivers' meeting on Thursday October 10th 12. *QUALIFYING SECTION: Indications to get to the Qualifying Section Note: leaving from the Registration Park are found The activities marked with (**) in both the program in the Route book. This Qualifying Section and in the above notes are MANDATORY for is subject to the same rules as the rest of the the competitors, entrants and participants of the Speed Sections of the event. A bulletin will be event. Failure to comply will cause the team to be SHQDOL]HGLQFOXGLQJDSRVVLEOHGLVTXDOL¿FDWLRQ published previously, indicating the starting order by category and in progressive order The activities marked with (*) in both the program according to the race number of each car. This and in the above notes, are important but not Qualifying Section is NOT mandatory and the mandatory. WHDPVWKDWGRQRWDWWHQGZLOOEHFODVVL¿HGDWWKH sole discretion of the Clerk of the Course and the Steward of the Meeting.
13. **DRIVERS’ MEETINGS, PUBLICATION OF UNOFFICIAL RESULTS AND TROPHY AWARDING PER STAGE: A drivers’ meeting will take place at the end of HDFK VWDJH ZKHUH WKH XQRႈFLDO UHVXOWV ZLOO EH SXEOLVKHGRQWKHRႈFLDOERDUG7KHUHZLOOEHD daily trophy award ceremony at the end of each stage which shall take place at the location LQGLFDWHG LQ WKH 5RXWH %RRN ,W LV PDQGDWRU\ that at least one team member attends the daily drivers’ meeting. Not attending will cause a penalty of 30 seconds and the team will lose its right to receive its corresponding trophy.
7 La Carrera Panamericana RULE BOOK 2020
III PROGRAM 2020
1. March 20th: Closing date of registration at a vehicle personnel. discounted fee - Permanent Secretariat, Mexico g) DLVWULEXWLRQ RI WKH 5XOH %RRN DQG RႈFLDO City. bulletins. h) Registration of the support vehicles. 2. March 22th - June 19th: Registration at the i) VHUL¿FDWLRQDQGUHFHLSWRIFRSLHVRIWKHLQVXUDQFH standard fee - Permanent Secretariat, Mexico City. policies of the support vehicles. j) VHUL¿FDWLRQ DQG UHFHLSW RI FRSLHV RI WKH 3. July 27th to September 18th: Closing of motorsports license and valid regular driving registrations with overpayment - Permanent license from the competitors’ country of origin. Secretariat, Mexico City. k) DLVWULEXWLRQRIRႈFLDOVRXYHQLUVDQGFORWKLQJWR the competitors. 4. September 20th: Final registration closure - Permanent Secretariat, Mexico City. 6.2. Station #2. - OMDAI-FIA licenses (Mandatory): 5. October 1st to 15th: The bulletins will be a) Paperwork and hand out of documents required SXEOLVKHG FRQWLQXRXVO\ RQ WKH RႈFLDO ZHE VLWH to obtain the OMDAI-FIA license. https://lacarrerapanamericana.com.mx/ b) Resolution of any pending issues with the competition-bulletins/ OMDAI, if necessary.
6. The Permanent Secretariat will be installed at 6.3. Station #3. - FEMADAC licenses the Registration Park in Oaxaca from Tuesday , (Mandatory): October 13th onwards, according to the following a) Paperwork and hand out of documents required schedule: to obtain the Mexican Motorsports Federation (FEMADAC) license. Tuesday, October 13th b) Payment of the FEMADAC license. 9:30 - 14:30 / 16:00 to 18:30 c) Resolution of any pending issues with the Wednesday, October 14th FEMADAC, if necessary. 9:30 - 14:30 / 16:00 to 18:30 Thursday, October 15th 6.4. Station .#4. - Medical exam: 11:00 to 16:00 a) Medical exam.
6. The following activities will take place at the 6.5. Station #5. - Scrutineering: Registration Park in Oaxaca, according to the a) Safety inspection of the competing car. dates and schedule stated above: b) Technical inspection of the competing car. c) Inspection of the mandatory safety equipment 6.1. Station #1. - Administrative review: of the competitors. a) RHYLHZ RI GRFXPHQWV DQG FRQ¿UPDWLRQ RI d) These three inspections (a, b, and c), must be payment of the entry fee. completed and approved, but it is not mandatory b) Distribution of the Registration Card to the to carry them out at the same time. It is permitted competitors. that the inspection of the competing car is carried c) CRQ¿UPDWLRQRIKRWHOVIRUWKHHQWLUHHYHQW RXW¿UVWDQGWKHLQVSHFWLRQRIWKHFRPSHWLWRUVDQG d) Sign of the Release of Responsibility (waiver). their safety equipment can be carried out later e) DLVWULEXWLRQRIWKH5RXWH%RRNWRFRPSHWLWRUV WKDWGD\RURQDGLႇHUHQWGD\ f) DLVWULEXWLRQ RI WKH 5RXWH %RRN WR WKH VXSSRUW 8 La Carrera Panamericana RULE BOOK 2020 e)** IMPORTANT - The competition car must 8.7. 16:00 Closing of the Registration park. present all mandatory advertising properly set at 8.8. 19:00 – 20:00 Ceremonial Start. the end of the scrutiny. 9. 7KHIROORZLQJWDEOHVKRZVWKHVWDUWDQG¿QLVK 6.6. Station #6. - Distribution of the Stella stages' schedules. For further details of the route, GPStransponder, LCP transponder, and OK VHUYLFHVHWF 6HHWKH5RXWH%RRN VWLFNHUWR¿QLVKZLWKWKHUHJLVWUDWLRQSURFHVV a) A deposit will be requested to obtain the Note A The location of the drivers' meetings GPS equipment and the measurement of the DQGXQRႈFLDOUHVXOWVRIHDFKVWDJH WURSKLHVDUH chronometer (Stella GPS and Transponder LCP). delivered by stage), will be published in the Route a1) The deposit will be returned upon delivery %RRNDQGZLOOEHFRQ¿UPHGLQWKHRႈFLDOERDUGV of the corresponding equipment at the end of the race. In case of not concluding the race, the Note B 7KH RႈFLDO ¿QDO UHVXOWV SXEOLFDWLRQ DQG teams will be able to deliver the equipment during the delivery of the corresponding trophies will take the awards dinners and the amount in guarantee place in Durango on October 23th at a breakfast. will be returned 7KHORFDWLRQZLOOEHLQGLFDWHGLQWKH5RXWH%RRN
6.7. Conclusion of the procedure a) The team must return to Station 1 to present the Registration Card with all the required stamps (doctors, scrutiny, OMDAI-FIA and FEMADAC licenses) in order to comply with the administrative review to be exchanged for the OK sticker which authorizes the team to take part in the event. b) If the OK sticker mentioned above is not obtained, regardless of the reason, the team will be excluded from the event.
7. Wednesday, October 14th: 7.1. 13:00–14:00 Mandatory press meeting 7.2. 14:00–16:00 Mandatory co-drivers' meeting in Spanish. 7.3. 17:00–20:00 Mandatory co-drivers' meeting in English. 7.4. 20:00–20:45 Mandatory drivers' meeting (without co-drivers).
8. Thursday, October 15th: 8.1. 9:00 – 9:30 Formation for Qualifying Section. 8.2. 10:00 – 11:00 Start to qualifying section. 8.3. 11:45 – 13:10 Qualifying Section on the highway. 8.4. ± 2ႈFLDOSKRWR DWOHDVWRQH member of the team must attend). 8.5. 14:30 – 16:30 Press meeting 8.6. 15:00 – 17:30 Service meeting
9 La Carrera Panamericana RULE BOOK 2020
Schedule: Stages, Formation and Drivers' Meeting Formation at Approx. Drivers' meeting and Start of Stage Date the starting arch ¿QLVKRI XQRႈFLDOUHVXOWV Stage (mandatory) Stage (Note A) Qfy. October 15th 10:00 11:00 14:30 14:30 1 October 16th 08:00 09:00 15:30 20:30 2 October 17th 06:00 07:00 16:45 20:30 3 October 18th 07:00 08:00 16:10 20:30 4 October 19th 07:00 08:00 16:00 20:30 5 October 20th 08:00 09:00 16:00 Free night 6 October 21th 06:30 07:30 16:15 20:30 7 October 22th 06:00 07:00 17:20 1RWH%
IV.- ORGANIZATION AND AUTHORITIES
Article 1: Organization 6DIHW\2ႈFHU Fernando Flores &KLHI0HGLFDO2ႈFHU 'U$QD%HOHP*DUFtD 'H¿QLWLRQ a) The organizer of La Carrera Panamericana Accommodation and Special Events 2020 is Promostage, S.A. de C.V. and Hosting and Events: endorsed by the Rally Automóvil Club, A.C. Mónica Grossmann / Karen León b) The event is run in compliance with: Assistant: b.1) 7KH RႈFLDO 5XOH %RRN RI /D &DUUHUD %HDWUL]&RURQD Panamericana 2020 [email protected] b.2) The Sporting Code of the Mexican Motorsports Federation (FEMADAC) and the Media and authorization of photographers, rules of the Mexican Rally Commission (CNRM) production of books for equipment and as a reference. production houses (video) b.3) 7KHIHGHUDOWUDႈFUHJXODWLRQ IRUIHGHUDO Ana García KLJKZD\V DQG DSSOLFDEOH VWDWH V WUDႈF [email protected] regulation in Mexico. Permanent Secretariat 1.2. Organizing Committee Promostage, S.A. de C.V. Honorary President and Founder Av. Lindavista 312, Eduardo León Col. Lindavista CP 07300 México, DF, Technical Committee México Clerk of the Course: Carlos Cordero Timekeeping chief: Mariana Rivapalacio Tel: +52(55) 5586 6898 / +52(55) 5754 6052 Scrutineering: Ing. Víctor Pérez Vonage: (310) 860 6959 10 La Carrera Panamericana RULE BOOK 2020
E-mail $UWLFOH 'H¿QLWLRQDQG [email protected] [email protected] Endorsement of La Carrera Panamericana 2020 Website (Spanish version) The Rally Automóvil Club is the organizer of La https://lacarrerapanamericana.com.mx Carrera Panamericana 2020. The event does (English version) not count for any ranked championship and is https://lacarrerapanamericana.com.mx/home/ endorsed by the following sporting authorities:
1.3. Sporting Authorities 2.1. Sporting Authorities: President OMDAI-FIA a) Mexican Organization of International Ing. José Abed Rouanett Motorsports (OMDAI-FIA) President FEMADAC b) Mexican Sports Commission (CONADE) Lic. F. Alfonso Oros Trigueros c) Mexican Motorsports Federation President CNRM (FEMADAC) Lic. Ignacio Rodríguez Montiel d) National Rally Commission (CNRM) President Rally Automóvil Club Mr. Víctor Pérez Couto Stewards of the Meeting 1. Ing. Rafael Machado Zubillaga 7%$ V.- GENERAL CONDITIONS Article 3: Description of during seven days, each one called "stage" and HDFKVWDJHLVDVVLJQHGDQXPEHUWKDWLGHQWL¿HVLW La Carrera Panamericana 2020 from the others. Each stage (day) is divided into GLႇHUHQWVHFWLRQV The length of La Carrera Panamericana 2020 is 7KH VHFWLRQV DUH GH¿QHG LQ Appendix 1 approximately 3,000 Km, of which 585 km are (Glossary) DQGDUHFODVVL¿HGDVIROORZV Speed Sections, (subject to change). The Route a) Transit Section is divided into seven stages on the dates shown b) Service Section in the following table: c) Speed with Transit Section A summary of the sections that constitute each stage, as well as the details of the route and the points for Time Controls, passage controls, Article 4: Eligibility Speed Sections, etc. are indicated in the Route of competing cars %RRN ZKLFK LV WR EH SURYLGHG WR FRPSHWLWRUV The competing car must comply with the DQG RႈFHUV GXULQJ WKH UHJLVWUDWLRQ SURFHVV LQ requirements of Chapter VII (Eligibility and 2D[DFD ,Q DGGLWLRQ WKH 5RXWH %RRN FRQWDLQV categories of the competing cars) of this Rule additional important information about arriving at %RRNIRUWKHFDWHJRU\UHJLVWHUHG WKH GLႇHUHQW FLWLHV GULYHUV¶ PHHWLQJV DQG RWKHU events and meetings. The entry form is available online at https:// lacarrerapanamericana.com.mx/registration- 3.1. Stages and types of sections: sheet/ 7KLVIRUPPXVWEHGXO\¿OOHGWRGH¿QHWKH La Carrera Panamericana 2020 takes place eligibility of the competing car. 11 La Carrera Panamericana RULE BOOK 2020
Stage Date Start Finish Qualifying October 15th Oaxaca Oaxaca 1 October 16th Oaxaca Veracruz 2 October 17th Veracruz Mexico City 3 October 18th Mexico City Querétaro 4 October 18th Querétaro Morelia 5 October 19th Morelia Guanajuato 6 October 20th Guanajuato Zacatecas 7 October 21th Zacatecas Durango
Additionally, the competing cars must have requirements, as well as having all the required mandatory safety equipment in accordance with documents and his/her own safety equipment Chapter VIII (Safety equipment). (the equipment is not transferable between participants) as mentioned above and must have Failure to comply with this article and Chapters paid a fee of USD $750. Only one spare driver/ VII and VIII, will result in the exclusion of the co-driver for each car and team will be allowed. participant from the event. 2ႈFLDOFORWKLQJVSDUHGULYHUVFRGULYHUV If this spare driver/co-driver is registered before Article 5: Eligibility of the September 1st, then he/she will have the right competitors WR UHFHLYH RႈFLDO VRXYHQLUV DQG FORWKLQJ DV indicated in item 8.1.k) of Chapter III. If he/she is 5.1. Eligibility of the competitors registered after this date, he/she will not receive To be eligible, all competitors (drivers and co- the aforementioned items. drivers), must comply with the provisions stated in Chapter VI, Article 8. The drivers and co-drivers must attend scrutineering with their valid licenses Article 6: Amendments and (sporting license of their country of origin, the one supplements to the rules issued by OMDAI & FEMADAC and their regular drivers license of their country of origin), as well as 6.1 Regulatory bulletins with valid insurance policies for the entire event. The provisions of this Regulation may only be In addition, the teams must comply with the safety PRGL¿HGRUVXSSOHPHQWHGE\5HJXODWRU\%XOOHWLQV equipment described in Chapter VIII. dated, numbered and authorized by the Race Director and the Sports Commissioner. These will 5.2. Non-compliance be an integral part of the Regulation as soon as Failure to comply with this article will cause the they are published. participant to be excluded from the event without a refund of its registration fee. 6.2. Publication of bulletins 7KHVH EXOOHWLQV DUH SXEOLVKHG RQ WKH RႈFLDO 5.3. Spare driver / co-driver ERDUGV DQG RQ WKH RႈFLDO ZHEVLWH https:// If the team includes a spare driver/co-driver, then lacarrerapanamericana.com.mx/competition- he/she must be registered and must also attend bulletins/ and it is the obligation of the teams to scrutineering to comply with all the administrative obtain this information by any one of these means.
12 La Carrera Panamericana RULE BOOK 2020
In this way, the Organizing Committee ensures HDFKVWDJHXQWLOWKHODVWFRPSHWLQJFDU¿QLVKHV that all competitors have a good knowledge of the WKHVWDJHFURVVLQJWKH¿QLVKOLQHRIWKHVWDJH bulletins. 7.4. The responsibility of the entrant 0RGL¿FDWLRQVWRWKH5XOH%RRN The driver is responsible for the acts of all the The Organizing Committee reserves the right to members of his/her team (guests, press, support, PRGLI\ WKLV 5XOH %RRN LI GHHPHG QHFHVVDU\ IRU photographers and service), even when he/she is safety reasons, "force majeure" or by order of the not present when something happens. civil or military authorities, which can even cancel a) 7KH GULYHU LV UHVSRQVLEOH IRU DOO RႇHQVHV the event in case extraordinary circumstances committed by one or all members of his/her team, arise or by order of the authorities. as well as the vehicles used by them in their role as visitors, spectators or crew of the service or support vehicles. Article 7: Application and b) $OO FRPSHWLWRUV PXVW UHVSHFW WKLV 5XOH %RRN interpretation of the Rule Book at all times during the event, as well as the DSSOLFDEOH )HGHUDO DQG 6WDWH WUDႈF UHJXODWLRQ 7.1. Responsibility They also must follow the indications of the police The Clerk of the Course is in charge of the DQGHYHQW VRႈFLDOV HQIRUFHPHQWRIWKLV5XOH%RRNDQGLWVSURYLVLRQV during the entire event. Nevertheless, he must 7.5. Judge – Steward of the Meeting inform the Steward of the Meeting of any important Any incorrect, fraudulent or unsporting actions decision he has had to make during the event. carried out by a competitor or participant will be judged by the Steward of the Meeting, who has 7.2. Protests the right to impose reprimands or penalties which Any protest concerning the enforcement of the PD\ JR DV IDU DV WKH GLVTXDOL¿FDWLRQ IURP WKH 5XOH %RRN PXVW EH SURYLGHG LQ ZULWLQJ WR WKH event. Steward of the Meeting for deliberation and to take a decision jointly with the Clerk of the Course. 7.6. Penalties $OO SHQDOWLHV RXWOLQHG LQ WKLV 5XOH %RRN DUH 'H¿QLWLRQV indicated in terms of minutes and/or seconds and )RUWKHH[DFWLQWHUSUHWDWLRQRIWKH5XOH%RRNWKH each penalized second equals to one point. To IROORZLQJGH¿QLWLRQVDSSO\ help competitors and participants, a summary of a) "Competitor" - means the driver or co-driver the penalties and reprimands are found in Chapter indistinctly. XI, Article 30. b) "Entrant" or "Participant" - means individuals (the driver, the co-driver, engineers, mechanics, 7.7. Use of the trademark "La Carrera service personnel, support personnel, team Panamericana" manager or the owner of the competing car; as The use of the logo, design, graphics and trademark well as guests, relatives and sponsors), or all of of "La Carrera Panamericana" and/or "La Carrera them collectively Panamericana 2020" is reserved exclusively for c) "Team" - used for both driver and co-driver. WKHLGHQWL¿FDWLRQRIFRPSHWLQJFDUVVHUYLFHDQG d) "Event" - means all the activities of La Carrera support vehicles, uniforms of the competitors and Panamericana 2020, including the competition RႈFHUVDGYHUWLVLQJRIWKHPDLQVSRQVRUVDQGLQ itself. RWKHUSODFHVVSHFL¿FDOO\DXWKRUL]HGLQZULWLQJE\ e) "Competition" / "rally" / "race" - is used for the the Organizing Committee and at the discretion of sporting activities of the event; from the time the the promoter. ¿UVWFRPSHWLQJFDUDUULYHVDWWKHIRUPDWLRQDUHDRI 13 La Carrera Panamericana RULE BOOK 2020
The commercial or promotional use of the route and extra nights in Oaxaca and Durango logo, design, graphics or brand of "La Carrera will be handled directly through the organizing Panamericana" and/or "La Carrera Panamericana Committee. The allocation of hotels will be 2020" in any manner, including, but not limited according to the order of the payment date of to electronic, written, taped (audio or video), or the registration and reservation of the rooms. Internet, or otherwise, requires a duly signed Accommodations are in 5-star hotels, however authorization from the promoter. Failure to premium hotels are also available at extra costs comply with the aforementioned will result in a with limited availability. penalization that may go as far as the exclusion/ GLVTXDOL¿FDWLRQ RI WKH SHUVRQ RU WHDP IURP WKH Request your hotel reservations at: event by the Clerk of the Course, upon request [email protected] from the Honorary President of the Organizing Committee. The promoter can also exercise his The deadline for reservations and hotel rights in accordance with the applicable law, as payment is September 20th, 2020. There are stated in "Annex A" herein. no refunds or room transfers for any reason LQFOXGLQJQRW¿QLVKLQJWKHHYHQW 7.8. Hotel Accommodations Reservations for additional rooms during the
VI. - GENERAL OBLIGATIONS for Teams
Article 8: Teams 8.3. Licenses a) It is mandatory for all drivers and co-drivers, 'H¿QLWLRQ including spare drivers/co-drivers to hold a sports a) The teams are made up of two people that license issued by: must be duly registered with the roles of Driver OMDAI-FIA (free registration) DQG &RGULYHU FOHDUO\ LGHQWL¿HG WR EH DOORZHG WR FEMADAC (Mexican Motorsports Federation), start each stage. which costs MXN $4,700.00, (Four thousand and b) All members of a team (driver / co-driver) may seven hundred, Mexican pesos), approximately. drive during the event, except if they are younger b) It is recommended that the driver and co- than 18 years old. driver request it through the FEMADAC’s website: http://ww2.femadac.org.mx/tramites/ 8.2. Minors licencia-deportiva or to get it at the Registration a) Competitors under 18 years old are considered Park during the administrative checks where a minors and must have written consent from both representative of the FEMADAC will be present. parents allowing them to compete. c) It is mandatory that all competitors show their b) Minors must comply with all competitor's regular driving license and sports license from requirements, including their own sports license their country of origin, which must be valid for the issued by the FEMADAC. duration of the event and issued by a recognized c) Authorized competitors under 18 years old can sporting entity in their country of origin. only compete as co-drivers and cannot drive the d) Not having any of the required licenses will vehicle in any of the sections. If a minor is reported cause the participant's exclusion from the event as having driven in any section, the team will be without the right to receive any refund of any kind. GLVTXDOL¿HGLPPHGLDWHO\IURPWKHHYHQW
14 La Carrera Panamericana RULE BOOK 2020
8.4. FEMADAC license coverage driver / co-driver is not registered; the team will be a) Accident insurance which covers medical GLVTXDOL¿HGIURPWKHVWDJHLQZKLFKWKHLQIUDFWLRQ expenses up to MXN $100,000.00, (One hundred occurred. thousand Mexican pesos) and accidental death insurance of MXN $120,000.00, (One hundred 8.7. Credential or identity card and twenty thousand Mexican pesos). a) During the administrative checks, the Organizing b) There is a deductible fee of MXN $1,000 (one Committee will provide competitors with a thousand Mexican pesos) per person per event, "CREDENTIAL ID" with their recent photograph which must be paid by the competitor and is not (previously provided by the competitor) that must recoverable. be kept in the car during the entire event. c) To recover the rest of the expenses related to b) This "CREDENTIAL ID" must be shown upon the accident, it is necessary that all receipts and WKHUHTXHVWRIDQ\RႈFHU invoices are addressed to the injured competitor. If c) Lack of this "CREDENTIAL ID" or if it does not a third party is involved, the receipts and invoices match the team members on board, will result in must be addressed to the driver. In addition, the WKHGLVTXDOL¿FDWLRQRIWKHFDUIURPWKHVWDJH receipts and invoices must have a breakdown of WKH 9$7 9DOXH$GGHG 7D[ IRU ¿VFDO GHGXFWLRQ Article 9: Entries and requirements purposes. If the receipts and invoices do not comply with these requirements, the expenses 9.1. Entries will not be refunded. No entry will be accepted if it is not totally paid. No down payments or reservations will be accepted. 8.5. During the event The complete team (driver / co-driver) must be In case a spare driver or co-driver is a member of on board of the competing car throughout the the team, this competitor must pay the additional duration of the rally, except for cases provided IHHGH¿QHGE\WKH2UJDQL]LQJ&RPPLWWHH $UWLFOH IRULQWKLV5XOH%RRN,IRQHPHPEHURIWKHWHDP 5.3). retires from the event or if a third party is admitted on board, the team will be immediately excluded The entry fee includes: from the event. a) One double room from October 15th to October 22th (8 nights). The hotels will be assigned based 8.6. Changes of team members on the date of payment of the entry fee and on the a) Any change of driver/co-driver for a new team criteria of the Organizing Committee. member may be done for a previously registered b) Mexican general liability insurance valid for FRPSHWLWRUVSHFL¿FDOO\IRUWKDWFDU7KLVPXVWEH the seven days of the competition. A copy of the QRWL¿HGLQZULWLQJWRWKH&OHUNRIWKH&RXUVHDQG policy will be available for all entrants. to the Steward of the Meeting at least 10 hours before the substitution takes place, even in cases VERY IMPORTANT! of "force majeure". If the competitor has not been The insurance policy is not valid for any accident registered, he/she must go before the Steward that occurs before or after the stage; it is only valid of the Meeting requesting his/her admission in once the driver has passed the starting line and writing, (Articles 5 and 10.6). The deadline for XQWLOKHVKHFURVVHVWKH¿QLVKOLQHIRUWKDWVWDJH this procedure is at 23:00 of the day before the Therefore, each competitor is responsible for intended substitution. FRPSO\LQJ ZLWK DOO WKH WUDႈF UHJXODWLRQ UHVSHFW b) If the change of a registered driver/co-driver WKH WUDႈF OLJKWV DQG VWRS VLJQV HYHQ LI SROLFH LVQRWQRWL¿HGWRWKH&OHUNRIWKH&RXUVHDQGWR RႈFHUVJLYHWKHULJKWRIZD\WRFRPSHWLWRUV the Steward of the Meeting and/or the substitute
15 La Carrera Panamericana RULE BOOK 2020
The Organizing Committee of La Carrera IMPORTANT NOTE: The competing cars and Panamericana 2018 is not responsible for any the service or support vehicles must all have accident occurring in any of the cities where the necessary valid insurance so that the car competitors spend the night or where the event can be authorized to compete (after passing passes through. In case of an accident during scrutineering), in accordance with Chapter X, the competition, the damages caused by the Article 28.2.d.3. competitor will be covered by this insurance; but the competitor must pay the deductible of 10% of 9.3. Competitors registered outside Mexico the cost of the accident. (Restrictions apply) Competitors registered outside Mexico must send a copy of their proof of payment to the Permanent 9.2. Requirements Secretariat of La Carrera Panamericana. The entry application will only be received WKURXJKWKHRQOLQHIRUPIRXQGDWWKHRႈFLDOZHE To import the competing car, it is necessary that site: https://lacarrerapanamericana.com.mx/ the Mexican Motorsports Federation (FEMADAC) registration-sheet/ issues a letter requesting the customs authorities to grant the Temporary Import Permit for all the To be accepted into the race, the team must vehicles participating in the event. Competitors comply with the following: must send their license form and their Temporary ,PSRUW3HUPLWGLUHFWO\WRWKH)(0$'$&RႈFHV a) Complete payment of the entry fee for the even though the payment of the license will be driver/co-driver, as well as for the spare driver/co- made at the Registration Park in Oaxaca before driver, given the case (Article 5.3). the event. b) Provide the following high-resolution For all matters related to the Mexican Motorsports photographs: one of the competing car, two of the Federation (FEMADAC), please contact: driver, two of the co-driver and two of the spare driver/co-driver, if any; before September 23, FEMADAC 2018. Goethe 40, Esq. Darwin, c) The technical and safety form of the competing Col. Anzures, C.P. 11590, CDMX, México FDU FRPSOHWHO\ ¿OOHG RXW EHIRUH 6HSWHPEHU 7KLVIRUPLVDYDLODEOHRQWKHRႈFLDOZHEVLWH Website: http://www.femadac.org.mx The Organizing Committee reserves the right to accept or refuse any requested entry. Tels.: d) The Organizing Committee reserves the right |+52(55) 5254 0084 to admit or reject any registration. +52(55) 5254 0011 e) No cancellations, fee transfers or future +52(55) 5254 0157 applications for other years will be accepted after Fax: +52(55) 5254 0447 July 22, 2020; nor will the entry fee or the payment for the hotels be refunded. Any refund will be at 9.4. Transportation and entry of cars into the sole discretion of the Organizing Committee. Mexico f) The service or support vehicle must also It is the responsibility of the competitors to ensure have valid liability insurance during the entire that their cars arrive on time to the Registration event, which must be valid in Mexican territory. Park in Oaxaca to comply with the scheduled The team must show this insurance during the activities. administrative check to complete the registration process. If the customs broker recommended by the Organizing Committee is used (with no responsibility for the Organizing Committee), 16 La Carrera Panamericana RULE BOOK 2020 then it is recommended that the cars coming from CargoLive the United States and Canada cross the border Att.: Lic. Claudia Fernandez between September 28th and October 9th, 2020. Website: http://www.cargolive.com.mx/ 3OHDVHFRQVLGHUWKDWFXVWRPVRႈFHLQ0H[LFRDUH E-Mail: [email protected] closed on weekends. Office: +52 (55) 15602976 Mobile: +52 (55) 4984 0758 Cars coming from Europe and Asia can enter Mexico by ship at the port of Veracruz, Veracruz IMPORTANT NOTE: Competing foreign teams (Gulf of Mexico) or from the Salina Cruz, Oaxaca must have a valid Temporary Import Permit for VHDSRUW 3DFL¿F 2FHDQ DQG WKHQ EH GHOLYHUHG their car for the duration of the event to Querétaro. The cars entering the country by airfreight can arrive at the airports of Mexico City or Toluca, State of Mexico. Article 10: Starting order and Competition numbers All foreign competitors must send to the Permanent Secretariat a copy of their entry form, as well as 10.1. Groups and categories the required technical and safety forms, including &RPSHWLQJFDUVDUHFODVVL¿HGLQWR*URXSVDQG copies of the documents that show the ownership 0 Categories. of the car. These are necessary to ensure proper &DUVWKDWGRQRW¿WLQWRWKH¿UVWWKUHHFDWHJRULHVEXW support for all required customs procedures and have been accepted by the Organizing Committee permits, for the temporary import of international and have completed their registration process competing cars and service and support vehicles. and payment, can only take part in the Exhibition Cars category without the right to a trophy and will The documents (copies) that prove the ownership EHH[FOXGHGIURPWKHJHQHUDOFODVVL¿FDWLRQ of the competing car and service or support vehicles, must also be sent to the FEMADAC to The competition numbers must match the issue the support letters required by the customs assigned category in accordance with the authorities. IROORZLQJFODVVL¿FDWLRQ
The original documents that prove ownership A. Panamerican Cars Group must be shown when clearing customs. 1. "Turismo de Producción" #2 to #99 2. "Turismo Mayor" #100 to #149 9.5. Recommended customs brokers 3. "Sport Menor" #150 to #199 The competitors are free to select their preferred 4. "Sport Mayor" #200 to #249 customs broker. The Organizing Committee 5. "Original Panam" #400 to #450 recommends the following customs brokers, which can assist competitors in Veracruz, Salina B. Historic Cars Group Cruz and at the international airports of Mexico 6. "Histórica A" #250 to #279 City and Toluca: 7. "Histórica A Plus" #280 to #299 +LVWyULFD%WR FIMASA +LVWyULFD%3OXVWR Attn. Lic. Elias Rojas 10. "Histórica C" #350 to #399 Website: https://www.fimasa.com/?lang=en 11 "Historic Road /Rally Racing Cars E-mail: [email protected] Tels.: (55) 5660-9054 / (55) 5660-9072 C. Exhibition Cars Fax: (55) 5551-3142 10. Category for cars non-eligible in any of the competing categories #451 to #499 17 La Carrera Panamericana RULE BOOK 2020
10.2. Qualifying Stage 10.4. Competition numbers On Thursday, October 15th there will be a The Organizing Committee will provide the Qualifying Stage that will not be scored for the competition numbers for each team. The JHQHUDOFODVVL¿FDWLRQ7KLVVHFWLRQZLOORQO\VHUYH FRPSHWLWLRQQXPEHUVPXVWEH¿[HGRQERWKVLGHV WRGHWHUPLQHWKHVWDUWLQJRUGHUIRUWKH¿UVWVWDJH of the car, on the rear and on the front of the car for This stage is subject to the same rules as all other the entire event. It is an obligation for the teams to Speed Sections, except that the starting order will make sure that they are always visible. be according to the order the teams arrive at the "CH" Control at the starting line within the time 10.5. The absence of competition numbers indicated in the program and in accordance with If at any time during the development of the event the instructions of the control marshal. it is observed that:
To take part in this Qualifying Stage, the team a) One of the side numbers is missing, a penalty must have all the required safety elements such of 30 seconds will be imposed for each stage as the roll cage, helmets, etc. in accordance with where the missing number was detected. If the Chapter VIII as well as the OK sticker on the car. number on the rear is missing, the penalty will be Considering that this Qualifying Stage is optional, 10 seconds. WKHWHDPVWKDWGRQRWWDNHSDUWZLOOEHFODVVL¿HG b) The car is missing both sides' numbers, the by category and subject to the criteria of the Clerk FDUZLOOEHGLVTXDOL¿HGIURPWKHVWDJHZKHUHWKH of the Course and the Steward of the Meeting. incident was detected. )RU WKLV UHDVRQ WKH VWDUWLQJ RUGHU RI WKH ¿UVW stage may be changed, taking into account that 7RDSSO\WKHVHSHQDOWLHVDUHSRUWIURPWKHRႈFHU for safety reasons it may be convenient that the of the event will be enough. IDVWHUFDUVVWDUW¿UVW &RQ¿UPDWLRQRIUHJLVWUDWLRQDQG 10.3. Starting order assignment of the numbers The starting order for each stage will remain 7R FRQ¿UP HQWU\ DQG WKH DVVLJQPHQW RI WKH unchanged during the entire stage, except if competition number, the procedure is as follows: the Clerk of the Course and the Steward of the Meeting decided to change the order for safety a) When the entry form and the technical reasons. description of the competing car, along with the required photos, are received in accordance with From the second stage onwards, the starting Article 15, the Organizing Committee will verify order will be determined in accordance with the that the car corresponds to the selected category results of the Speed Sections from the previous and if the requested competition number is still stage, regardless of the groups or categories. available, (it may have been assigned to another team); if not, then a new number will be assigned. The competing cars will start at intervals of 30 seconds. b) If the competing car is not registered in the correct category or, if during scrutineering the At the end of the last speed section of the last GHVFULSWLRQ RႇHUHG E\ WKH FRPSHWLWRU GRHV QRW VWDJHWKH¿UVWFODVVL¿HGFUHZVWKDWEHORQJWR match the category, the Organizing Committee will the Panamerican Cars Group will be formed and assign the car to a new category and an available ZLOO UHPDLQ XQFKDQJHG XQWLO WKH\ FURVV WKH ¿QDO competition number for the correct category will goal arc. be issued.
18 La Carrera Panamericana RULE BOOK 2020 c) ,IWKHFDUGRHVQRW¿WLQWRDQ\FDWHJRU\RIWKH road user. The police have the authority to competition, the car will not be allowed to start the withhold the documents of the car and/or driver of event. If the Clerk of the Course and the Steward WKHRႇHQGHURUWRDUUHVWKLPKHUDQGWDNHKLPKHU of the Meeting allow the participation of a non- before the corresponding authorities. HOLJLEOH FDU LW ZLOO EH FODVVL¿HG LQ WKH ([KLELWLRQ Category, which is not scored for the event, and Any team or their service or support vehicle that ZLOOUHFHLYHQHLWKHUWURSKLHVQRURႈFLDOUHFRJQLWLRQ GRHVQRWFRPSO\ZLWKWKHWUDႈFUHJXODWLRQVZLOOEH The entrant must agree with this decision. subject to penalties at the sole discretion of the Steward of the Meeting. These may range from d) 7KH 2UJDQL]LQJ &RPPLWWHH ZLOO FRQ¿UP E\ DPLQLPXPRIVHFRQGVWRWKHGLVTXDOL¿FDWLRQ e-mail the competition number requested by the from the event, depending on the nature of the competitor or the one assigned. fault. The procedure is as follows: e) The registered spare driver/co-driver must a) ,IDQRႈFHURIWKHHYHQW¿QGVDWHDPRUVHUYLFH comply with all rules in Article 5. YHKLFOHEUHDNLQJDWUDႈFUHJXODWLRQKHPXVWQRWLI\ the Clerk of the Course. ,GHQWL¿FDWLRQRIWKHWHDPRQWKH b) (YHQLIWKHSROLFHGHFLGHQRWWRVWRSWKHRႇHQGLQJ competing car driver, but ask the Organizing Committee to apply A sticker with the names, blood type and allergies reprimands, the penalties mentioned above will of the driver, co-driver and the spare driver/co- be applied. driver (if any) must be visible on both sides of the c) 7KH &OHUN RI WKH &RXUVH PXVW EH QRWL¿HG LQ car. If at any time during the event, a competitor ZULWLQJDQGEHIRUHWKHXQRႈFLDOUHVXOWVRIWKHGD\ is substituted by a spare competitor who has have been posted. not been registered, he/she will not be allowed d) The report must include a detailed description to drive until he/she complies with the provisions of the incident and must include the facts, the outlined in Articles 5 and 8 and his/her medical identity established beyond any reasonable doubt, information is visible on the outside of the car. as well as the place and time of the incident. e) 7KHUHSRUWRIWKHRႈFHULVHQRXJKWRDSSO\WKH If the team fails to show the name, blood type, penalties. and allergies on the car, the team will receive a warning, it the failure is repeated then a penalty Article 12: Repairs of one minute will be applied. This penalty will be applied each time that the infraction is repeated. 2ႈFLDODUHDV 5HSDLUVZLOORQO\EHDOORZHGLQWKHRႈFLDOVHUYLFH If the car arrives at scrutineering before the event areas or at the end of each stage. Repairs can without the names, blood type and allergies, the also take place during the Transit Sections, team will not be able to start until the situation has provided that they are not performed in a control been corrected. area or "parc fermé" 7KH RႈFLDO VHUYLFH DUHDV DUHLQGLFDWHGLQWKH5RXWH%RRN $UWLFOH 7UDႈFUHJXODWLRQV $Q\ RႇHQVH ZLOO EH SHQDOL]HG ZLWK PLQXWHV D Throughout the event, the teams and their service UHSRUWE\DQRႈFHUZLOOEHVXႈFLHQWWRDSSO\WKH RU VXSSRUW YHKLFOHV PXVW VWULFWO\ REH\ DOO WUDႈF penalty. regulations, especially in the cities and towns ZKHUHWKHHYHQWVWDUWVDQG¿QLVKHV7KHSROLFH 12.2. External assistance having noted the infringement, must inform the Throughout the entire event, the competing car RႇHQGHULQWKHVDPHZD\DVKHZRXOGDQRUPDO must circulate by its own means; from the start to 19 La Carrera Panamericana RULE BOOK 2020
the end of each stage. checks. If the team insists on not registering or If a competing car is towed, pushed or transported identifying their vehicle after an initial warning, by another vehicle or receives help from a third then the team will be penalized with 3 minutes in party, it will be penalized, unless instructed by an each stage that the service or support vehicle is RႈFHURIWKHHYHQWWRUHWXUQWKHFDUWRWKHURDGRU QRWGXO\UHJLVWHUHGRULGHQWL¿HG to clear the road to allow unrestricted circulation of b) It is mandatory for the service or support other vehicles in a Speed Section, (Article 25.10). vehicles to have a valid general liability insurance policy that covers third parties for the duration of The minimum penalty for breaking this rule will be the event. A copy of the policy must be presented the application of the maximum sanction for that during the administrative checks to register and section, which is the maximum time assigned to identify the vehicle. If the service vehicle does not the Speed Section + 1 minute in the Time Control have a valid insurance policy they will be excluded at the start and end of that section. It will also be from the event. up to the Steward of the Meeting whether the FDU LV GLVTXDOL¿HG IURP WKH VWDJH RU HYHQ IURP 13.2. Circulation of the service vehicles the event; depending on the nature of the fault, The service or support vehicles must precede the (especially if it is a recurring fault). pace cars or follow the sweeper car and the entire WDLOFRQWLQJHQW RႈFLDODQGRႇWKHEDFNYHKLFOHV 12.3. Forbidden acts a) Deliberately block the free passage of other Any service or support vehicle that is not registered competing cars or not allow them to overtake in a RUGRHVQ¶WKDYHWKHRႈFLDOLGHQWL¿FDWLRQVWLFNHUV Speed Section when caught by another car. and is found to be circulating on the route while the b) %HKDYLQJLQDQXQVSRUWVPDQOLNHPDQQHURUWR UDOO\LVWDNLQJSODFHZLOOFDXVHWKHGLVTXDOL¿FDWLRQ LQVXOW RWKHU FRPSHWLWRUV RU RႈFHUV RU DQ\ RWKHU of the team from that stage. person who is participating in the event or to GDPDJHDQ\IDFLOLW\RUWRWDNHSDUWLQD¿JKWGXULQJ If the service or support vehicle overtakes the the event. sweeper car without the authorization from the c) If the team or the crew performs any of the driver of the sweeper car, this will cause the SURKLELWHG DFWLRQV WKH\ ZLOO EH GLVTXDOL¿HG IURP GLVTXDOL¿FDWLRQ IURP WKH VWDJH RI WKH WHDP WKH\ the event at the sole discretion of the Race are servicing or supporting. Director and the Event Sports Commissioner. $UHSRUWIURPDQRႈFHURIWKHHYHQWLVHQRXJKWR Article 13: Support Vehicles be subject to the penalties.
13.1. Registration and insurance 13.3. During the Speed Sections a) The service or support vehicles of a team will It is strictly forbidden for the service or support be registered at the same time as the competitor vehicles to circulate during the Speed Sections during the administrative checks. This registration while the teams are in competition. Their team is mandatory. The front doors of the car and UXQVWKHULVNRIEHLQJGLVTXDOL¿HGIURPWKHVWDJH a space in the rear must be reserved for the competition number of the car they are servicing. The service or support vehicles that enter a 2QO\ UHJLVWHUHG DQG SURSHUO\ LGHQWL¿HG VHUYLFH Speed Section before the roads are closed must YHKLFOHV ZLOO KDYH DFFHVV WR WKH RႈFLDO VHUYLFH IROORZWKHLQVWUXFWLRQVRIWKHRႈFLDOSDFHFDUVDQG areas. Vehicles that fail to be properly registered park in an absolutely safe place, away from the DQGLGHQWL¿HGZLOOEHSHQDOL]HGZLWKPLQXWH route and where they do not block nor confuse The service vehicle must be insured and the the competitors. insurance policy shown during the administrative At the end of the Speed Section the service or
20 La Carrera Panamericana RULE BOOK 2020 support vehicles cannot be moved until the b.6) The use of caps of own sponsors during the sweeper car and the entire tail contingent has DUFVRIH[LWDQG¿QLVKOLQHLVVWULFWO\SURKLELWHG passed. WKH RႈFLDO FDS RI WKH HYHQW SURYLGHG E\ WKH organizing committee shall be used. The penalty for violating the provisions of this SDUDJUDSKZLOOEHWKHGLVTXDOL¿FDWLRQRIWKHFDU 14.2. Exclusion of the entire stage in which the case is presented, Any competitor who comes to the scrutiny LIWKHWHDPRULWVPHPEHUVDUHUHSHDWRႇHQGHUV without complying with the mandatory advertising WKHFUHZZLOOEHGLVTXDOL¿HGIURPWKHHQWLUHHYHQW requirements, especially in relation to the SODFHPHQWRIRႈFLDOVWLFNHUVLQWKHSODFHVRIWKH $UHSRUWIURPDQRႈFHURIWKHHYHQWLVHQRXJKWR car intended for it, will receive a verbal notice from apply the penalty. the scrutineer or the Race Director.
Article 14: Advertising 14.3. Penalties The team is responsible for the presence, proper 14.1. Advertising and sponsors placement and visibility of the compulsory a) The Organizing Committee reserves the advertising on the competing car. If the stickers right to use certain areas of the competing car are missing, they are not placed correctly or are IRU WKH RႈFLDO FRPSHWLWLRQ QXPEHUV DQG IRU WKH not easily visible to the public; the team will be advertising of the main sponsors of the event. The penalized with 30 seconds in each of the stages stickers will be provided to the competitors during ZKHUHWKLVRFFXUV$UHSRUWIURPDQRႈFHURIWKH the administrative checks. These areas are: event is enough to apply the penalty. a.1) Front doors a.2) Upper part of the windshield If this fault persists, the penalty may be increased a.3) Fenders DOO WKH ZD\ XS WR SRVVLEOH GLVTXDOL¿FDWLRQ IURP the event upon request from the Clerk of the b) Considering the above, competitors are Course. The Steward of the Meeting will make DOORZHGWRDႈ[WKHLURZQVSRQVRU¶VDGYHUWLVLQJWR this decision. their cars, provided that they do not: b.1) ,QYDGH WKH DUHDV UHVHUYHG IRU RႈFLDO stickers. b.2) Interfere with the vision of the driver and co-driver. b.3) &DXVHDFRQÀLFWZLWKWKHVSRQVRUVRIWKH event. In that case, only a maximum of 2 areas of 21 square centimeters (7cm x 3cm) for the stickers of the team’s sponsors will be allowed. b.4) 7KH PDLQ RႈFLDO VSRQVRU RI /D &DUUHUD Panamericana 2018 must be respected, without exception and no rival brands or services will be accepted. b.5) 2ႈFLDO HQWLWLHV VXFK DV WKH 6HFUHWDU\ RI Tourism, the Mexican Motorsports Federation (FEMADAC), the National Rally Commission (CNRM) or the Rally Automobile Club (LAC), ZLOOSURYLGHWKHVWLFNHUVWKDWPXVWEHDႈ[HGWR competing cars. 21 La Carrera Panamericana RULE BOOK 2020
VII. - ELIGIBILITY AND CATEGORIES OF THE COMPETING CARS
Article 15: Eligibility of the Organizing Committee with a complete technical description of the car that includes pictures in competing cars order to evaluate the request. If the car complies with the requirements, it may be accepted into A) Panamerican Cars Group that category. The Organizing Committee may Sports, GT, and production touring cars (sedans) VXJJHVWVRPHPRGL¿FDWLRQVIRUWKHFDUEHHOLJLEOH from 1940 to 1954 are eligible for this category. if it initially does not meet the requirements. Some models of these cars that were built after 1954 will be accepted into the category if they C) Exhibition Cars are essentially the same in terms of technical All cars that have been accepted but do not components and/or aesthetics. correspond to any of the previous groups or categories mentioned above belong in this Competitors who wish to register a competition category. car built after 1954 in the categories of "Turismo de Producción", "Turismo Mayor", "Sport Menor" 7KHWHFKQLFDOVSHFL¿FDWLRQVDQGSKRWRJUDSKVRI and "Sport Mayor" must provide the Organizing the competing cars in all groups and categories Committee along with its registration and the must be submitted to the Organizing Committee Technical Card and Security, a complete technical by July 19, 2020, along with the entry form and description with photographs of the competition the technical and safety forms. The Steward of the car for evaluation and determine if it meets the Meeting who will make a decision regarding the requirements to be accepted. The Organizing category of a car will evaluate these applications. Committee can make recommendations so that the car meets all the requirements and is eligible. "Street Rod" or "Hot Rod" type cars prepared from those built in 1932 or later are also eligible, as are B) Historic Cars Group the "replicas" of prototypes from the era or cars Sports, GT, and production touring cars (sedans), built in 1932 to 1956. from 1955 to 1973 are eligible for the "Histórica A" and "Histórica C" cars categories. Cars built from 1955 to 1974 are eligible for the "Histórica Article 16: Categories % FDWHJRU\ 6RPH PRGHOV RI WKHVH FDUV WKDW were built after 1965, will be accepted if they This article details the technical features and are essentially the same in terms of technical requirements that shall be met by the competing components and/or aesthetics. cars.
In the "Histórica A Plus" category, cars from For scrutineering, protests, revisions and 1965 to 1975 are allowed. To register a car in sanctions, the information contained in this article this category, it is necessary for the Organizing is deemed the valid reference, therefore these Committee to approve the entry. Competitors requirements must be followed and observed who wish to register a car that was built after for the entire event. Failure to comply with the 1965 in the "Histórica A","Histórica C" categories; provisions stated in this article will result in the or after 1973 in the "Histórica A Plus", "Histórica exclusion of the team from the event. % DQG FDUV EXLOW IURP WR IRU WKH +LVWyULFD % 3OXV FDWHJRULHV PXVW SURYLGH WKH
22 La Carrera Panamericana RULE BOOK 2020
A) Panamerican Cars Group must be "rigid". The bases that can be installed for the coil springs of the suspension may allow 16.1. "Turismo de Producción" the installation of a device to manually set the (Numbers from #1 to #99) height of the car. Cockpit operated or remote Production cars (sedans) from 1940 to 1954 control systems to change the ride height of the with original bodywork and F.H./O.H.V. with V8 suspension are not allowed. cylinder engines or F.H./O.H.V. and S.O.H.C. inline 6-cylinder and O.H.V./O.H.C. D.O.H.C. Tubular frames or chassis are strictly 4-cylinder. The engines must be of the same forbidden. PDNHRUIDPLO\DQGFRQ¿JXUHGOLNHWKHRULJLQDO All chassis are subject to the approval of a) Construction: the Organizing Committee; therefore it is The original chassis or the main frame of the recommended that any related questions be sent car is mandatory (if it has not been damaged with anticipation to the Organizing Committee by corrosion, oxidation, welding or is cracked) of La Carrera Panamericana along with any or a similar one of the same make or family or a drawings and comments. In case the chassis is new one recently manufactured by a specialized not approved, the competitor will be informed in company (e.g. Art Morrison Company - Appendix DGYDQFH WR DYRLG EHLQJ GLVTXDOL¿HG GXULQJ WKH LQDFFRUGDQFHZLWKWKHIROORZLQJVSHFL¿FDWLRQV scrutineering before the event. The decision of WKH6WHZDUGRIWKH0HHWLQJZLOOEH¿QDO The distance between the side members, measured transversally to the car must be the The bodywork of the car must be original, but if same as the original design, without changes. WKHUH DUH VRPH FRPSRQHQWV WKDW DUH GLႈFXOW WR The front area of the chassis, from the imaginary ¿QGWKH2UJDQL]LQJ&RPPLWWHHPXVWEHQRWL¿HG OLQHRIWKH¿UHZDOORIWKHFDUWRWKHIURQWPD\EH in advance in order to approve the substitution of PRGL¿HGLQRUGHUWRLQWHJUDWHWKHUROOFDJHDVZHOO any of the pieces. If this approval is not obtained as to provide greater rigidity to the whole. The beforehand, the car may be excluded from the joint points or support of the A-arms or arms of event during scrutineering. the suspension and the shock absorbers may be relocated without restriction. b) Engines: )RU WKRVH FDUV ZLWK KDUG WR ¿QG HQJLQHV LW The bases of the springs of the suspension may LV DXWKRUL]HG WR XVH HQJLQHV IURP GLႇHUHQW EHPRGL¿HGWRDOORZDGHYLFHWRPDQXDOO\VHWWKH manufacturers, but they must have the same height of the car. Cockpit operated or remote FRQ¿JXUDWLRQDQGQXPEHURIF\OLQGHUV control systems to change the ride height of the suspension are not allowed. For O.H.V. with 8 cylinders engines in V FRQ¿JXUDWLRQWKHXVHRILURQKHDGVLVPDQGDWRU\ For the rear of the chassis, from the imaginary It is not allowed to use engines of limited production line of the back of the back seat; the team is or of a special racing design. allowed to modify and/or relocate the joint points A maximum of 8" (20.3 cm) of inline relocation of or support of the rear suspension so that the leaf engines and drive-lines from their original position springs can be replaced by coil springs. on American sedan cars will be allowed.
$OOPRGL¿FDWLRQVQHHGHGWRLQWHJUDWHWKHUROOFDJH Displacement and carburetion for cars equipped to the chassis are allowed. The team is free to with engines of: modify the location of the mounting points of the b1. 4 cylinders up to 2000 cc (122 cubic inches) movement control arms of the rear axle, which and 2 carburetors with two barrels each. 23 La Carrera Panamericana RULE BOOK 2020
b2. For Volkswagens, 2 carburetors with 2 If a team presents a car without any of the barrels. aforementioned devices, the team will be excluded b3. 6 cylinders up to 5,000 cc (305 cubic from the event. inches), three carburetors with two barrels or one 4 barrel carburetor of maximum 600 c.f.m. All competitors must hand in to the Permanent b4. 8 cylinders up to 5,000 cc (305 cubic Secretariat, all technical and safety forms, the inches), one carburetor with four barrels of VSHFL¿FDWLRQV RI WKH LJQLWLRQ PRGXOHV WKH 530 maximum 600 c.f.m. limiter and the size and diameter of the tires, in order to select the module that will be installed c) Transmission: during scrutineering. The use of 5-speed transmissions in all cars is allowed, except in the case of eligible cars To verify that the competing cars comply with the equipped with O.H.V. V8 engines, which will be technical requirements regarding speed limit, limited to a 4-speed transmission. the teams may be subject to random revisions both during and at the end of the event by the In order to limit the top speed of the cars, the scrutineers. following table must be taken into account; for the rear axle ratio in relation to the tire's size and the %HORZ DUH WKH VSHFL¿FDWLRQV RI WKH SRZHU WUDLQ revolutions per minute (RPMs). ZKLFKGH¿QHVWKH530OLPLWRIWKHHQJLQHDQGWKH top speed of the car: It is mandatory for all cars that the top gear (4th or 5th) has a 1:1 ratio. d) Tires and wheels: d1. The diameter of the wheels must be the The table shows increments of 200 RPM. This is original or one inch greater, limited to 16 inches. compatible with some of the computer chips of the d2. The maximum rim width on 4 cylinder cars MSD systems or the adjustment knobs or buttons is 6". of the MSD systems or equivalent. d3. The maximum rim width on 6 and 8 cylinder cars is 8". It is obligatory that the teams use MSD ignition d4. The treadwear cannot be lower than 40 control modules, (or from any other manufacturer), DQGPXVWFRPSO\ZLWKWKH'27FHUWL¿FDWLRQ that control the RPMs of an engine. The MSD 6A, d5. The height of the tires (aspect ratio) must be 6AL, 6ALN, SFI-5520, AL-2 ignition controls can 50 or higher (no lower number will be allowed). be used (or from any other manufacturer). e) Other components: The ignition control module will be inspected and e1. Disk brakes on the four wheels are permitted sealed during scrutineering. If during the event a and they may be vented. team wishes to change the size of their rear tires e2. Headers are permitted on all cars. or the relationship of the gears of the rear axle, e3. The steering system is free of restrictions they must inform the Technical Director in order in order to improve the safety of the driver and WRKDYHWKH530OLPLWVUHFHUWL¿HGDQGUHVHDOHG driving precision.
Any ignition control system can be used as long f) Weight: as it includes an RPM limiter. The minimum total weight shall be as follows (with If a car does not use an ignition module with RPM a tolerance of 5% less): limiter, then any other RPM limiter can be used, f1. Volkswagen: 1,800 lb (817 kg) (e.g. Mallory – Part No. 644L) or equivalent. f2. Alfa Romeo T.I.: 2,400 lb (1,089 kg) f3. Chevrolet: 3,200 lb (1,452 kg) 24 La Carrera Panamericana RULE BOOK 2020
f4. Ford and Mercury: 3,310 lb (1,502 kg) 16.2. "Turismo Mayor" f5. Volvo: 2,115 lb (960 kg) (Numbers from #100 to #149) For all other eligible cars, the originally listed All production sedans (saloons) from 1940 to weight must be considered. 1954 with original bodywork and inline D.O.H.C. 6 cylinders and O.H.V. V8 cylinder engines, as well :LWKRXWH[FHSWLRQDOOFDUVDQGWKHLUPRGL¿FDWLRQV as all O.H.C. / D.O.H.C. 4 cylinder engines. are subject to the approval of the Organizing Committee. Please send the technical and safety a) Construction: forms to the Permanent Secretariat to review the The original chassis or the main frame of the car's eligibility. car is mandatory (if it has not been damaged by corrosion, oxidation, welding or is cracked) or similar of the same make or family; or a new one recently manufactured by a specialized company
Ratios of Turismo Producción
Rear axle ratio 3.50:1 3.70:1 Diameter of the tire Size of the tire RPM kph mph RPM kph mph (inches) 255/50-16 26.2 6600 232 144 7000 233 145 225/50-16 24.5 6800 230 143 7200 232 144 225/60-16 26.6 6400 228 142 6800 228 142 245/50-15 24.8 7000 233 145 7400 233 145 225/50-15 23.8 7200 230 143 7600 230 143 255/60-15 27.1 6200 232 144 6800 233 145 235/60-15 26.1 6600 232 144 7000 230 143 215/60-15 25.2 6800 230 143 7200 230 143
Rear axle ratio 3.00:1 3.25:1 Diameter of the tire Size of the tire RPM kph mph RPM kph mph (inches) 255/50-16 26.2 5600 230 143 6000 228 142 225/50-16 24.5 5800 230 143 6400 233 145 225/60-16 26.6 5600 232 144 6000 230 143 245/50-15 24.8 6000 233 145 6400 230 143 225/50-15 23.8 6200 232 144 6800 230 143 255/60-15 27.1 5400 228 142 5800 227 141 235/60-15 26.1 5600 228 142 6200 233 145 215/60-15 25.2 5800 228 142 6400 233 145 25 La Carrera Panamericana RULE BOOK 2020
(e.g. Art Morrison Company from the US, see DGYDQFH WR DYRLG EHLQJ GLVTXDOL¿HG GXULQJ WKH Appendix 4) in accordance with the following scrutineering before the event. The decision of VSHFL¿FDWLRQV WKH6WHZDUGRIWKH0HHWLQJZLOOEH¿QDO
The distance between the side members, The bodywork of the car must be original, but if measured transversally to the car must be the WKHUH DUH VRPH FRPSRQHQWV WKDW DUH GLႈFXOW WR same as the original design, without any changes. ¿QGWKH2UJDQL]LQJ&RPPLWWHHPXVWEHQRWL¿HG The front area of the chassis, from the imaginary in advance in order to approve the substitution of OLQHRIWKH¿UHZDOORIWKHFDUWRWKHIURQWPD\EH any of the pieces. If this approval is not obtained PRGL¿HG LQ RUGHU WR LQWHJUDWH LW WR WKH UROO FDJH beforehand, the car may be excluded from the and to give it more rigidity as a whole. The joint event during the scrutineering. points or support of the A-arms support or arms of the suspension and the shock absorbers may be b) Engine: relocated without restriction. The use of modern engines of the same PDQXIDFWXUHUIDPLO\ DQG FRQ¿JXUDWLRQ DUH The bases of the springs of the suspension may permitted; with displacement up to 5000 cc. (305 EHPRGL¿HGWRDOORZDGHYLFHWRPDQXDOO\VHWWKH cubic inches) for 6 cylinder engines and 6,000 cc. height of the car. Cockpit operated or remote (366 cubic inches) for 8 cylinder engines with a V control systems to change the ride height of the FRQ¿JXUDWLRQDQGFF FXELFLQFKHV suspension are not permitted. for 4 cylinder engines.
For the rear of the chassis, from the imaginary Aluminum cylinder heads are allowed. line of the back of the back seat; the team is permitted to modify and/or relocate the joint points A maximum of 8" (20.3 cm.) of inline relocation of or support of the rear suspension so that the leaf engines and drive-lines from their original position springs can be replaced by coil springs. on American sedan cars will be permitted.
$OVRDOOPRGL¿FDWLRQVQHHGHGWRLQWHJUDWHWKHUROO Dry-sump engines are not permitted. cage to the chassis are permitted. The team is free to modify the location of the mounting points The authorized carburetion depends on the of the movement control arms of the rear axle, number of cylinders of the engine, in accordance which must be "rigid". The bases that can be with the following: installed for the coil springs of the suspension may b1. One carburetor (maximum 600 c.f.m.) allow the installation of a device to manually set with 4 barrels for 8 cylinder engines with V the height of the car. Cockpit operated or remote FRQ¿JXUDWLRQ control systems to change the ride height of the b2. Three carburetors with 2 barrels for inline 6 suspension are not permitted. cylinder engines. b3. Two carburetors with 2 barrels for 4 cylinder The use of space-frame (tubular) chassis is engines. categorically forbidden. All chassis are subject to the approval of the Organizing Committee; therefore c) Transmission: it is recommended that any related questions be 0RGHUQ WUDQVPLVVLRQV DQG GLႇHUHQWLDOV DUH sent with anticipation to the Organizing Committee permitted. The use of any type of transmission is of La Carrera Panamericana along with any permitted, with a maximum of a 5-speed automatic drawings and comments. In case the chassis is transmission. not approved the competitor will be informed in
26 La Carrera Panamericana RULE BOOK 2020
In order to limit the top speed of the cars, the %HORZ DUH WKH VSHFL¿FDWLRQV RI WKH SRZHU WUDLQ following table must be followed; showing the ZKLFKGH¿QHVWKH530OLPLWRIWKHHQJLQHDQGWKH rear axle ratio in relation with the tire size and the top speed of the car: revolutions per minute (RPMs) of the engine. d) Tires and wheels: It is mandatory for all cars that the top gear (4th or d1. The material and construction of the wheels 5th) has a 1:1 ratio. are free d2. The maximum diameter of the wheels is 18 The table is set in increments of 200 RPM. This is inches. , allowing the use of 15, 16 and 17 in. compatible with some of the computer chips of the diameter wheels MSD system that will be used during the event. d3. The maximum width of the wheels is LQFKHV 7KH RႇVHW DQG EDFN VSDFLQJ It is mandatory that the teams use MSD ignition dimensions are free control modules, (or from any other manufacturer), d4. The tires rubber compound, “Tread wear” that control the RPMs of an engine. The MSD 6A, factor, must not be below “40”. Tires must be 6AL, 6ALN, SFI-5520, AL-2 ignition controls can '27FHUWL¿HG be used (or from any other manufacturer). d5. The “Aspect Ratio” of the tires must not be below “ 40 “ The ignition control module will be inspected d6. The permitted tire sizes are shown on and sealed during scrutineering. In the case the attached chart “Maximum Speed Limit”. that during the event a team wishes to change The tires must be installed according to the the size of their rear tires or the relationship of VSHFL¿HGULPZLGWKE\WKH7LUH 5LP%RRN the gears of the rear axle, they must inform the Technical Director in order to have the RPM limits e) Other components: UHFHUWL¿HGDQGUHVHDOHG e1. Disk brakes on the four wheels are permitted and they may be vented. Any ignition control system can be used as long e2. Headers are permitted on all cars. as it limits the RPMs of an engine, (e.g. Mallory – Part No. 644L). f) Weight: A tolerance of minus 5% of the minimum total If a team presents a car without any of the above- weight is permitted. mentioned devices, the team will be excluded from the event. The minimum weight must be 3,300 lb (1,497 kg) All competitors must hand in to the Permanent for all 6 and 8 cylinder cars. For eligible cars with Secretariat, the technical and safety forms, the 4 cylinders, the minimum weight should be the VSHFL¿FDWLRQV RI WKH LJQLWLRQ PRGXOHV WKH 530 original weight of the car. limiter and the size and diameter of the tires, in order to select the module that will be installed :LWKRXWH[FHSWLRQDOOFDUVDQGWKHLUPRGL¿FDWLRQV during scrutineering. are subject to the approval of the Organizing Committee. Please send the technical and safety To verify that the competing cars comply with the forms to the Permanent Secretariat to review the technical requirements regarding the speed limit car's eligibility. of the cars, the teams may be subject to random revisions both during and at the end of the event by the scrutineers.
27 La Carrera Panamericana RULE BOOK 2020
Ratios of Turismo Mayor
28 La Carrera Panamericana RULE BOOK 2020
16.3. "Sport Menor" A maximum of 6" (15.24 cm.) of inline relocation of (Numbers from #150 to #199) the engine from its original position is permitted. All mass and limited production sports cars, The teams are free to use up to 2 carburetors prototypes and/or reproductions from 1940 to with 2 barrels each. Fuel injection systems are 1954 or similar, which have been authorized by not allowed. the Organizing Committee (Article 15) with original bodywork and/or of the same material and with c) Transmission: the original or bored out engine up to 2,000 cc. Transmissions with 5-speed gearboxes are (122 cubic inches) for mass production cars. allowed. a) Construction: d) Tires and wheels: The original chassis is mandatory; but if necessary, d1. The maximum rim diameter must be 15". a similar one can be used as long as it is from the d2. The maximum rim width for all cars is 6". same family of cars. The Director of Scrutineering d3. The treadwear cannot be lower than 40. or an inspector designated by the Organizing DQGPXVWFRPSO\ZLWKWKH'27FHUWL¿FDWLRQ. Committee must analyze the non-original d4. The height of the tires (aspect ratio) must be chassis. If it is not approved, the competitor will 50 or higher (no lower number will be permitted). EHLQIRUPHGEHIRUHKDQGWRDYRLGGLVTXDOL¿FDWLRQ during scrutineering before the start. The decision For cars equipped with 15" rims, the tires must RIWKH6WHZDUGRIWKH0HHWLQJZLOOEH¿QDO PHHW WKH VSHFL¿FDWLRQV RI WKH PDQXIDFWXUHU IRU installation on 6" wide rims, according to the table The bodywork of the car must be original, but if for 15" tires. It is forbidden to use tires designed WKHUH DUH VRPH FRPSRQHQWV WKDW DUH GLႈFXOW WR for 6.5" rims. ¿QGWKH2UJDQL]LQJ&RPPLWWHHPXVWEHQRWL¿HG in advance in order to approve the substitution e) Other components: of any pieces. If this approval is not obtained e1. Disc brakes on the four wheels are permitted beforehand, the car may be excluded from the and may be vented. event during scrutineering. e2. Headers are permitted on all cars. A fully independent rear suspension is permitted. e3. The steering system is free of restrictions For Porsche 356 cars, the competitor is permitted in order to improve the safety for the driver and to move the arms of the suspension in order to precision when driving. install a 5-speed gearbox. f) Weight: b) Engine: The minimum weight (5% less is tolerable) is:. In this category and in all cases, the use of a f1. Alfa Romeo: 1,998 lb (907 kg) modern 4 cylinder engine of mass production f2. MGA: 1,995 lb (905 kg) ZLWKWKHVDPHFRQ¿JXUDWLRQDVWKHRULJLQDOHQJLQH f3. Porsche: 3561,985 lb (901 kg) of that particular car (inline or boxer) with a f4. For all other eligible cars, the originally listed maximum displacement of 1,600 cc., 4 valves per weight must be considered. cylinder and double overhead cams (D.O.H.C.) is permitted. :LWKRXWH[FHSWLRQDOOFDUVDQGWKHLUPRGL¿FDWLRQV are subject to the approval of the Organizing Any limited production or prototype car of the Committee. Please send the technical and safety era must keep its mechanical characteristics. forms to the Permanent Secretariat to review the However, an increment of 15% over its original car's eligibility. 1954 displacement is permitted.
29 La Carrera Panamericana RULE BOOK 2020
16.4. "Sport Mayor" In case the original carburetor of any V8 type (Numbers from #200 to #249) engine needs to be replaced, it is permitted to use All mass and limited production sports cars, a carburetor with four barrels with a maximum prototypes and/or reproductions from 1940 to limit of 600 c.f.m. 1954 or similar, which have been authorized No fuel injection system is permitted, unless the by the Organizing Committee (Article 15) with model of the car had been originally manufactured original bodywork and/or of the same material. with it. The engine must be the original or from the same family; larger than 2000 cc (122 cubic inches) and c) Transmission: bored up to 5,000 cc, (305 cubic inches), unless Transmissions with a maximum of 5-speed the original size is larger. manual or automatic gearboxes are permitted. In order to limit the top speed of the cars, the a) Construction: following table must be followed; showing the The original chassis is mandatory; but if necessary, rear axle ratio in relation with the tire size and the a similar one can be used as long as it is from the revolutions per minute (RPMs) of the engine. same family of cars. The Director of Scrutineering It is mandatory for all cars that the top gear (4th or or an inspector designated by the Organizing 5th) has a 1:1 ratio. Committee must analyze the non-original chassis. The table is set in increments of 200 RPM. This If it is not approved, the competitor will be informed is compatible with some of the computer chips EHIRUHKDQG WR DYRLG GLVTXDOL¿FDWLRQ GXULQJ WKH of the MSD system that will be used during the scrutineering before the start of the event and competition. the decision of the Steward of the Meeting will be It is mandatory that the teams use MSD "6AL" and ¿QDO "6AL-2" and ignition control modules, and that the The rear suspension must be original, without any "chip" is already installed on the car according to PRGL¿FDWLRQ WKH VSHFL¿FDWLRQV IURP WKH PDQXIDFWXUHU HYHQ The bodywork of the car must be original, but if though the "chips" that will be used in the event WKHUH DUH VRPH FRPSRQHQWV WKDW DUH GLႈFXOW WR will be installed and sealed during scrutineering. ¿QGWKH2UJDQL]LQJ&RPPLWWHHPXVWEHQRWL¿HG In case that an MSD system is not installed in the in advance in order to approve the substitution car, then it is mandatory to have a Mallory RPM of any pieces. If this approval is not obtained limiter (Mallory – Part No. 644L), installed, beforehand, the car may be excluded from the If a car arrives to scrutineering without an MSD event during scrutineering. ignition module or Mallory RPM limiter installed, it will be excluded from the event. b) Engine: All competitors must hand in to the Permanent In this category and in all cases, the use of a Secretariat, the technical and safety forms, the modern mass-produced inline 6 cylinder engine VSHFL¿FDWLRQV RI WKH LJQLWLRQ PRGXOHV WKH 530 with a maximum displacement of 3,000 cubic limiter and the size and diameter of the tires, to centimeters (183 cubic inches) four valves per select the module that will be installed during cylinder and double overhead cams (D.O.H.C.), scrutineering. is permitted. To verify that the competing cars comply with the Any limited production or prototype car of the technical requirements regarding the speed limit era must keep its mechanical characteristics. of the cars, the teams may be subject to random However, an increment of 15% over its original revisions both during and at the end of the event 1954 displacement is permitted. by the scrutineers. For sports cars, the admission must be with the %HORZ DUH WKH VSHFL¿FDWLRQV RI WKH SRZHU WUDLQ original system. The use of a maximum of three ZKLFKGH¿QHVWKH530OLPLWRIWKHHQJLQHDQGWKH carburetors with two barrels each is permitted in top speed of the car: cars of this category that use a modern engine.
30 La Carrera Panamericana RULE BOOK 2020 d) Tires and wheels: panels or the wheel openings. All glass panels d1. The maximum rim diameter is 15". and windshield must be made from the original d2. The maximum rim width for all cars is 6". material with allowance for the use of modern d3. The treadwear cannot be lower than 40. shatterproof tempered glass on the side and back DQGPXVWFRPSO\ZLWKWKH'27FHUWL¿FDWLRQ windows. The windshield must be made from d4. The height of the tires (aspect ratio) is 50 shatterproof glass or the original three-layer type. or higher (no lower number will be permitted). b) Chassis: e) Other components: The car must have the original frame. It is e1. Disc brakes on the four wheels are permitted permitted that the frame of the car is reinforced at and may be vented. the weakest points or to strengthen sections that e2. Headers are permitted on all cars. have been repaired. e3. The steering system is free of restrictions in order to improve the safety for the driver and c) Suspension: precision when driving. The front and rear suspension must maintain the original design concept; this means that the f) Weight: leaf springs cannot be replaced by a coil springs A tolerance of 5% less of the minimum total weight system and the front "A" arms must be the is permitted. original arms or a replacement that maintains the For all other eligible cars, the originally listed original geometry. It is permitted to replace the weight must be considered. front spindles with a "ball and joint type" design instead of the original "kingpin type", along with :LWKRXWH[FHSWLRQDOOFDUVDQGWKHLUPRGL¿FDWLRQV provisions to install disc brakes by replacing the are subject to the approval of the Organizing drum brakes. The work done to accept the new Committee. Please send the technical and safety spindles on the original "A" arms must maintain forms to the Permanent Secretariat to review the the original suspension geometry. The use of any car's eligibility. shock absorber is permitted, providing that it is installed on the original mounting points. 16.5. "Original Panam" (Numbers from #400 to #449) d) Rear axle: This category groups the cars that are the same It is permitted to replace the solid rear axle with make, model and year of those that participated in a stronger one, like a Ford 9.0" or 8.8", GM 10 the original "Carrera Panamericana" from 1950 to or 12 bolt, Chrysler 9.25, etc. The gear ratio is 1954. The appearance of the car must be as close free of restrictions as well as the type of shafts as possible to the original with a certain allowance and hubs used. The use of a limited slip or locker IRU WKH IROORZLQJ PRGL¿FDWLRQV WR LPSURYH WKH GLႇHUHQWLDO LV SHUPLWWHG 7KH RULJLQDO ÀDQJHWR VDIHW\DQGUHOLDELOLW\RIWKHFDUZLWKRXWDႇHFWLQJLWV ÀDQJH GLPHQVLRQV RI WKH D[OH KRXVLQJ PXVW EH original appearance. maintained to maintain the original tread width of the car. All cars that comply with the provisions in Appendix "K" and have an "FIA HTP" (Historic e) Brakes: Technical Passport) in the period "E" from 1950 to The use of disc brakes on the four wheels 1954 or similar will be accepted by the organizing replacing the original drum brakes is not only committee permitted, but also strongly recommended. The original hydraulic actuating system must be a) Body: replaced with a modern and safer "independent 7KH ERG\ PXVW QRW EH PRGL¿HG E\ RSHQLQJ IURQWDQGUHDUWXELQJDQGPDVWHUF\OLQGHU%UDNH scoops, vents, or enlarging the fenders, quarter balance adjustable valves can be used. 31 La Carrera Panamericana RULE BOOK 2020
Ratios of Sport Mayor Rear Axle Ratio 3.00:1 3.25:1 Diameter of the tire Size of the tire RPM KPH MPH RPM KPH MPH (Inches) 245/50-15 24.8 6000 233 145 6400 228 142 225/50-15 23.8 6200 230 143 6800 233 145 215/50-15 23.5 6200 228 142 6800 232 144 205/50-15 23.1 6400 232 144 7000 233 145 195/50-15 22.7 6600 233 145 7000 230 143 225/55-15 24.8 6000 233 145 6400 228 142 205/55-15 23.9 6200 232 144 6600 228 142 195/55-15 23.4 6400 233 145 6800 230 143 235/60-15 26.1 5600 228 142 6200 233 145 225/60-15 25.6 5800 232 144 6200 230 143 215/60-15 25.2 5800 228 142 6400 233 145 205/60-15 24.7 6000 232 144 6400 228 142 195/60-15 24.2 6000 227 141 6600 230 143
Rear Axle Ratio 3.50:1 3.70:1 Diameter of the tire Size of the tire RPM KPH MPH RPM KPH MPH (Inches) 245/50-15 24.8 7000 233 145 7400 233 145 225/50-15 23.8 7200 230 143 7600 230 143 215/50-15 23.5 7400 233 145 7800 233 145 205/50-15 23.1 7400 230 143 7800 228 142 195/50-15 22.7 7600 232 144 8000 230 143 225/55-15 24.8 7000 233 145 7400 233 145 205/55-15 23.9 7200 230 143 7600 230 143 195/55-15 23.4 7400 232 144 7800 232 144 235/60-15 26.1 6600 232 144 7000 232 144
Rear Axle Ratio 3.50:1 3.70:1 Diameter of the tire Size of the tire RPM KPH MPH RPM KPH MPH (Inches) 225/60-15 25.6 6800 233 145 7200 233 145 215/60-15 25.2 6800 230 143 7200 230 143 205/60-15 24.7 7000 232 144 7400 232 144 195/60-15 24.2 7200 233 145 7600 233 145
32 La Carrera Panamericana RULE BOOK 2020 f) Steering: k) Transmission: The replacement of the steering box with that of The cars originally equipped with automatic a similar type as the original is permitted as long transmissions or 3-speed manual transmissions as the original rods and geometry are maintained. are allowed to use a modern manual 4-speed A hydraulic power-assisted steering system can WUDQVPLVVLRQ SURYLGLQJ WKDW WKH ¿QDO JHDU UDWLR also be used. The use of a regular rack and pinion (fourth) is 1:1. If a 3-speed manual transmission steering system is not permitted. is used, the use of an "Overdrive" system, similar WRWKHRQHRႇHUHGRQWKHRULJLQDOFDULVSHUPLWWHG g) Wheels and Tires: The use of a straight gears transmission is The replacement of the original rims for steel rims forbidden. The location and type of the gear shift is permitted. The original rim size can only be are not restricted. replaced with 15" diameter rims with a maximum width of 7" on North American cars, while l) Weight: European cars can have rims up to 6" wide. It is Even though most of the cars in this class have Aluminum rims are not permitted. a total weight, which surpasses the original The use of modern tires, which are DOT approved, VSHFL¿FDWLRQV GXH WR WKH UROO FDJH DQG RWKHU must have a minimum aspect ratio of 50 (no PRGL¿FDWLRQVLQFOXGLQJWKHDGGLWLRQDOVDIHW\LWHPV lower number will be permitted). The minimum a car must have. treadwear must be greater than 60. The minimum weight of the car must not be OHVV WKDQ WKH VKLSSLQJ ZHLJKW VSHFL¿HG E\ WKH h) Engine: manufacturer for the particular type, model and The engine must be the original one or an engine of year of the car. the same family, type and exterior appearance. It is )RU DOO FKDQJHV RU PRGL¿FDWLRQV PDGH WR WKH permitted to increase the cubic inch displacement car within these regulations, the competitor to the larger displacement that exists within the must submit a request for approval, showing all same family of these engines. Aluminum heads the details and pertinent data to the La Carrera cannot replace the cast iron cylinder heads. Panamericana Technical Committee at least 90 Modern parts can replace the camshaft, intake days before the initial inspection prior to the race. manifold, carburetor and distributor, providing that WKH PD[LPXP FDUEXUHWRU ÀRZ GRHV QRW H[FHHG B) Historic Cars Group 600 c.f.m. It is permitted to use exhaust headers to replace the original manifolds. The exhaust 16.6. "Histórica A" tubing lengths and diameter have no restriction. (Numbers from #250 to #279) All mass production and limited production cars i) Engine cooling system: built from 1955 to 1973 and more recent models It is permitted to modify the engine cooling system aesthetically and mechanically similar to those by using a larger radiator and/or one made of 1973, which have been previously authorized IURP GLႇHUHQW PDWHULDO7KH ZDWHU SXPS FDQ EH by the Organizing Committee regardless of their replaced with one of greater volume. The fan can country of origin. The cars that are included in be replaced with a fan clutch and/or an electric "Appendix K" of the international F.I.A. sporting fan. It is permitted to use an engine oil cooler. code, which are equipped with original 4 cylinder engines and original bodywork are eligible for this j) Fuel system: category. The fuel tank can be replaced only by a safe fuel cell no larger than 83lt. (22 gallons). It permitted to use electric fuel pumps.
33 La Carrera Panamericana RULE BOOK 2020 a) Construction: designed for the competition are permitted. It is mandatory to use the original chassis of the car. d5. It is forbidden to modify in any way the %RG\ZRUNPRGL¿FDWLRQVDUHSHUPLWWHGDFFRUGLQJ original tread of the tires; this includes making to the "period" (if proof or evidence exists) and if additional cuts in them. the Organizing Committee approves them before d6. The treadwear cannot be lower than 40. scrutineering. DQGPXVWFRPSO\ZLWKWKH'27FHUWL¿FDWLRQ It is permitted to increase the width of the fenders by a maximum of one inch. e) Other components: e1. Shock absorbers are free of restrictions (in b) Engine: the original mounting position). Four-cylinder engines that are not the original ones e2. It is allowed to improve the ignition system. are permitted, only if their maximum displacement e3. Disc brakes on the four wheels are permitted is not greater than 1,600 cc (97.64 cubic inches) and may be vented. and with only one camshaft. e4. The use of alternators instead of generators is permitted. 0RGL¿FDWLRQV DUH SHUPLWWHG DFFRUGLQJ WR WKH e5. The use of tube exhaust headers is "period" (if proof or evidence exists) and if the permitted. Organizing Committee approves them before scrutineering. 1f) Weight: A tolerance of 5% less of the minimum total weight A maximum overbore of 0.040" is permitted. is permitted. The use of carburetors is mandatory except for For all eligible cars, the originally listed weight those cars that were originally equipped by the must be considered. manufacturer with fuel injection system, which must be the original brand and model, and the Examples of eligible cars competitor must present the appropriate FIA in this category include: homologation Fuel injection systems are not permitted nor the Austin Healey Sprite/100, Austin Mini, Alfa Romeo use of turbochargers. Giulietta TI/Spider, Giulia 1,600, Porsche 356 a/b/c, Porsche 912, Volvo PV 544/1600/1800, c) Transmission: VW Karmann Ghia, Triumph TR2/3/2, Sunbeam The transmission may be the original or a similar Rapier/Alpine, Renault Dauphine/Floride 845 cc one provided that it is mechanically identical and R-81108,1300 Morgan plus 4.2 l, Citroen ds 19, with the same number of gears. The Organizing Hillman Minx, Lotus Elite/Elan 1600, Mercedes Committee must approve it before scrutineering. %HQ] )LDW%RUJZDUG Isabella/Coupe, Ford Cortina Lotus, Honda S Spur gearboxes are not allowed. 600, MG 1600. d) Tires and Wheels: :LWKRXWH[FHSWLRQDOOFDUVDQGWKHLUPRGL¿FDWLRQV d1. Rims one inch wider than the original ones are subject to the approval of the Organizing are permitted. Committee. Please send the technical and safety d2. The maximum width of the rims is 6" forms to the Permanent Secretariat to review the d3. The aspect ratio of the tires must not be less car's eligibility. than 50, (no lower number will be permitted). d4. Only designated DOT or E3 or E4 tires with their original factory tread, which are readily available in retail stores and are not specially 34 La Carrera Panamericana RULE BOOK 2020
16.7. "Histórica A Plus" If modern engines with 1,600 cc (97.64 cubic (Numbers from #280 to #299) inches) are used then manual non-sequential transmissions with a maximum of 5 speeds are All mass production and limited production cars permitted. built from 1965 to 1975 and more recent models Spur gearboxes are not permitted. aesthetically and mechanically similar to those of 1975, which have been previously authorized d) Tires and wheels: by the Organizing Committee regardless of their d1. Rims one inch wider than the original ones country of origin. The cars that are included in are permitted. The maximum width of the rims "Appendix K" of the international F.I.A. sporting is 6" code which are equipped with the original d2. The maximum width of th wheels for all cars bodywork and original 4 cylinder engines limited is 6 inches , except for those that had originally to 2000 cc (122 cubic inches) of displacement or wheels with greater width; in this case, the modern engines with a maximum displacement of participant must prove the authenticity of the 1,600 cc (97.64 cubic inches) are also eligible for of the width of the wheels with documents of this category. that time (catalogs, magazines, homologation card, etc.). Porsche 912 an 914 cars must use a) Construction: wheels maximum 6 inches wide. It is mandatory to use the original chassis of the d3. The aspect ratio of the tires must not be less car. than 50, (no lower number will be permitted). %RG\ZRUNPRGL¿FDWLRQVDUHSHUPLWWHGDFFRUGLQJ d4. Only designated DOT or E3 or E4 tires with to the "period" (if proof or evidence exists) and if their original factory tread, which are readily the Organizing Committee approves them before available in retail stores and are not specially scrutineering. designed for the competition are permitted. It is permitted to increase the width of the fenders d5. It is forbidden to modify in any way the by maximum one inch. original tread of the tires; this includes making additional cuts in them. b) Engine: d6. The treadwear cannot be lower than 40. 0RGL¿FDWLRQV DUH SHUPLWWHG DFFRUGLQJ WR WKH DQGPXVWFRPSO\ZLWKWKH'27FHUWL¿FDWLRQ "period" (if proof or evidence exists) and if the Organizing Committee approves them before e) Other components: scrutineering. e1. Shock absorbers are free of restrictions (in A maximum overbore of 0.040" is permitted. the original mounting position). The use of devices to electronically make e2. It is permitted to improve the ignition variations to the camshaft is not allowed. system. The use of carburetors is mandatory, except for e3. Disc brakes on the four wheels are permitted those cars that were originally equipped with a and may be vented. fuel injection system, in this case, the participant e4. The use of alternators instead of generators must prove the authenticity this system with is permitted. documents of that time (catalogs, magazines, e5. The use of tube exhaust headers is homologation card, etc.). Turbochargers are not permitted. allowed. f) Weight: c) Transmission: A tolerance of 5% less of the minimum total weight The transmission may be the original or a similar is permitted. one provided that it is mechanically identical and For all eligible cars, the originally listed weight with the same number of gears. The Organizing must be considered. Committee must approve it before scrutineering. 35 La Carrera Panamericana RULE BOOK 2020
Examples of eligible For those cars not mentioned above, a maximum cars in this category include: overbore of 0.040" is permitted. The use of carburetors is mandatory, except for Alfa Romeo Giulia, Datsun 510, Ford Cortina those cars that were originally equipped with a (VFRUW 9ROYR $PD]RQ %0: fuel injection system, in this case, the participant Porsche 914-4, Opel GT, Glas, Dinalpin (this car must prove the authenticity of this system with LVHOLJLEOHRQO\LILWIXO¿OOVWKHIROORZLQJ PD[LPXP documents of that time (catalogs, magazines, displacement of the engine 1,600 cc (97.64 cubic homologation card, etc.). Turbochargers are not inches), 5-speed gearbox, weight not lower than allowed. the original and the chassis must be reinforced and authorized by the Organizing Committee). c) Transmission: The transmission may be the original or a similar :LWKRXWH[FHSWLRQDOOFDUVDQGWKHLUPRGL¿FDWLRQV one, provided that it is mechanically identical are subject to the approval of the Organizing and with the same number of gears. It must be Committee. Please send the technical and safety approved by the Organizing Committee before forms to the Permanent Secretariat to review the scrutineering. car's eligibility. Spur gearboxes are not permitted.
16.8. "Histórica B" d) Tires and wheels: (Numbers from #300 to #349) d1. Rims one inch wider than the original ones All mass production and limited production cars are permitted. built from 1955 to 1974 and more recent models d2.The maximum width of the rims is 7" aesthetically and mechanically similar to those d3. The aspect ratio of the tires must not be less of 1974, which have been previously authorized than 50, (no lower number will be permitted). by the Organizing Committee regardless of their d4. Only designated DOT or E3 or E4 tires with country of origin. The cars that are included in their original factory tread, which are readily "Appendix K" of the international F.I.A. sporting available in retail stores and are not specially code which are equipped with original 6 cylinder designed for the competition are permitted. engines and original bodywork are also eligible. d5. It is forbidden to modify in any way the original tread of the tires; this includes making a) Construction: additional cuts in them. It is mandatory to use the original chassis, but d6. The treadwear cannot be lower than 40, ERG\ZRUN PRGL¿FDWLRQV DUH SHUPLWWHG DFFRUGLQJ DQGPXVWPHWWKH'27FHUWL¿FDWLRQ to the "period" (if proof or evidence exists) and if the Org. Committee approves them before e) Other components: scrutineering. e1. Shock absorbers are free of restrictions (in the original mounting position). b) Engine: e2. It is permitted to improve the ignition 0RGL¿FDWLRQV DUH SHUPLWWHG DFFRUGLQJ WR WKH system. "period" (if proof or evidence exists) and if the e3. Disc brakes on the four wheels are permitted Organizing Committee approves them before and may be vented. scrutineering. e4. The use of alternators instead of generators The maximum cylinder capacity for this category is permitted. is 2.4cm³ for Porsche 911, 4.2cm³ for Jaguar, 3.0 e5. The use of tube exhaust headers is cm³ for Austin Healey, 2.8 cm³ for Datsun and 4.1 permitted. cm³ for cars from the USA such as a Chevy II, Valiant, Falcon 6cm³, etc. 36 La Carrera Panamericana RULE BOOK 2020 f) Weight: b) Engine: A tolerance of 5% less of the minimum total weight Of the camshaft during operations. The induction is permitted. system must exclusively use carburetors except For all eligible cars, the originally listed weight for those cars that were originally equipped with must be considered. mechanical fuel injection system, considering that it must be proved by original documents and/or a For Datsun Z cars, the minimum weight must be: FIA or regional homologation book, in the event of - 240 Z (2.4 l) - 2,300lb / 1045kg. having this information. For the cars equipped with - 260 Z (2.6 l) - 2,404lb / 1093kg. Weber, Solex or Mikuni carburetors, the throttle - 280 Z (2.8 l) - 2,748lb / 1246kg. valve(es) must not exceed 50 mm diameter. For “SU” carburetors the throttle valve must not Examples of eligible cars exceed 1.5 inches. Any “modern” fuel injection in this category include: system electronically controlled, and the use of superchargers and turbo chargers are forbidden. -DJXDU;.($VWRQ0DUWLQ'%$XVWLQ+HDOH\ 0HUFHGHV%HQ]6()RUG)DOFRQ)RUG c) Transmission: Mustang 6, Chevrolet Corvair 6; Chevy II (Nova) The transmission is completely free, allowing 3O\PRXWK9DOLDQW'RGJH'DUW%DUUDFXGD the use of straight gears and sequential shifts 6, Studebaker Lark 6, Nash Rambler 6, Rambler WUDQVPLVVLRQVQRWH[FHHGLQJ¿YHIRUZDUGVSHHGV American 6, Hudson Rambler 6, Hudson Wasp 6, or gears. To have a top speed limit as ruled for 0DVHUDWL 6HEULQJ 0LVWUDO $&$FH%ULVWRO WKH IDVWHVW FDUV WKH JHDU UDWLRV VSHFL¿FDOO\ WKH Porsche 911, Datsun 240,260,280. ¿IWKJHDUDQGWKHVL]HDQGWUDFWLRQWLUHVGLDPHWHU must be reported during the pre-race inspection, :LWKRXWH[FHSWLRQDOOFDUVDQGWKHLUPRGL¿FDWLRQV WR GH¿QH WKH PD[LPXP HQJLQH VSHHG LQ 530 are subject to the approval of the Organizing using the corresponding arithmetical formula. It Committee. Please send the technical and safety is mandatory the installation of an engine speed forms to the Permanent Secretariat to review the limit device such as MSD-AL, 6AL2 or a similar car's eligibility. equipment, or a GPS signal speed limit control. The maximum speed allowed is 152 mph or 245 16.9. "Histórica B Plus" kph. To be sure that the speed limit is set as (Numbers from #550 to #599) VSHFL¿HGWKHRUJDQL]DWLRQPD\FKHFNZLWKODVHU Cars from 1964 to 1973 and equal to these or radar, in any place or time during the race. even if they are of later models, as long as they maintain the same line and shape, equipped with d) Tires and wheels: DER[HUW\SHVL[ÀDWHQJLQHXSWRFFRUD The wheels diameter must not exceed 17 inches six-cylinder V engine up to 3,500 cc or an inline and the wide dimension should be no larger than six-cylinder engine up to 4,200cc. 9.0 inches for the front ones and 11.0 inches. For WKHUHDUV:KHHORႇVHWDQGZKHHOVFRQVWUXFWLRQ a) Construction: and material (s) are free. The tires must be “DOT” The chassis, monocoque or frame must be the RU((FHUWL¿HGDQGWKHDVSHFWUDWLRVKRXOGEH RULJLQDORIWKHFDU0RGL¿FDWLRQVWRWKHERG\DUH PLQLPXPDVZHOODVWKHWUHDGZHDUVSHFL¿FDWLRQ allowed according to the time (as long as there is cannot be less than 40. It is forbidden the use of proof or ample evidence) and that are approved by the Organizing Committee before presenting tires designed “for competition purposes only” themselves to technical scrutiny. It is allowed to increase 1.0 inches to the width of the fenders e) Other components: and / or sides with respect to the competing cars The suspension must retain the original geometry, in rallies of that time. allowing the use of replacement "Coil-Over" being 37 La Carrera Panamericana RULE BOOK 2020 free the springs and the calibration of the valves a) Construction: of the shock absorbers. a.1) Chassis The braking system is totally free. ,WLVSHUPLWWHGWRUHLQIRUFHWKHÀRRURIWKHFDU The exhaust system is free. integrating the reinforcements to the roll cage. The fuel system must include a "Fuel Safe" type ,WLVDOVRSHUPLWWHGWRUHWUR¿WWKHÀRRUZLWKQHZ tank including a roll-over fuel valve. sheets, either in sections or completely, but maintaining the original dimensions and form. f) Weight: 7KH¿UHZDOODQGWKHVWUXWEDUUHOVRIWKHVKRFN A tolerance of 5% less of the minimum total weight absorbers must be original, but the latter may is permitted. be reinforced at the joint points to the aprons and in the seat of the springs. Examples of eligible cars 7KH¿[DWLRQSRLQWVRIWKHHQJLQHPXVWEHWKH in this category include: original ones, thus keeping the engine exactly in its original position. Porsche 911, Maserati Mistral 3.7 L 1969-1970, a.2) Front suspension 0HUFHGHV%HQ]6(\6(/ /DQFLD The geometric principles and the joint points of )ODPLQLD9 %0:&6 the original design must be kept. It is permitted Ferrari 246 Dino GT 1969-1971, Ford Capri y Ford to use "negative roll" type suspensions as long Cologne Capri 1969-1973, Subaru XT6 y TVR DVWKHRULJLQDO¿[DWLRQSRLQWVWRWKHERG\ZRUN V6-3.0L 1967-1971, AMC Gremlin, AMX y Javelin or chassis of the car are kept. It is permitted WRUHLQIRUFHWKHHOHPHQWVDQGRU¿[DWLRQSRLQWV :LWKRXWH[FHSWLRQDOOFDUVDQGWKHLUPRGL¿FDWLRQV The springs have no restrictions, provided that are subject to the approval of the Organizing they do not exceed the external diameter of the Committee. Please send the technical and safety original ones. forms to the Permanent Secretariat to review the Those cars equipped with torsion bars may car's eligibility. FKDQJH WKHP WR EDUV RI D GLႇHUHQW GLDPHWHU or change the whole suspension system to 16.10. "Histórica C" a Mustang II type suspension with double (Numbers from #350 to #399) "A" arms. These are available from various All mass production and limited production cars manufacturers in the USA built from 1955 to 1973 and more recent models a.3) Rear Suspension aesthetically and mechanically similar to those The car must have its original rear suspension of 1973, which have been previously authorized system without having changed any of its points by the Organizing Committee regardless of their of anchorage to the chassis. This means, that country of origin. The cars that are included in if a vehicle originally used leaf springs, this "Appendix K" of the international F.I.A. sporting system must be kept; but the holes of the code which are equipped with original 8 and 12 shackles may be relocated and the springs cylinder engines and original bodywork are also PD\EHUHSODFHGE\RWKHURQHVRIDGLႇHUHQW eligible for this category. width. Those special, unique, limited production or artisan The use of lowering blocks is allowed, as well manufactured (handmade) cars, which were as the installation of "Panhard" type bars. built from 1950 to 1954 and which maintain their a.4) Bodywork original mechanical and aesthetic characteristics %RG\ZRUN PRGL¿FDWLRQV DUH SHUPLWWHG may be accepted in this category; if and when according to the "period" (if proof or evidence their authenticity is proved (Article 15) and are exists) and if the Organizing Committee authorized by the Organizing Committee before approves them before scrutineering. scrutineering. 38 La Carrera Panamericana RULE BOOK 2020 b) Engine: don't have a diameter 0.040" larger than the b.1) Ford original. Mustang, Falcon and Fairlane/Torino must use • The valve train is free of restrictions. an engine block of 289 cubic inches or 302 • The heads of the engine must be made cubic inches up to 1969 models or 302 cubic from iron; either the original or a modern one LQFKHV IURP RQZDUGV 7KH XVH RI %RVV manufactured to high-performance specs. and Cleveland type heads are forbidden. The • The camshaft is free of restrictions as well original engine block for the rear seal of the back as the admission manifold. oil seal for the crank in "two pieces" (engine • Using a dry sump is forbidden. block produced up to the 1980 model) may • The use of a carburetor is mandatory and EHPRGL¿HGWRXVHDPRGHUQVLQJOHRQHSLHFH the maximum admission permitted is one seal. The type of crank to be used may either carburetor with 4 barrels and a maximum be "heavy", "light", "original" or "0" balancing; ÀRZRIFIP provided it maintains maximum travel of 3.00", • Cars weighing less than 2,800 lbs. (1,273 ZKLFKLVWKHRULJLQDOVSHFL¿FDWLRQIRUWKHFUDQN Kg) and are equipped with an 8-cylinder in a 302 cubic inch engine. engine must use one carburetor with two b.2) Chevrolet EDUUHOV ZLWK D PD[LPXP ÀRZ RI FIP Chevy II, Nova, Corvette, Chevelle, and instead of the authorized one with four barrels Camaro may use engines with 327 cubic and 600 c.f.m. inches displacement, even though some cars • If cars were equipped with the optional were originally equipped with a 283 cubic inch direct fuel injection system (Chevrolet 1957) engine. The use of an engine block of 350 cubic its use is allowed, but the participant must inches with four bedplate bolts with a crank of prove the authenticity with documents of that a 327 cubic inch second-generation engine time (catalogs, magazines, homologation with large diameter stumps is permitted. Cars card, etc.) like the Chevrolet 1957 can use the original • The use of turbochargers is forbidden. injection system (the same of the Corvette) which was optional for this model c) Transmission: b.3) Chrysler, Dodge and Plymouth The transmissions may be the original ones 'DUW 'DUW *7 9DOLDQW 6LJQHW DQG %DUUDFXGD corresponding to the car make and model. may use 318 cubic inch engines, even though Replacement of the transmission is allowed, some cars were originally equipped with a 273 providing that it is of the same brand and design cubic inch engine. For the Chrysler 300, a 440 as the original one, not exceeding four forward cubic inch engine is accepted only if the weight speeds or gears. The Richmond gear T10 or of the car is the same or greater as the original. super-T10 transmissions and the T- Force b.4) Cars of other brands and models not GT-4 helical gears transmission are approved mentioned above must be equipped with the replacements. Straight gears or spur gear boxes original engine corresponding to the type of are forbidden. car and model. If an engine has been replaced Helical gears transmissions are approved by a similar one of another year of the model UHSODFHPHQWV,WLVDOORZHGWKHXVHRI¿YHVSHHG or of less displacement, the approval of the WUDQVPLVVLRQV ZLWK WKH ¿IWK JHDU LQRSHUDWLYH RU Organizing Committee must be obtained blocked, providing that the fourth gear ratio is before scrutineering. 1.0:1.0. This condition will be inspeted and sealed b.5) General points that apply to all cars in this durin the Initial Technical Inspection. category: It is mandatory that the teams use MSD ignition • The connecting rods, pistons and rings are control modules, (or from any other manufacturer), free of restrictions, as long as the pistons to control the RPMs of an engine. The MSD 6A, 39 La Carrera Panamericana RULE BOOK 2020
6AL, 6ALN, SFI-5520, AL-2 ignition controls can e) Other components: be used (or from any other manufacturer). e1. The steering must keep its basic The ignition control module will be inspected and RSHUDWLRQ,WLVDOORZHGWRXVHDGLႇHUHQWLQSXW sealed during scrutineering. In case that during output ratio from the original. It is permitted the event a team wishes to change the size of and recommended to replace the original their rear tires or the relationship of the gears steering column, (solid with a worm gear), of the rear axle, they must inform the Technical for a collapsible one that corresponds to the 'LUHFWRU WR KDYH WKH 530 OLPLWV UHFHUWL¿HG DQG same make of car, but in later models or a re-sealed. Any ignition control system can be modern steering column from a specialized used as long as it limits the RPMs of an engine. If manufacturer (e.g. Flaming River). a car does not use an ignition module that limits e2. Using a removable steering wheel from the RPMs, any other RPM limiter can be used, (e.g. column is permitted. Mallory – Part No. 644L). e3. Shock absorbers have no restrictions (if All competitors must hand in to the Permanent WKH\DUH¿WWHGLQWKHRULJLQDOPRXQWLQJSRVLWLRQ Secretariat, along with the technical and safety e4. It is permitted to improve the ignition IRUPVWKHVSHFL¿FDWLRQVRIWKHLJQLWLRQPRGXOHV system by using an MSD ignition module or an the RPM limiter and the size and diameter of the equivalent product from any other make. tires, in order to select the module that will be e5. The original brakes, either drum or disc, installed during scrutineering. may be replaced with modern disc brakes with To verify that the competing cars comply with the KLJKHU HႈFLHQF\ 7KHVH PD\ EH YHQWHG DQG technical requirements regarding the speed limit their size is limited only by the size of the wheel. of the cars, the teams may be subject to random e6. The use of alternators instead of generators revisions, both during and at the end of the event is permitted. by the scrutineers. e7. The exhaust system is free of restrictions 5HDUD[OHVDQGGLႇHUHQWLDOVZLWKDKLJKHUFDSDELOLW\ and tube exhaust headers of any diameter are of torque absorption are allowed, provided that permitted without restriction. The outlet of the they are from the same manufacturer and/or type exhaust tubes must at least be from behind the RIFDU7KHXVHRIORFNLQJGLႇHUHQWLDOVLVSHUPLWWHG driver’s seat to the outside of the car. d) Tires and wheels: f) Weight: d1. Rims one inch wider than the original ones A tolerance of less than 5% of the minimum total are permitted. weight is permitted. d2. The maximum width of the rims is 7" For all eligible cars, the originally listed weight d3. The aspect ratio of the tires must not be must be considered. less than 50, (no lower number will be allowed). d4. Only designated DOT or E3 or E4 tires with Examples of eligible cars their original factory tread, which are readily in this category include: available in retail stores and are not specially designed for the competition are permitted. Chevrolet, Nova, Chevelle, Corvette V8 283, 327, d5. 7KHWLUHVPXVWEHVSHFL¿FDOO\PDGHIRUULPV )RUG )DOFRQ 9 &KHYUROHW %HO$LU 9 &KU\VOHU with a maximum width of 7". %&( )HUUDUL *7% d6. It is forbidden to modify in any way the Facel Vega FV/HK 500, Studebaker Hawk / Silver original tread of the tires; this includes making +DZN%0:)RUG0XVWDQJ additional cuts in them. d7. The treadwear cannot be lower than 40. :LWKRXWH[FHSWLRQDOOFDUVDQGWKHLUPRGL¿FDWLRQV DQGPXVWFRPSO\ZLWKWKH'27FHUWL¿FDWLRQ are subject to the approval of the Organizing
40 La Carrera Panamericana RULE BOOK 2020
Committee. Please send the technical and safety Any brand of tire is allowed as long as they forms to the Permanent Secretariat to review the have DOT (or equivalent) approval and have a car's eligibility. treadwear of no less than 40. In the event that the original tire size(s) is no longer available, 16.11 Historic Road / Rally Racing Cars the team must request the approval from the This Class is exclusively for Historic Road and Organizing Committee to be able to use an 5DOO\ 5DFLQJ &DUV VSHFL¿FDOO\ EXLOW IRU WKLV alternate size. purpose and manufactured from 1957 to 1977 a.4) Engine, Transmission and Axles/ and are included in t Appendix "K" of the FIA 'LႇHUHQWLDOV International Sporting Code irrespective of their The original engine, transmission and country of origin. Considering the current safety GLႇHUHQWLDO V PXVW EH XVHG DFFRUGLQJ WR regulations, cars that are not equipped with either WKH ),$2+% DQGRU ),$+73 ,I WKHUH LV D an original or new roll cage built according to GLႇHUHQFH RU YDULDWLRQ IURP WKH ),$DSSURYHG WKH VSHFL¿FDWLRQV PHQWLRQHG LQ ,WHP DQG parts, the Organizing Committee must be $SSHQGL[RIWKLV5XOH%RRNFDQQRWEHDFFHSWHG QRWL¿HGLQDGYDQFHLQRUGHUWRGHWHUPLQHLIWKH car can be accepted into this Class. To register a car in this Class, it is necessary to a.5) Cooling System send to the Organizing Committee, at least 90 days The cooling system must be in accordance before the date of the initial technical inspection, ZLWKWKH),$2+%DQGRU),$+73 along with the entry form, a copy of the original a.6) Steering System ),$ +RPRORJDWLRQ %RRN ),$2+% DQGRU WKH The steering system must be in accordance FIA Historical Technical Passport (FIA-HTP), as ZLWKWKH),$2+%DQGRU),$+73 well as pictures showing the actual condition of a.7) Fuel System and Fuel Tank the car including the exterior and interior, roll cage The fuel system and gas tank must be in and engine compartment. DFFRUGDQFHZLWKWKH),$2+%DQGRU),$+73 All cars must have a roll-over check valve to a) General Rules avoid spillage of fuel in the event of an accident. a.1) Chassis and Suspension a.8) Minimum Weight The car must have the original chassis and ,W PXVW EH LQ DFFRUGDQFH ZLWK WKH ),$2+% suspension according to the parts shown in the and/or FIA-HTP ),$2+% DQGRU ),$+73$Q\ W\SH RI VKRFN a.9) Exterior and Body absorbers are permitted provided that they The bodywork of the car must be original are installed to the original mounting points. ZLWKRXW DQ\ PRGL¿FDWLRQV RU DOWHUDWLRQV DQG The original suspension geometry cannot be must be made from the original materials. The PRGL¿HGRUDOWHUHG windows must be of the original materials. It a.2) Brakes is mandatory to use a safety or three layer The car must have the original brakes according windshield. WRWKHSDUWVVKRZQLQWKH),$2+%DQGRU),$ HTP, except for the brake pads. These can be b) Safety Equipment replaced with modern ones with compounds b.1) The car and the competitors (driver and that are free of restrictions. co-driver) must comply with the safety rules a.3) Wheels and Tires mentioned in Article VIII and for all the Classes. The rims and tires that are shown in the FIA- With the exception that an original roll cage 2+%DQGRU),$+73PXVWEHXVHG1HZULPV FDQEHXVHGDFFRUGLQJWRWKH),$2+%DQGRU can be used as long as the diameter, rim width, FIA HTP, instead of the one mentioned in this RႇVHW DQG EDFNVSDFLQJ LV WKH VDPH DV WKH 5XOH%RRN original design. 41 La Carrera Panamericana RULE BOOK 2020
Ratios of Histórica C
Rear axle ratio 3.00:1 3.25:1 Diameter of the tire Size of the tire RPM kph mph RPM kph mph (inches) 245/50-15 24.8 6000 233 145 6400 228 142 225/50-15 23.8 6200 230 143 6800 233 145 215/50-15 23.5 6200 228 142 6800 232 144 205/50-15 23.1 6400 232 144 7000 233 145 195/50-15 22.7 6600 233 145 7000 230 143 225/55-15 24.8 6000 233 145 6400 228 142 205/55-15 23.9 6200 232 144 6600 228 142 195/55-15 23.4 6400 233 145 6800 230 143 235/60-15 26.1 5600 228 142 6200 233 145 225/60-15 25.6 5800 232 144 6200 230 143 215/60-15 25.2 5800 228 142 6400 233 145 205/60-15 24.7 6000 232 144 6400 228 142 195/60-15 24.2 6000 227 141 6600 230 143
Rear axle ratio 3.50:1 3.70:1 Diameter of the tire Size of the tire RPM kph mph RPM kph mph (inches) 245/50-15 24.8 7000 233 145 7400 233 145 225/50-15 23.8 7200 230 143 7600 230 143 215/50-15 23.5 7400 233 145 7800 233 145 205/50-15 23.1 7400 230 143 7800 228 142 195/50-15 22.7 7600 232 144 8000 230 143 225/55-15 24.8 7000 233 145 7400 233 145 205/55-15 23.9 7200 230 143 7600 230 143 195/55-15 23.4 7400 232 144 7800 232 144 235/60-15 26.1 6600 232 144 7000 232 144 225/60-15 25.6 6800 233 145 7200 233 145 215/60-15 25.2 6800 230 143 7200 230 143 205/60-15 24.7 7000 232 144 7400 232 144 195/60-15 24.2 7200 233 145 7600 233 145 42 La Carrera Panamericana RULE BOOK 2020
16.12. "Exhibition Cars" $UWLFOH 0RGL¿FDWLRQVWRWKH (Numbers from: #450 to #499) Exhibition cars are all cars in the Panamerican competing cars Cars group (1940 – 1954) or cars from the of A) Panamerican Cars Group Historic Cars group including categories "Histórica (“Turismo de Producción”, “Turismo Mayor”, A" / "Histórica C" (from 1955 – 1973) or from “Sport Menor”, “Sport Mayor” and “Original the category "Histórica A Plus" (1965 – 1975) or Panam”) +LVWyULFD% ± RUWKHFDUVIURPWKH group of Original Panamerican Cars that do not 18.1. Fuel tank: correspond to any of the 9 competition categories; a) The original fuel tank must be replaced by a but are allowed to participate in the event upon “cell” type fuel tank (Fuel Cell or Fuel Safe), on all prior authorization by the Organizing Committee, the cars of the Pan American Group. EXWDUHQRWHOLJLEOHIRURႈFLDOFODVVL¿FDWLRQ b) The capacity or volume of the tank is unrestricted c) The tank and its breathing system must have a :LWKRXWH[FHSWLRQDOOFDUVDQGWKHLUPRGL¿FDWLRQV “one-way” safety valve installed (check valve) to are subject to the approval of the Organizing prevent the gasoline from leaking or leaking out Committee. Please send the technical and safety of the system in the event of the car overturning. forms to the Permanent Secretariat to review the d) The fuel tank must be completely isolated from car's eligibility. WKHSDVVHQJHUV FRPSDUWPHQWE\D³¿UHZDOO´WKDW SUHYHQWVWKHÀRZRIIXHORUYDSRUJDV Article17: Fuel 18.2. Suspension: It is mandatory for all categories and cars to use a) It is allowed to modify the suspension, stabilizer the commercially available unleaded fuel Magna bars, and control according to the following points Sin (green) or Premium (red) available at PEMEX (b, c, and d). service stations. The use of aviation or any other b) It is allowed to replace the leaf springs by fuel "special for competitions" is forbidden for all springs to the cars of the categories "Turismo categories Producción" and "Turismo Mayor" Dion type rear axles are not allowed. The use of fuel additives and octane boosters is c) Leaf spring can be replaced by coil springs. A permitted. rear axle Dion system is not permitted. d) Cockpit operated or remote control systems to It is obligatory to refuel at the PEMEX service change the ride height of the suspension are not VWDWLRQV RU DW WKH RႈFLDO VHUYLFH DUHDV DORQJ permitted. the route. When the car is being refueled the FRPSHWLWRUV PXVW KDYH D ¿UH H[WLQJXLVKHU RQ 18.3. Bodywork: hand. It is strictly prohibited to refuel in any other a) The replacement of some original pieces with location; the penalty will be exclusion from the SODVWLF DOXPLQXP RU ¿EHUJODVV LV SHUPLWWHG stage. provided they have the same shape and appearance as the original parts replaced. The transportation of fuel to the service areas +RZHYHU WKH VSHFL¿HG PLQLPXP ZHLJKW VKDOO FDQ EH GRQH RQO\ RQFH D VWDJH KDV ¿QLVKHG RU be maintained. These replacements should be before the start of a stage. This is done to avoid authorized by the Organizing Committee either transporting fuel in competing cars or service before or during the initial scrutineering before the vehicles during the competition. The penalty will event. EHWKHGLVTXDOL¿FDWLRQIURPWKHVWDJH
43 La Carrera Panamericana RULE BOOK 2020 b) The original windshield must be used or a c.f.m. maximum are permitted in all cars with similar one with safety shatterproof glass. American engines with 6 inline cylinders. c) Windshields made from any other material b.3) Two carburetors with two barrels each for other than safety shatterproof glass is forbidden. cars with 4 cylinders, including Volkswagen, d) If the car starts with an authorized windshield, are permitted. but later replaces it with another one made from c) On sports and GT cars for the "Sport Menor" DGLႇHUHQWPDWHULDOWKHWHDPZLOOEHGLVTXDOL¿HG category, the induction is unrestricted, however from the event. injection systems are not permitted (Article 16.3). e) It is allowed to modify the area of the fenders d) On sports and GT cars for the "Sport Mayor" and rear wheel openings, widening one inch per category, the induction must be with the original side (two inches to the total original width) to system and the injection system may only be facilitate the use of wheels and rims authorized used if the original cars were manufactured with for each Category. this system (Article 16.4). e) For the "Sport Mayor" category, modern engines 18.4. Engines: with 6 cylinders in-line may be used, subject to a) All cars are allowed to balance the engine and WKH¿UVWSDUDJUDSKRI$UWLFOHE to modify the camshaft, pistons, connecting rods, valves, springs and any other parts of the internal 7UDQVPLVVLRQDQGGLႇHUHQWLDO movement. a) Gearbox and rear axle ratios are free of b) For cars in the "Turismo de Producción" (only restrictions. American sedan cars) and "Turismo Mayor" b) 7KHXVHRIOLPLWHGVOLSGLႇHUHQWLDOVDQGORFNHG categories, a maximum of 8" (20.3 cm) of in-line rear ends are permitted. relocation of the engine and drive-line from the original engine position is allowed. c) The use of "overdrive" is permitted only in cars c) All engines are allowed to increase the cylinder originally manufactured with this system. diameter up to .060 inches 18.8. Tires: d) In the "Sport Mayor" category, the use of a) Modern tires will be permitted only with the HQJLQHV RI WKH VDPH IDPLO\ DQG FRQ¿JXUDWLRQ designation D.O.T., E3 or E4 for use in cities and larger than 2,000 cc (122 cubic inches) and bored highways and readily available in retail stores. out up to 5,000 cc (305 cubic inches) is permitted, b) Narrower tires and with a numerically higher (Article 16.4.b). aspect ratio (example: series 50, 60, 70, etc) are e) The use of a dry sump is not permitted. permitted. c) In no case, may the treadwear be lower than 60. 18.5. Radiators and oil coolers: d) No racing tires (Slicks or Treadwear zero) are a) Any type of radiator is permitted. permitted. b) Oil coolers are permitted and are recommended. e) The tread design must be the original from the factory; additional cuts in the tire are not permitted. 18.6. Engine induction: f) 1RWFRPSO\LQJZLWKWKHVSHFL¿HGWLUHVZLOOLPSO\ a) For all categories, superchargers or WKH GLVTXDOL¿FDWLRQ IURP WKH VWDJH LQ ZKLFK WKH turbochargers are not permitted. infraction was detected. b) For cars of the "Turismo de Producción" category: 18.9. Steering: b.1) Only one carburetor with 4 barrels with a) Steering systems may be updated. 600 c.f.m. maximum is permitted in cars with American engines with 8 cylinders. 18.10. Shock absorbers: b.2) Only 3 carburetors with two barrels each a) The shock absorbers are free of restrictions or one carburetor with four barrels with 600 IRUDOOFDWHJRULHVEXWRQO\LIWKH\DUH¿WWHGLQWKH 44 La Carrera Panamericana RULE BOOK 2020 original upper and lower mounting position. preparation of the car for the event by sending b) Coil-overs are allowed for the "Turismo de to the Permanent Secretariat all the issues that Producción" and "Turismo Mayor" categories. will be required for approval by the Organizing Committee. 18.11. Brakes: This is why it is very important to deliver the a) %UDNLQJ V\VWHPV PXVW EH LPSURYHG DQG technical and safety form completed on time updated. along with pictures and drawings or sketches of b) For all cars of all categories, it is recommended WKH PRGL¿FDWLRQV WKDW ZLOO EH PDGHKDYH EHHQ to use disc brakes on the four wheels, and these done to the car. may be vented. c) It is recommended to update the original brake ,I DQ\ FKDQJH RU PRGL¿FDWLRQ LV QRW DFFHSWHG OLQHV WXELQJFRQQHFWLRQVDQGEUDNHÀXLGKRVHV the team will be informed as soon as possible. and change them to other modern options that If possible, recommendations will be made as to RႇHUEHWWHUVDIHW\ how the changes can be made in a way that it is d) The system used to actuate the brakes is free acceptable and in compliance with the rules and of restrictions. UHTXLUHPHQWVPHQWLRQHGLQWKLV5XOH%RRN
18.12. Weight: ,Q FDVH RI FRQÀLFWV UHJDUGLQJ DQ\ FKDQJHV RU a) $OOZHLJKWVIRUWKHFRPSHWLQJFDUVDUHVSHFL¿HG PRGL¿FDWLRQV WKH FDVH ZLOO EH VXEPLWWHG WR WKH LQ $UWLFOH RI WKLV 5XOH %RRN DQG PXVW EH 6WHZDUG RI WKH 0HHWLQJ ZKR ZLOO WDNH D ¿QDO respected for all categories. Cars not complying decision. ZLWKWKHVHVSHFL¿FDWLRQVZLOOEHGLVTXDOL¿HGIURP the stage where the infraction was detected. Original Panamerican Cars b) In Article 16 the reference made for the weight of the competing car includes the wheel and spare 0RGL¿FDWLRQVSHUPLWWHG tire, the jack, the tools to replace the tire, as well For the Original Panamerican Cars Group, only DVWKH¿UHH[WLQJXLVKLQJV\VWHPDQGHPHUJHQF\ WKH PRGL¿FDWLRQV LQGLFDWHG LQ $UWLFOH DUH signs. This is the weight that must be respected permitted. The following must be considered: and that must correspond to the catalogs of Scrutineering. a) Windshield: a.1) The original windshield must be used or a 3HUPLWWHGPRGL¿FDWLRQV similar one with safety shatterproof glass. For the Panamerican Cars group, only the a.2) Windshields made from any other material PRGL¿FDWLRQV LQGLFDWHG LQ $UWLFOHV WR other than safety shatterproof glass is strictly and those corresponding to this Article from 18.1 forbidden. to 18.12 are permitted. a.3) If the car starts with an authorized windshield, but later replaces it with another $XWKRUL]DWLRQRIWKHPRGL¿FDWLRQV RQHPDGHIURPDGLႇHUHQWPDWHULDOWKHWHDP It is mandatory for the Organizing Committee ZLOOEHLPPHGLDWHO\GLVTXDOL¿HGIURPWKHHYHQW WR DXWKRUL]H WKH PRGL¿FDWLRQV PDGH WR WKH FDUV before scrutineering in Querétaro. b) Brakes: b.1) %UDNLQJ V\VWHPV PXVW EH LPSURYHG DQG In order to not be rejected during the scrutineering updated. before the start of the event, it is recommended b.2) For all cars of all categories, it is WKDW DOO PRGL¿FDWLRQV TXHVWLRQV FRPPHQWV DQG recommended to use disc brakes on the four requests for any changes made to the cars be wheels, and these may be vented. submitted to the Organizing Committee well in b.3) It is recommended to update the original advance; from the time when the team begins brake lines (tubing, connections, and brake 45 La Carrera Panamericana RULE BOOK 2020
ÀXLGKRVHV DQGFKDQJHWKHPWRRWKHUPRGHUQ ,Q FDVH RI FRQÀLFW UHJDUGLQJ DQ\ FKDQJHV RU RSWLRQVWKDWRႇHUEHWWHUVDIHW\ PRGL¿FDWLRQV WKH FDVH ZLOO EH VXEPLWWHG WR WKH b.4) The system used to actuate the brakes is 6WHZDUG RI WKH 0HHWLQJ ZKR ZLOO PDNH D ¿QDO unrestricted. decision. c) Weight: B) Historic Cars Group c1.) The weight for the competing cars is ("Histórica A", "Histórica A Plus", "Histórica VSHFL¿HG LQ$UWLFOH RI WKLV 5XOH %RRN DQG B" "Historica B Plus" and "Histórica C" must be respected for all categories. The cars categories) WKDW GR QRW FRPSO\ ZLWK WKHVH VSHFL¿FDWLRQV ZLOO EH GLVTXDOL¿HG IURP WKH VWDJH ZKHUH WKH 3HUPLWWHGPRGL¿FDWLRQV infraction was detected. )RUWKH+LVWRULF&DUV*URXSRQO\WKHPRGL¿FDWLRQV c2.) Article 16 mentions the weight of the indicated in Articles 16.5 to 16.8 are permitted. competing car and includes the wheel and The following must be considered: spare tire, the jack, the tools to replace the tire, DV ZHOO DV WKH ¿UH H[WLQJXLVKLQJ V\VWHP DQG a) Fuel Tank: emergency signs. This is the weight that must a.1) The original fuel tank must be replaced by be respected and that must correspond to the a “cell” type fuel tank (Fuel Cell or Fuel Safe”) catalogs of scrutineering. on all the cars of the Historic Cars Group. a.2) The capacity or volume of the tank is $XWKRUL]DWLRQRIWKHPRGL¿FDWLRQV unrestricted. It is mandatory that the Organizing Committee a.3) The tank and its ventilation system must DXWKRUL]HV WKH PRGL¿FDWLRQV PDGH WR WKH FDUV have a “one-way” check valve installed, to before scrutineering at Querétaro. prevent the gasoline from leaking or leaking out of the system in the event of the car overturning. To avoid rejection during the scrutineering before a.4) The fuel tank must be completely isolated the start of the event, it is recommended that all from the passengers' compartment by a PRGL¿FDWLRQVTXHVWLRQVFRPPHQWVDQGUHTXHVWV ³¿UHZDOO´WKDWSUHYHQWVWKHÀRZRIIXHORUYDSRU for any changes made to the cars be submitted to gas. the Organizing Committee well in advance; from the time when the team begins preparation of the b) Windshield: car for the event by sending to the Permanent b.1) The original windshield must be used or a Secretariat all issues that will be required for similar one with safety shatterproof glass. approval by the Organizing Committee. b.2) Windshields made from any other material This is why it is very important to deliver the are strictly forbidden and the start will not be WHFKQLFDO DQG VDIHW\ IRUP FRPSOHWHO\ ¿OOHG RQ permitted for cars with windshields not made time along with pictures and drawings or sketches from safety shatterproof glass. RIWKHPRGL¿FDWLRQVWKDWZLOOEHPDGHKDYHEHHQ b.3) If the car starts with an authorized done to the car. windshield, but later replaces it with another RQHPDGHIURPDGLႇHUHQWPDWHULDOWKHWHDP ,I DQ\ FKDQJH RU PRGL¿FDWLRQ LV QRW DFFHSWHG ZLOOEHGLVTXDOL¿HGIURPWKHHYHQW the team will be informed as soon as possible. If possible, recommendations will be made as to c) Brakes: how the changes can be made in a way that it is c.1) %UDNLQJ V\VWHPV PXVW EH LPSURYHG DQG acceptable and in compliance with the rules and updated. UHTXLUHPHQWVPHQWLRQHGLQWKLV5XOH%RRN7KLVLV c.2) For all cars of all categories, it is to avoid rejecting during the initial scrutineering. recommended to use disc brakes on the four 46 La Carrera Panamericana RULE BOOK 2020
wheels, and these may be vented. along with pictures and drawings or sketches of c.3) It is recommended to update the original WKH PRGL¿FDWLRQV WKDW ZLOO EH PDGHKDYH EHHQ brake lines (tubing, connections and brake done to the car. ÀXLGKRVHV DQGFKDQJHWKHPWRRWKHUPRGHUQ RSWLRQVWKDWRႇHUEHWWHUVDIHW\ ,I DQ\ FKDQJH RU PRGL¿FDWLRQ LV QRW DFFHSWHG c.4) The system used to actuate the brakes is the team will be informed as soon as possible. free of restrictions. If possible, recommendations will be made as to how the changes can be made in a way d) Weight that it is acceptable and in compliance with the d1.) The weight for the competing cars is rules and requirements mentioned in this Rule VSHFL¿HG LQ$UWLFOH RI WKLV 5XOH %RRN DQG %RRN 7KLV LV WR DYRLG UHMHFWLQJ FDUV GXULQJ WKH must be respected for all categories. The cars LQLWLDOVFUXWLQHHULQJ,QFDVHRIFRQÀLFWUHJDUGLQJ WKDW GR QRW FRPSO\ ZLWK WKHVH VSHFL¿FDWLRQV DQ\ FKDQJHV RU PRGL¿FDWLRQV WKH FDVH ZLOO EH ZLOO EH GLVTXDOL¿HG IURP WKH VWDJH ZKHUH WKH submitted to the Steward of the Meeting who will infraction was detected. PDNHD¿QDOGHFLVLRQ d2.) Article 16 mentions the weight of the competing car and includes the wheel and D) Exhibition Cars spare tire, the jack, the tools to replace the tire, DV ZHOO DV WKH ¿UH H[WLQJXLVKLQJ V\VWHP DQG 3HUPLWWHGPRGL¿FDWLRQV emergency signs. This is the weight that must In this group, there is not a list of allowable be respected and that must correspond to the PRGL¿FDWLRQV VLQFH HQWUDQWV LQ WKH ([KLELWLRQ catalogs of scrutineering. &DUV *URXSKDYH QR ULJKW WR EH FODVVL¿HG RU qualify for the trophies. However, the following e) Bodyworks must be considered: It is allowed to modify the area of the fenders and rear wheel openings, widening one inch per side a) Windshield: (two inches to the total original width) to facilitate a.1) The original windshield must be used or a the use of wheels and rims authorized for each similar one with safety shatterproof glass. Category. a.2) Windshields made from any other material are strictly forbidden and the start will not be $XWKRUL]DWLRQRIWKHPRGL¿FDWLRQV permitted for cars with windshields not made It is mandatory that the Organizing Committee from safety shatterproof glass. DXWKRUL]HV WKH PRGL¿FDWLRQV PDGH WR WKH FDUV a.3) If the car starts with an authorized before scrutineering in Querétaro. windshield, but later replaces it with another RQHPDGHIURPDGLႇHUHQWPDWHULDOWKHWHDP To avoid rejection during the scrutineering before ZLOOEHLPPHGLDWHO\GLVTXDOL¿HGIURPWKHHYHQW the start of the event, it is recommended that all PRGL¿FDWLRQVTXHVWLRQVFRPPHQWVDQGUHTXHVWV b) Brakes: for any changes made to the cars be submitted to b.1) %UDNLQJ V\VWHPV PXVW EH LPSURYHG DQG the Organizing Committee well in advance; from updated. the time when the team begins preparation of the b.2) For all cars of all categories, it is car for the event by sending to the Permanent recommended to use disc brakes on the four Secretariat all issues that will be required for wheels, and these may be vented. approval by the Organizing Committee. b.3) It is recommended to update the original brake lines (tubing, connections and brake This is why it is very important to deliver the ÀXLGKRVHV DQGFKDQJHWKHPWRRWKHUPRGHUQ WHFKQLFDODQGVDIHW\IRUPFRPSOHWHO\¿OOHGRQWLPH RSWLRQVWKDWRႇHUEHWWHUVDIHW\ 47 La Carrera Panamericana RULE BOOK 2020
b.4) The system used to actuate the brakes Sport Mayor categories do not comply with the has no restrictions. WHFKQLFDO VSHFL¿FDWLRQV RXWOLQHG LQ $UWLFOHV and 16.3 nor with the corresponding permitted c) Weight: PRGL¿FDWLRQVPHQWLRQHGLQ$UWLFOHWKHFDUZLOO In this Group, the weight of the cars has no be excluded from the event. restriction. If the entrant requests it and the Clerk of the 18.20. Authorization to take part in La Carrera Course and the Steward of the Meeting accept, the Panamericana car may be transferred to the Exhibition Category, The cars participating in this Group, require ZKLFKLVQRWFODVVL¿HGQRUDUHWKHGULYHUVHOLJLEOH VSHFL¿FDFFHSWDQFHDQGDQDJUHHPHQWEHWZHHQ to receive trophies (Articles 16.10 and 19.4), in the team and the Organizing Committee, with compliance with Article 18.20. the Steward of the Meeting as a witness that they will take part in the event without the right 19.3. Historic Cars Group WRFODVVL¿FDWLRQQRUWRUHFHLYHWURSKLHVGXHWRWKH If the competing cars in any of the categories IDFWWKDWWKHFRPSHWLQJFDUGRHVQRW¿WLQDQ\RI of this group do not comply with the technical the 9 competing categories; or because from the VSHFL¿FDWLRQVRXWOLQHGLQ$UWLFOHVWRQRU time of their application to the event, the team ZLWK WKH SHUPLWWHG PRGL¿FDWLRQV PHQWLRQHG LQ decided to only take part in this category and the Article 18, the car will be excluded from the event. Organizing Committee accepted their entry If the entrant requests it and the Clerk of the Course and the Steward of the Meeting accept, the Article 19: Non-eligible cars - car may be transferred to the Exhibition Category, Exclusions ZKLFKLVQRWFODVVL¿HGQRUDUHWKHGULYHUVHOLJLEOH to receive trophies (Articles 16.10 and 19.4), in 19.1. Turismo de Producción and Sport Menor compliance with Article 18.20. If the competing cars of the Turismo de Producción Moving from one category to another within the and Sport Menor categories do not comply with the Historic Car Group for failing to meet Regulation WHFKQLFDO VSHFL¿FDWLRQV RXWOLQHG LQ $UWLFOHV is not allowed. and 16.3 nor with the corresponding permitted PRGL¿FDWLRQVPHQWLRQHGLQ$UWLFOHWKHFDUZLOO &ODVVL¿FDWLRQLQWKH([KLELWLRQ&DWHJRU\ be moved to the Turismo Mayor and Sport Mayor In order for an entrant to be accepted into the categories respectively. Exhibition Category, there must be an agreement between the Clerk of the Course and the entrant, If after being transferred to the new category with the Steward of the Meeting as a witness. the car still does not comply with all technical Otherwise, the team will be excluded from the requirements, it will be excluded from the event. event, (Article 18.20).
If the entrant requests it and the Clerk of the 19.5. Refund of the entry fee Course and the Steward of the Meeting accept, the $Q\SDUWLFLSDQWWKDWLVGLVTXDOL¿HGIURPWKHHYHQW car may be transferred to the Exhibition Category, cannot claim a full or partial refund of the entry fee ZKLFKLVQRWFODVVL¿HGQRUDUHWKHGULYHUVHOLJLEOH to receive trophies (Articles 16.10 and 19.4), in compliance with Article 18.20.
19.2. Turismo Mayor and Sport Mayor If the competing cars of the Turismo Mayor and 48 La Carrera Panamericana RULE BOOK 2020
VIII. SAFETY EQUIPMENT
Article 20: Mandatory safety cage before scrutineering. The recommended construction of the roll-cage must be in accordance equipment with Article 253 of Appendix J of the International Sporting Code of the Fédération Internationale de It is essential that all cars of all categories, as well O¶$XWRPRELOH ),$ ,Q$SSHQGL[RIWKLV5XOH%RRN as all competitors have all the safety equipment are the recommended drawings to build one. indicated in this Article. Failure to comply with this b) ,I D WHDP GHFLGHV WR XVH D GLႇHUHQW GHVLJQ DUWLFOH ZLOO UHVXOW LQ WKH GLVTXDOL¿FDWLRQ IURP WKH LW PXVW ¿UVW EH DXWKRUL]HG E\ WKH 2UJDQL]LQJ event. Committee before scrutineering. This Article states the minimum requirements that a roll- 20.1. Hood pins cage must meet. The corresponding reference (for all categories) drawings are shown in Appendix 2. a) Hood pins or belts are mandatory on all cars c) A team has the obligation to inform the and must be attached to the bonnet (hood) and Organizing Committee about the design and boot (trunk) to keep them closed. construction details of the roll-cage no later than August 24, 2020, for its authorization. If there is an 20.2. Fire extinguishers issue with the proposed roll-cage, the Organizing (for all categories) Committee will propose options and/or changes a) It is mandatory to use an extinguishing system that would have to be made for it to be authorized. E\ PHDQV RI D ¿[HG WDQN ZLWK QR]]OHV ZLWK D The roll-cage must be approved before attending capacity of at least 4 kg, as well as a 2 kg manual scrutineering. extinguisher. d) It is mandatory for all cars to use a roll-cage b) 7KHH[WLQJXLVKHUVPXVWEHSURWHFWHGZLWK¿UH with 6 mounting points. The basic roll-cage resistant material and located in the cockpit and design must have a main arch located just behind all conduits must be made of metal. the front seats, two lateral half-roll bars, one c) The driver must be capable of activating the transverse member joining the upper parts of the extinguishers manually, while seated with the lateral half roll bars and two backstays. This basic safety belts fastened and the steering wheel in its design is shown in Appendix 2, drawing 253-3. position e) The roll-cage must be made of steel tubes with d) There must be an external switch to activate a diameter of 1.5 – 2 inches and have a thickness WKH V\VWHP WKDW PXVW EH FOHDUO\ LGHQWL¿HG ZLWK of 0.089" - 0.095" (13 gauge). the red letter "E" inside a white circle with a red f) Any car whose total weight exceeds 3,100 lb. border. It must have a minimum diameter of 10 (1,361 kg.) must have a 2-inch diameter steel cm (4 inches). roll-cage which must have a thickness between e) The system must be functional in all positions. 0.089" - 0.095" (13 gauge). f) The sprinkle nozzles must be appropriate for g) 7KH UROOFDJH PXVW EH ¿UPO\ Dႈ[HG WR WKH the extinguisher agent and must be installed in chassis or the main frame of the vehicle on the a way that they do not point directly at the heads most resistant points with four auto-locking screws and faces of the occupants. or adjusted with lock washers. The screws must have an M8 minimum diameter and a minimum 20.3. Roll-Cage quality of 8.8 (ISO standard). The roll-cage must (for all categories) be welded with the best quality welding possible. a) The use of a roll-cage is mandatory for all cars. The contact area of the plate that is screwed to The Organizing Committee must approve the roll- WKHFKDVVLVDQGLVXVHGWRDႈ[WKHVL[SRLQWVRI 49 La Carrera Panamericana RULE BOOK 2020
the roll-cage must not be smaller than 120 cm2, car is rolled over. and the thickness of the plate must not be less d) The safety net must be able to be released than 3 mm. The placement of the plate can be with only one hand. The release handle must be seen in Appendix 2, drawings 253-51, 253-52 and painted with a bright color, such as orange for 253-57. HDV\ LGHQWL¿FDWLRQ 7KH XVH RI D TXLFNUHOHDVH h) The main arch must be vertical, it must be one button is permitted but it must be of bright color piece and without any wrinkles where it bends. with a label that reads "press". The upper part of the arch must be well above e) 7R Dႈ[ WKH VDIHW\ QHW WR WKH UROOFDJH RQO\ the helmets of the competitors and as close as screwed fasteners are permitted. Under no possible to the bodywork. FLUFXPVWDQFHV FDQ WKH UROOFDJH EH PRGL¿HG WR i) A diagonal member must be placed to form an Dႈ[WKHVDIHW\QHW integral part of the main arch. This is shown in f) For all open cars, the use of arm restraint straps Appendix 2, drawings 253-4, 253-5 y 253-7. for competitors is mandatory. j) Two door bars must be added (one on each side g) Arm restraint straps must be fastened to the of the car). This is shown in Appendix 2, drawings safety belt buckle. Once the restraint straps 253-9, 253-10 y 253-11. length is measured when the driver is seated, k) Additionally, a roof reinforcement must be the driver needs to ensure that he/she can reach placed on the upper part of the cage, forming an the steering wheel and all controls comfortably. "X" between the main arch and the front arch. Likewise, the co-driver must adjust the length of This is shown in Appendix 2, drawings 253-12, the restraint straps so that he/she can reach the 253-13 y 253-14. measuring devices and any other elements that l) An additional member must be placed between need to be operated within the car. WKHEDFNVWD\VZKLFKFDQDOVREHXVHGWRDႈ[WKH h) These restraint straps must be used according safety belts. This is shown in Appendix 2, drawing to the manufacturers’ instructions, without 253-66. PRGL¿FDWLRQVDQGZLWKRXWDQ\PLVVLQJSLHFHV WKH m) It is mandatory to drill a hole of 1/8" in all HႇHFWLYHQHVV DQG ORQJHYLW\ RI WKH DUP UHVWUDLQW the main tubes and members of the roll-cage. straps are directly related to the manner in which These holes must not be less than 10 cm. from they are installed, used and maintained). the welding, from where there are screws or from i) These restraint straps must be in good operating where there is a bend in the tube. These holes condition and made from the best quality materials. serve to verify the thickness of the tubing. j) It is up to the Scrutineering Director to determine whether the safety nets or arm restraint straps 20.4. Arm protection elements are suitable or not and if they can perform their (for all categories) intended function and ensure the safety of the a) All closed cars are required to have and use competitors. Not complying with these safety ODWHUDOVDIHW\QHWVWKDWPXVWEH¿[HGWRWKHUROO dispositions will cause the car to be excluded cage or bodywork. from the event. b) The safety nets must be made of interwoven VWULSV RI D ¿UH UHVLVWDQW PDWHULDO DQG PXVW EH 20.5. Safety belts sewn together at each cross point with a minimum (for all categories) width of 19mm (3/4"). The safety nets must not a) The use of safety belts with a harness is be temporary in nature or purpose. The mesh mandatory. An internationally recognized sporting must have a minimum width of 25 x 25 mm and a authority such as FIA, SFI, must homologate all maximum width of 60 x 60 mm. VDIHW\EHOWV7KHEHOWVFDQQRWEHPRGL¿HGLQDQ\ c) 7KH VDIHW\ QHWV PXVW EH Dႈ[HG WR WKH UROO way. In the case of FIA homologation, they must cage above the windows of the occupants and be meet the No 8853/98,8854/98. or 8853-2016 FIA Dႈ[HGE\DTXLFNUHOHDVHV\VWHPHYHQZKHQWKH standards, for SFI homologation, will be SFI 16.1. 50 La Carrera Panamericana RULE BOOK 2020
Appendix 2 shows the valid labels for the belts RUPLVVLQJSDUWV WKHHႇHFWLYHQHVVDQGORQJHYLW\RI that can be used in the event. the safety belts are directly related to the manner b) Five-point belts are mandatory: two straps for in which they are installed, used and maintained). the shoulders, two straps for the abdomen and i) The belts must be replaced after a serious one strap for the crotch from the pelvis to the accident or if they are cut, frayed, weakened by ÀRRU7KH VDIHW\ EHOWV PXVW EH HTXLSSHG ZLWK D the action of sunlight or chemical products or if turnbuckle release system. The belts must be 3 the width of the belts is uneven (meaning that the inches wide (narrower belts are not accepted) VDIHW\ EHOWV KDYH EHHQ VXEMHFW WR D VLJQL¿FDQW and not older than 5 years from the date of amount of strain beyond what is considered manufacture. The safety belts must have a label normal use or that they have been involved in a indicating the manufacture date. serious accident). They must also be replaced if c) For the correct positioning of the safety belt, the metal parts or buckles are deformed, bent or shoulder straps should be directed back and corroded. Any malfunctioning safety belt must be down and must be installed in such a way that replaced. they do not form an angle greater than 45° from j) Any safety belt, based upon the sole judgment the horizontal, from the top edge of the backrest, of the Director of Scrutineering that is obsolete even though it is recommended that this angle or is not properly working must be immediately should not exceed 10°. To secure the shoulders' replaced, either before the start of the event or straps, these may be installed on the rear seat after an accident. Failure to comply with this lap strap anchor points originally mounted by the rule will result in the exclusion from the event or car manufacturer. They may also be anchored to not being able to continue in the race after an the additional member between the backstays of accident, if the seat belt is not properly replaced. the roll-cage (Appendix 2, drawing 253-66). The shoulders straps must be installed crosswise 20.6. Seats symmetrically in relation to the centerline of the (for all categories) front seat. a) All seats of the passengers must be homologated d) It is prohibited for the seat belts to be anchored by a sporting authority recognized internationally to the seats or their supports. A safety harness may (such as FIA, SCCA, SCORE, etc.) and cannot be be installed on the anchor points of a production PRGL¿HG,IWKHVHDWVRIWKHFRPSHWLQJFDUIROORZ car. The recommended geometrical locations the FIA rules, the original seats must be replaced of the anchor points are shown in Appendix 2, by homologated bucket seats in accordance with drawings 253-61 and 253-62. the 8855/1999 or 8862/2009 standards. e) 7KH DEGRPLQDO VWUDSV PXVW ¿W WLJKWO\ LQ WKH In Appendix 2 the valid labels for the seats that bend between the pelvic crest and the upper can be used in the event are shown. thigh. Under no conditions must they be worn b) The use of the homologated seats with the over the region of the abdomen. The belts must be VWDQGDUGLVOLPLWHGWR¿YH\HDUVIURP anchored to the original anchor points of the front the date of manufacture indicated on the label and seats, originally mounted by the car manufacturer. may be used for two more years if the manufacturer If that is not possible, the abdominal straps can authorizes it by issuing an additional label for this be anchored to the frame or chassis of the car. purpose. If the homologation complies with the f) The crotch strap must be attached to the 8862/2009 standard, the limit for usage is for 10 ÀRRUZLWKVFUHZVDQGWRDSODWHRIDWOHDVWPP years. thickness to reinforce the anchorage. c) The attachment method of the seat must be g) When the straps are attached by screws, an approved by the Organizing Committee during insert must be welded for each mounting point, scrutineering. If it is not approved, the car will as it is indicated in Appendix 2, drawing 253-67. be excluded from the event. It is recommended h) Safety belts must be used according to the that the participant submits to the Organizing PDQXIDFWXUHUV¶LQVWUXFWLRQV ZLWKRXWPRGL¿FDWLRQV Committee all related documentation and 51 La Carrera Panamericana RULE BOOK 2020 information about the seats used, such as the EHGLVTXDOL¿HGIURPWKHVWDJH manufacturer, date of manufacture and installation details of the seats, in order for it to be authorized 20.9. Helmets & Head and Neck Support Device or recommendations made to help the approval (for all categories) process. Appendix 2, drawings 253-65 show an a) It is mandatory for all competitors (drivers and example of the anchorage of the seats. co-drivers) to use a helmet that meets one of the d) 7KH VHDWV PXVW EH ¿[HG DQG DQFKRUHG LQ IROORZLQJ VSHFL¿FDWLRQV ),$ accordance with the above paragraph. It must not 2010, 8860-2015, 8859-2015, 8858-2002 or 8858- be a reclining seat and the use of rails to move 2010. Snell Foundation SA2005, or SA2010 also the seats is forbidden. 6),$R6),$$QRQFHUWL¿HG KHOPHW e) Kirkey brand seats are permitted. will cause the exclusion of a team from the event. b) $OO KHOPHWV PXVW EH YDOLG EH OHVV WKDQ ¿YH 20.7. Electric equipment (for all categories) years old from the manufacturing date, and must a) Headlamps must be turned on at all times have a label that shows the original manufacturing during the entire stage. date. Appendix 2 shows valid labels for helmets b) Intermittent emergency lights that work properly. that may be used in the event. c) )URQW DQG UHDU WXUQ VLJQDO ÀDVKHUV WKDW ZRUN c) For all open car competitors, the use of full- properly face helmets is strongly recommended. d) 6WRS%UDNHOLJKWVWKDWZRUNSURSHUO\ d) All helmets must be in good shape and in working e) Air horns that work properly. condition. If during scrutineering a non-valid or f) Windshield wipers that work properly. damaged helmet is detected, the competitor must g) 7KH FDU PXVW KDYH D PDLQ FXW Rႇ VZLWFK LQ replace it and show it to scrutineering again before a visible spot installed on the outside of the being allowed to start. bodywork. e) SM HOMOLOGATED MOTORCYCLE HELMETS ARE NOT ALLOWED. Competitors 20.8. Mandatory emergency equipment wearing this type of helmets will not be allowed (for all categories) to start and will be excluded from the event until a) It is mandatoryWRKDYHWZRZDUQLQJUHGÀDJV they wear an authorized helmet. (30X40 cm.) on board in case of an accident. f) The helmet must bear the name, blood type, RH b) Two belt cutters must be always on board and factor and known allergies of the competitor. This must be easily accessible to the driver and co- is a mandatory requirement. Failure to comply will driver when seated with their harnesses fastened. result in the exclusion of the competitor from the 7KH FXWWHUV PXVW EH ¿[HG LQ VXFK D ZD\ WKDW event until compliance. they cannot be released or be a danger to the g) Switching helmets without notifying the Director occupants. Appendix 2 shows a picture of the of Scrutineering or using a non-compliant helmet cutters that must be used that serve to cut the ZLOOUHVXOWLQGLVTXDOL¿FDWLRQIURPWKHVWDJHZKHUH belts when the release mechanism does not work the fault was detected. or in case of an accident. h) The use of head and neck support devices c) A working hand-held battery-operated lamp. +DQV GHYLFH /($77%UDFH HWF RU VLPLODU d) Two soft cervical collars must be on board (one homologated devices by an internationally for each competitor). It is also recommended to recognized sporting authority (such as FIA, SCCA, FDUU\DFRPSOHWH¿UVWDLGNLW SCORE, etc) is mandatory. The device cannot be e) Spare wheel and tire. PRGL¿HGLQDQ\PDQQHU7KHVHGHYLFHVPXVWEH f) Jack. SFI 38.1 or FIA A 8858 2002 also FIA A 8858 2010 g) A VHF radio operating at frequencies between Any competitor who does not present this safety 144 and 148 MHz, which is only for emergency devise at scrutineering they will not be allowed to use. If used for any other purpose, the team will start. In Appendix 2 the valid labels for the head 52 La Carrera Panamericana RULE BOOK 2020 and neck support device that can be used in the valid labels for the shoes that can be used in the event are shown. event. h) *ORYHV PXVW EH ¿UH UHWDUGDQW DQG RI UDFLQJ 20.10. Clothing/Overall (for all categories) type. a) 7KHXVHRIDQRYHUDOO 1RPH[ PDGHIURP¿UH resistant material is mandatory for all competitors 20.11. Compliance and they must wear it always while driving. All To ignore any of the safety mandatory requirements clothing must be homologated by an internationally indicated in this Article, will cause the competitor recognized sporting authority (such as FIA, WREHGLVTXDOL¿HGIURPWKHHYHQW 6&&$ 6&25( HWF DQG FDQQRW EH PRGL¿HG in any manner. If it is FIA homologated, then the applicable standard is 8856-2000, 8856-2018. or Article 21: Safety SFI3.2A-20 Appendix 2 shows the valid labels for Recommendations the overalls that can be used in the event. Not mandatory, but strongly recommended. b) It is recommended that the overall is a three-layered unit, but two-layered ones will be 21.1. Ground clearance SHUPLWWHG2YHUDOOVPXVWEHOHVVWKDQ¿YH\HDUV It is recommended that cars have a minimum old from the manufacturing date, and must have ground clearance of 20 cm. (7.9 inches), since the label that shows the original manufacturing there are many large speed bumps along the date. route and the road conditions of the route itself c) 8VLQJ¿UHUHWDUGDQWXQGHUZHDULVPDQGDWRU\ may not be the best. d) The overalls may be rejected by the Scrutineering Director if they are already expired 21.2. Fog Lights DUH PRUH WKDQ ¿YH \HDUV ROG RU LI WKH\ DUH It is recommended to install additional fog lights to found to be unable to perform their function due the car, due to the fact that some Speed Sections WR H[FHVVLYH ZHDU RU GHWHULRUDWLRQ RI WKH ¿UH may be run where there is a possibility of fog. resistant layers. In this case, the competitor will be excluded from the event until he submits to the 21.3. Navigation equipment Scrutineer a new overall with his name labeled The use of any mechanical or electronic distance and in optimal condition for use in the competition. meter (Halda, Terra Trip, or similar), calibrated e) If the competitor presents an overall which was in kilometers is highly recommended since all authorized and after starting any of the stages it LQVWUXFWLRQVLQWKH5RXWH%RRNDUHLQGLFDWHGLQWKH is detected that the overall has been changed, the metric system. The use of a Global Positioning FRPSHWLWRUZLOOEHDXWRPDWLFDOO\GLVTXDOL¿HGIURP System (GPS) is permitted. the event. f) The overall must have the name, blood type, Rh factor and known allergies of the competitor printed or embroidered in a visible place. If this requirement is not met, the competitor will not be DOORZHGWRVWDUWXQWLOWKLVKDVEHHQUHFWL¿HG g) 6KRHVPXVWEH¿UHUHWDUGDQWDQGRIUDFLQJW\SH They must be homologated by an internationally recognized sporting authority (such as FIA, SCCA, 6&25( HWF DQG FDQQRW EH PRGL¿HG LQ DQ\ manner. If the homologation is FIA the applicable standard is 8856/2000 and for SFI the applicable standard is 3.3/5 Shoe. Appendix 2 shows the 53 La Carrera Panamericana RULE BOOK 2020
IX.- RUNNING OF THE EVENT
Article 22: Start before them, the team will be penalized with 1 minute unless the passage of the blocking vehicle is blocked and is reported at least 10 minutes a) Competing cars must be at the starting arch of before their individual start time. each stage 30 minutes before a team’s individual g) The starting arch must be passed in the correct start time and lineup according to their starting starting order and at the individual start time. If a order. At that moment, at least one member of the team passes the arch out of place in relation to its team must be present at the starting arch control starting order or its individual start time, the team to reset their chip, collect their time card of the will be penalized with 2 minutes. GD\ DQG YHULI\ WKH ORFDWLRQ RI WKH RႈFLDO ERDUG h) The marshal at the starting arch may, subject to where the bulletins are published. his criteria, start the teams before their individual It is the responsibility of each competitor to review start time. This indication must be obeyed. In this the information published in the bulletins, because case, the penalty for passing the starting arch out there may have been last minute changes or of place will not be applied, but the teams must important information. UHVSHFWWKHPRGL¿HGVWDUWLQJRUGHU b) Late arrival to the starting arch or passing i) ,IDWHDPDUULYHVGLUHFWO\DWWKH¿UVW&+&RQWURO the starting arch late (if it is not blocked in any DWWKHVWDUWRIWKH¿UVW6SHHG6HFWLRQRIDVWDJH manner), will be penalized as a "CH-P" Time without having passed through the starting arch Control (Article 24.2), up to a maximum tolerance with/without their time card; in addition to the 2 of 15 minutes. minute penalty mentioned above, the team will c) If a team arrives more than 15 minutes late to start behind all competitors that did comply with pick up its time card or to pass through the starting this requirement. The marshal at the "CH" Control arch, the penalty is 2 minutes. They will be able to will give the team a time card and their time to start the rest of the sections in its original starting VWDUWWKH¿UVW6SHHG6HFWLRQRIWKHVWDJH $UWLFOH RUGHURIWKHGD\LIWKH\DUULYHLQWLPHWRWKH¿UVW 22.2c). Control "CH" of the stage Otherwise, they must maintain for the remainder 22.1. Starting order and intervals between cars RIWKHVWDJHWKHLUSDVVLQJRUGHUDWWKH¿UVW&+ a) All competitors must know their start time and &RQWURORIWKHVWDJHXQOHVVDQRႈFHURIWKHHYHQW starting order. This information will be published PRGL¿HVWKHVWDUWLQJRUGHU,QWKLVFDVHWKHLVVXH DIWHU RQ WKH RႈFLDO ERDUG DW WKH GULYHUV shall be noted on the time card must and must be meeting the night before. VLJQHGE\WKHRႈFHU b) )RUWKH¿UVWVWDJHWKHVWDUWWLPHDQGVWDUWLQJ It is possible that for whatever reason, a team order will be published on October 10, after 02:30 cannot pick up their time card, reset their chip and at the Driver’s meeting in Oaxaca based on the know the content of the bulletins of the day; but results of the Qualifying Section. this does not justify that they do not comply with c) The exact starting times will be published information published in the bulletins. DFFRUGLQJWRWKHJHQHUDOFODVVL¿FDWLRQE\JURXSV d) The schedule for the lineup and start time of and starting order. This document will list the HDFKVWDJHLVIRXQGLQWKH5RXWH%RRN teams permitted to start, their start time and name e) The starting order and start time for each team and number of the stage. ZLOOEHSXEOLVKHGRQWKHRႈFLDOERDUGRIHDFKGD\ d) The Organizing Committee has set a starting f) All teams must strictly observe their starting interval of 30 seconds between each team. This order and not block other teams starting before interval is the same for all competing cars. them. If a vehicle blocks another team starting 54 La Carrera Panamericana RULE BOOK 2020
22.2. Passing Time Controls and lateness f) The starting interval between each team will not a) Teams must pass the Time Control posts at EHPRGL¿HGDQGPXVWEHUHVSHFWHG their designated hour, minute and second. Not complying with this will be cause for a penalization 222ႈFLDOWLPH in accordance with Article 24.2. a) Hours, minutes and seconds are always shown b) The start time for each stage is indicated on the in the following manner: 00:01:00 up to 23:59:00. time card of each team, as well as the established b) Only completely elapsed minutes are taken in time to cover the distance of each section. If this account for penalty purposes in the Time Controls. time is not adhered to, a penalty of 30 seconds c) 7KURXJKRXW WKH HQWLUH HYHQW WKH RႈFLDO WLPH will be applied plus any penalties that a team is taken from the W.W.V. station at Fort Collins, may have accumulated because of this or other Colorado, USA. actions. This is done to respect the allotted time 7KHRႈFLDOWLPHFDQEHFRQVXOWHGDWhttp://www. for each of the teams. timeanddate.com/worldclock/usa/fort-collins c) A team may arrive late to the start of a section, d) 7KHRႈFLDOWLPHRIWKHHYHQWZLOOEHDYDLODEOHIRU provided that their accumulative lateness does the competitors at the starting arch of each stage. not exceed 15 minutes, which is the maximum The people in charge of scoring who deliver the tolerance for a late arrival. If a team arrives late time cards will have a dial with the time transmitted with less than 15 accumulated minutes, the by the W.W.V. station that can be consulted by the penalty that will be applied corresponds to the competitors. "CH" Control (Article 24.2). If the accumulated time is greater than 15 minutes, 22.4. Route a team will be penalized with 30 seconds in that a) $OOWHDPVUHFHLYHD5RXWH%RRNFRQWDLQLQJD control and in each of the following Time Controls detailed description of the route that has to be ("CH-P" and "CH") until the end of that stage. Also, followed. a team will not be permitted to start the following b) Each team must complete the entire route; from Speed Sections of the stage and will be penalized WKHVWDUWLQJDUFKWRWKH¿QLVKDUFKRIHDFKVWDJH by being assigned the maximum time for each of c) If the route is not respected or not fully the remaining Speed Sections that day. completed, the penalty will be 30 seconds for the ThHWHDPVWKDWDUULYHDWWKH¿UVW&+&RQWURORI ¿UVW7LPH&RQWUROQRWSDVVHGDQGVHFRQGVIRU WKH¿UVWVHFWLRQRIWKHVWDJHZKRKDYHQRWSDVVHG each subsequent Time Control until the end of the through the starting arch, do not have their time stage. Also, a team will be assigned the maximum card, or have not reset their chip, will be penalized time given to the following Speed Sections for that with 30 seconds in that control. VWDJHDIWHUWKH¿UVW7LPH&RQWUROQRWSDVVHG d) If the marshal at the control post is not aware of the infraction (arriving late with more than 15 Article 23: Controls - General accumulated minutes) and a team starts that provisions and the following Speed Sections; the team will be penalized regardless with the maximum time 23.1. Control signals assigned to each of the Speed Sections and Time $OOSDVVDJHFRQWUROV VWDUWLQJDQG¿QLVKDUFKHVRI Controls ("CH-P" and "CH") for that day. the stage and "CH-P" Controls at the entrance and e) If the delay is less than 15 accumulated minutes, exit of the service sections); Time Controls ("CH"); a team can start the following Speed Sections with VWDUWDQG¿QLVKRID6SHHG6HFWLRQ $%DQG their newly assigned time. In accordance with this "C"), are signaled and visible in accordance with new time, the team must recalculate its time card. the control signals described as follows. If a team is delayed they must respect their new starting order and continue with it until the end of a) "CH-P" Controls: are the passage controls the stage. DW WKH VWDUW DQG ¿QLVK DUFKHV RI WKH VWDJH DW 55 La Carrera Panamericana RULE BOOK 2020
the entrance and exit of the service sections c) Once a car has entered the control area, the in addition to the Time Controls for the Transit car must pass through this control post in no more Sections followed by another Transit Section. than one minute. b) "CH" Controls: are the Time Controls at the d) It is prohibited to stop between the yellow sign end of each Transit Section. with a stopwatch and the red sign with a stopwatch. c) "A", "B" and "C" Controls: are the controls at 'LVTXDOL¿FDWLRQ FRXOG UHVXOW DV D EUHDFK RI WKLV WKHVWDUWDQG¿QLVKRIHDFK6SHHG6HFWLRQ rule. e) It is forbidden to drive in reverse within a 23.2. Signaling at the Time Controls and Speed control area. Once a competitor has entered a Sections control area, he must wait the necessary time to a) The start of the control areas is indicated cross the control post. He cannot drive in reverse by a large sign with a stopwatch on a yellow to make any sort of repairs or perform any other background, approximately 10 meters before the intervention to the car. control post. f) Infringing these rules will cause a penalization b) The control post is indicated with an identical of 2 minutes; and if repeated, the team will be sign but with blue background. GLVTXDOL¿HGIURPWKHVHFWLRQ,IWKLVLVUHSHDWHGD c) 7KH HQG RI WKH FRQWURO DUHDV LV LGHQWL¿HG E\ WKLUGWLPHWKHSHQDOW\ZLOOEHWKHGLVTXDOL¿FDWLRQ a large sign with three transversal stripes on a from the entire stage. white background, approximately 15 meters after the control post. 23.6 Time cards and actual time recorded a) At the starting arch, a team will receive a 23.3 Control areas time card with their starting time for the stage All control areas (the area between the sign in accordance with the starting order. This time with the yellow background and the one with cannot be changed and must be strictly adhered transversal stripes with a white background or the to. Each day, the time card must be handed to the RQHZLWKDFKHFNHUHGÀDJRQDJUHHQEDFNJURXQG PDUVKDODWWKH¿QLVKDUFKRIWKHVWDJH DW%&RQWURODQGWKH¿QDORQHZLWKWUDQVYHUVDO A new time card will be given to the teams at the stripes), are considered "parc fermé" (Article 26). starting arch of each stage. Each team is responsible for their time card. 23.4 Time within a control area b) The time card must be available for inspection a) The stopping time within any control area must LIUHTXLUHGE\DQRႈFHURIWKHHYHQW HVSHFLDOO\DW not exceed the necessary time for carrying out the control posts where a post marshal will write this operation properly. the time on it. The team must write their times b) Once the marshal has entered the passage in the assigned places and never in the places time on the time card the vehicle must leave the DVVLJQHGWRWKHRႈFHUV control area immediately. c) Any correction or amendment made by a team c) At the beginning of a Speed Section, the start member where they have written on the time card time will be decided by the marshal who will then in an incorrect place will cause a penalty of 10 indicate to the team when they must start from the seconds to the team; unless the correction or "A" Control. DPHQGPHQWLVGRQHE\DQDXWKRUL]HGRႈFHUZKR must then sign it. A team member may write any 23.5 Entrance to a control area observations on the back of the time card. In no The following is strictly forbidden: case may the team make any annotations on the a) To enter a control area in any direction other front of the time card. than that of the event or not passing any of the d) Each team is responsible for calculating the signs within the control area. time at which they will pass each "CH" Control. b) To re-cross a control post or to re-enter a 7KLVWLPHPXVWEH¿OOHGRXWLQWKHFRUUHVSRQGLQJ control area. blank section on the time card, (yellow column). 56 La Carrera Panamericana RULE BOOK 2020
Each team is also responsible for calculating the post marshal before handing him the time card to GLႇHUHQFHLQWLPHEHWZHHQWKH$&RQWURODQGWKH record the passage time of the car. %&RQWUROIRUHDFK6SHHG6HFWLRQ WKLVWLPHZLOO The post marshal at the Time Controls ("CH" or EHXVHGLQHDFKVHFWLRQ7KLVWLPHPXVWEH¿OOHG "CH-P") must not mention the target check-in out in the corresponding blank section on the time time or the actual time the competitor crossed the card, (orange column). control post. If a team makes an error in calculating the time At the start of a Speed Section ("A" Control), the GLႇHUHQFHV DQG WKLV DႇHFWV WKH VXP WRWDO RI WKH marshal must tell the competitor his starting time. time on the card that is used to calculate the At the Stop Control ("C" Control) the team’s car result of the stage, the penalty will be 30 seconds must stop completely to let the marshal write the per error. SDVVDJHWLPHDWWKHHQGRIWKH6SHHG6HFWLRQ % It is mandatory to hand in the time card with all Control). calculations and the sum of the accumulated times of the stage at the entrance to the service 23.7 Opening and closing of control posts VHFWLRQDQGDWWKH¿QLVKDUFKRIWKHVWDJH,IWKLV The control posts must be ready to operate 15 is not done, the penalty will be 1 minute for each minutes before the target passage time for the instance. If one of the additions is incorrect it will ¿UVWWHDPDQG¿QLVKLWVRSHUDWLRQPLQXWHVDIWHU be considered as a calculation mistake and a WKHSDVVDJHRIWKHODVWFODVVL¿HGWHDPIRUWKHGD\ penalty of 30 seconds will be applied. 7KHODVWWHDPRIHDFKVWDJHZLOOEHLGHQWL¿HGRQ ,IDWLPHHQWU\LVQRW¿OOHGLQE\DSRVWPDUVKDODW the start list of each day. a Time Control; if a card is not handed in on time at a post control because of the team’s fault, or if Exceptions: WKHWLPHFDUGLVQRWKDQGHGLQDWWKH¿QLVKDUFK a) ,I WKH &OHUN RI WKH &RXUVH JLYHV D GLႇHUHQW even though the car did not pass on time or the indication. team lost the time card; a 1 minute penalty will be b) Even if a team arrives at the control post, the applied. marshals must conclude their functions exactly e) The recorded times of the Speed Sections are PLQXWHVDIWHUWKHSDVVDJHRIWKHODVWFODVVL¿HG an important element of the time cards and are team.. subject to the aforementioned penalties. f) A team is responsible for handing in the time 23.8 Instructions from the post marshals FDUGDWWKHGLႇHUHQWSRVWFRQWUROVDQGWRYHULI\WKDW The teams must always follow the instructions of the marshals have written the times. the post marshals. Failure to do so may lead to g) It is up to a team to decide the moment that they penalties and even GLVTXDOL¿FDWLRQ, at the sole will give the time card to the post marshal so that discretion of the Steward of the Meeting. The he can register their time on the time card. The minimum penalty is 2 minutes. The marshal's team members must verify that the time recorded UHSRUWLVVXႈFLHQWWRDSSO\WKHSHQDOW\ by the marshal is correct. The post marshal is the only person authorized to ,GHQWL¿FDWLRQRIWKHSRVWPDUVKDOV write the time on the time cards. $OOWKHURDGDQGSRVWPDUVKDOVDUHLGHQWL¿HGE\ If there is a discrepancy between the time written RႈFLDO VKLUWV RU YHVWV DQG DQ LGHQWL¿FDWLRQ FDUG E\WKHRႈFHUDQGWKHWLPHUHJLVWHUHGE\WKHWHDP that they must wear at all times during the stage. member, he/she can make a written observation on the back of the time card and let it be known to the post marshal himself as well as to the Clerk of the Course at the end of the stage. h) Recording the target check-in time at the Time Controls ("CH" or "CH-P") is the responsibility of the team. They may consult the clock of the 57 La Carrera Panamericana RULE BOOK 2020
Article 24: "CH-P" Passage 1RWFURVVLQJWKH¿QLVKDUFKRUFURVVLQJWKHDUFK controls 6WDUW DQG ¿QLVK DUFKHV outside of the time limit mentioned above will of a stage and Transit Sections) - incur a penalty of 2 minutes. Delay / Abandonment 24.2. Time Controls 24.1. Passage Controls: "CH-P" $WWKHWLPHFRQWUROV &+ WKHFRQWURORႈFHUPXVW 7KH VWDUW DQG ¿QLVK DUFKHV RI D VWDJH DQG WKH enter the time of passage through the control on controls at the entrance and exit of the service the Time Card and record the time on the chip as areas are referred to as "Passage controls" where soon as one of the competitors delivers them or the following procedure applies: when the front tire of the competing car physically passes through the post control, even if the Time a) The start of a stage (starting arch): "CH-P" Card has not been delivered to the post marshal. . Control. The starting order and the start time must be Check-in procedure at a Time Control respected. It is forbidden to block the path of other competitors starting before. a) The check-in procedure begins the moment a 7KH UHFRUGLQJ RI KLVKHU RႈFLDO WLPH EHJLQV team enters a control area. the moment the starting arch is crossed. The b) To have the time recorded at the post control by competitor may only cross the arch before or after a marshal, it is required that both team members his/her previously designated starting time, only if (driver and co-driver) are inside the competing the marshal requests him to do so. car and in front of the control signal. Not passing through the arch or blocking another c) When the control area is occupied with other competitor will be penalized in accordance with cars and it is impossible for the vehicle to enter, Article 22. one of the team members must get out of the car b) Service areas: "CH-P" Control. and walk to the post control, wait for his time and At these points it is permitted to arrive before the give their time card and chip to the post marshal designated time without penalties and up to a so that he can record the passage time on his maximum of 15 minutes late. A team arriving later control sheet (yellow column) and on the time than this will be penalized in accordance with card of the team. Articles 24.2 and 24.3. If several competitors are doing this procedure at For leaving the service area, the estimated time the same time, the post marshal will assign the of the Time Card must be considered without time to the teams based on their order of arrival, considering whether the entry was advance or taking into account and making any necessary delayed. DGMXVWPHQWV WR WKH ¿QDO UHFRUGHG WLPH IRU WKH F (QG RI WKH VWDJH ¿QLVK DUFK &+3 amount of time it took to complete the check-in Control. procedure. The complete team (driver and co-driver) and the d) The check-in time recorded at a post control is competing car must pass through the arch by its written on the control sheet and on the team’s time own means and one of the team members must card. The recorded time must include minutes provide their time card to the post marshal, and and seconds. WKLV PHDQV WKH WHDP RႈFLDOO\ SDVVHG WKH DUFK e) A team will not incur a penalty if the vehicle control. At each end-of-stage arc there shall be enters a control area 1 minute before the D SURSHUO\ LGHQWL¿HG DQG YLVLEOH FRQWURO RႈFHU scheduled check-in time or 59 seconds past this who will take the time of each team upon passing time. through the arch. f) A team will not be penalized for lateness if they No penalties will be applied if the car arrives 15 hand their time card to the post marshal within 59 minutes early or late. seconds of the target check-in time if the marshal is busy registering a team who arrived before them. 58 La Carrera Panamericana RULE BOOK 2020 g) In the case of handing in their time card before second interval in order to coincide with the target the target time (in the minute preceding the target check-in time). time or even before), a team will be penalized 15 b) Conversely, when a Time Control ("CH") is seconds for every minute early. If a car arrives followed by a start control for a Speed Section, more than 5 minutes early, the penalty will be 5 the following procedure will be applied: minutes. b.1) The two posts ("CH" and "A") are included h) If a team arrives at the control post so far ahead in a single control area and the signs which are of the scheduled time that the control marshals used will be the following (Article 23.3): are not yet in their positions, the team must wait • Yellow sign with a stopwatch: the beginning for their scheduled check-in time and give the of a control area. marshals enough space to continue setting up the • Red sign with a stopwatch (control post) control area in order to have their passage time located at a distance of approximately 15 recorded. meters: "CH" Control. i) If the Time Card is presented after the target • 5HG VLJQ ZLWK D ÀDJ VWDUW RI D 6SHHG time (after 59 seconds or more of the target time Section) located at a distance of 50 - 150 have elapsed), the team will be penalized with 5 meters: "A" Control. seconds for each minute late. If a team’s delay is • White sign with three transversal stripes more than 15 accumulated minutes, the penalty located about 15 meters further on: end of will be the GLVTXDOL¿FDWLRQ from the stage, plus 30 a control area. seconds in that control, plus the time indicated in b.2) $WD7LPH&RQWUROSRVWDWWKH¿QLVKRID Article 24.3. Transit Section ("CH"), the post marshal will write on the time card a team’s check-in time Example: and the provisional start time for the following 1. If a team must check-in at a control post at Transit Section, (start of a Speed Section at an 10:23:00, the check-in will be considered "on "A" Control). The ideal time between these two time" and no penalties incurred if the check-in controls is 3 minutes. takes place between 10:22:01 and 10:23:59. The time between the "CH" and the "A" Controls 2. If a team must check in at a control post at PD\ EH GLႇHUHQW PRUH RU OHVV PLQXWHV 15:18:30, the check-in will be considered "on The post marshal at "A" Control will make the time" and no penalties incurred if the check-in decision. takes place between 15:17:31 and 15:19:29. b.3) Considering that a control area is deemed The teams must comply with this check-in "parc fermé", if any repairs are needed, these procedure, especially when entering a control must be done before entering the control area area (maximum one minute before the target or after leaving it (Article 26). check-in time). The post marshal must make a b.4) Immediately after checking-in at a Time written report to the Clerk of the Course indicating Control, a team must go to the start of the which teams do not comply with this procedure. Speed Section. The marshal at "A" Control will These teams will be penalized with 30 seconds. enter the anticipated start time on the time card A report from the marshal is enough to apply the and on his control sheet. He will then start the penalty. team according to the procedure in Article 25.4. b.5) ,W PLJKW EH D GLႇHUHQFH EHWZHHQ WKH Time for leaving controls: originally anticipated time and the actual start a) If the next section does not begin with a Speed time of a Speed Section. The actual starting time Section, the Time Control ("CH-P") will be valid for RIWKH6SHHG6HFWLRQ PRGL¿HGE\WKH&RQWURO both sections and the check-in time entered on 2ႈFHU$DQGZULWWHQRQWKHFRPSHWLWRU V7LPH the time card will constitute both the arrival time &DUG ZLOOEHWKHRႈFLDO at the end of the Transit Section and the start time of the following section (rounded up to the next 30 59 La Carrera Panamericana RULE BOOK 2020
24.3. Delay / Abandonment Section B In case of abandonment or delay, the following - Start at "A" Control: 13:08:00 (3 minutes after will apply: passing through control "CH" or the time assigned a) Any lateness exceeding 15 accumulated by the post marshal) minutes on a stage at a Time Control or not - Time to cover the section: 1:30:00 reporting to a Time Control will incur a penalty of - Target check-in time at "CH" Control: 14:38:00 30 seconds at that Time Control. - Actual check-in time: 14:36:00 (new time for b) Additionally, a team will be penalized in the recalculation - 2 minutes early) following sections up until the end of the stage, (Article 22) with the maximum time assigned to Penalty: 2 minutes early: 15 second penalty for each Speed Section + an additional 30 seconds each minute = 30 seconds. at that Time Control. Section C Example: - Start at "A" Control: 14:39:00 (3 minutes after Section A passing through "CH" Control or the time assigned - Start at "A" Control: 12:00:00 by the post marshal) - Time to cover the section: 1:00:00 - Time to cover the section: 2:00:00 - Target check-in time at "CH" Control: 13:00:00 - Target check-in time at "CH" Control: 16:39:00 - Actual check in time: 13:15:01 (more than 15 - Actual check-in time: 16:41:00 (new time for minutes late) recalculation - 2 minutes late) Penalty: 2 minutes late: 5 second penalty for each Penalty:GLVTXDOL¿FDWLRQIURPWKLVFRQWURORQZDUGV minute = 10 seconds. for the rest of the stage and 30 seconds in that 7RWDO SHQDOWLHV LQ 7UDQVLW 6HFWLRQV $%& control. (Articles 22, 24.2 and 24.3) (30)+(25)+(10) = 65 seconds. c) If a team accumulates delays that exceed 15 minutes in one or several controls, it will be e) Any team unable to complete a Speed Section GLVTXDOL¿HG for the rest of the stage, but can will still have the possibility to rejoin the event for be readmitted to the race in the following stage the following stage. without incurring any additional penalties, if f) If a team is unable to report to a Time Control, requested to the Clerk of the Course. (Item "f" of arrives more than 15 accumulated minutes late this Article). or is unable to continue in the event; it may be Under no circumstance can an early arrival at d) UHDGPLWWHGDQGUHFODVVL¿HGLQWKHIROORZLQJVWDJH a Time Control be used as means of reducing the with any penalties accrued from the previous day minutes of delay a competitor has accumulated. if the team complies with the following: Penalties for early or late arrival are calculated as f.1) The Clerk of the Course is informed in follows: writing of their intention to continue in the event. f.2) 7KHQRWL¿FDWLRQLVGHOLYHUHGZLWKLQKRXUV Example: SDVWKLVWDUJHWWLPHRISDVVLQJWKH¿QLVKDUFK but under special circumstances, a maximum Section A of 30 minutes before the publication of the - Start at "A" Control: 12:00:00 provisional results of the stage of the day. - Time to cover the section: 1:00:00 A team must take their car in "competition - Target check-in time at "CH" Control: 13:00:00 f.3) - Actual check-in time: 13:05:00 (new time for FRQGLWLRQWRWKHVFUXWLQHHULQJRႈFHUVDWOHDVW recalculation - 5 minutes late) 30 minutes before the start of the following stage when they arrive at the formation area. Penalty: 5 minutes late: 5 second penalty for each f.4) If an accident happened, both the Director minute = 25 seconds. RI6FUXWLQHHULQJDQGWKH&KLHI0HGLFDO2ႈFHU 60 La Carrera Panamericana RULE BOOK 2020
must authorize the car and the competitors for Article 25: Speed sections them to be able to restart in the competition. Not having this approval, the car and/or the 'H¿QLWLRQ FRPSHWLWRU V ZLOOEHGLVTXDOL¿HGIURPWKHHYHQW Speed Sections are speed tests on roads closed g) If a team does not inform the Clerk of the VSHFL¿FDOO\IRUWKHHYHQWDQGDUHDOZD\VIROORZHG Course of their intention to continue, he/she will by a Transit Section. Speed Sections on racetracks not be assigned a start time and therefore cannot are subject to the same rules as those that apply FRQWLQXHLQWKHUDFHDQGZLOOEHGLVTXDOL¿HG to the open roads. Conversely, if he informs the Clerk of the Course on time and depending on the category where he 25.2. Required safety equipment is entered; he/she may be assigned a start time In special stages, all crew members must wear based on safety reasons for the other competitors, hHOPHWVKHDGDQGQHFNSURWHFWRUV¿UHUHVLVWDQW even it means that the team’s start time (taking clothing and approved safety seat belts and into account their time and penalties) is before window side nets properly installed; if not the team their corresponding position. FRXOG EH GLVTXDOL¿HG IURP WKH HYHQW &KDSWHU ,IWKH&OHUNRIWKH&RXUVHLVQRWL¿HGLQZULWLQJRQ VIII). the same day; but after the time limit has passed, a team may start the following stage only with the 25.3. Direction of the event authorization from the Clerk of the Course and It is forbidden to drive in the opposite direction of the Steward of the Meeting. The team will start that of the event. Doing so will result in the after all the teams who were given a start time. In LPPHGLDWHGLVTXDOL¿FDWLRQIURPWKHHYHQW this case, the Clerk of the Course must sign the time card. 25.4. Start of a Speed Section h) If a team arrives at the start of the next stage The start of a Speed Section will be according to without a start time and starting order, under no the following procedure: circumstances will the team be permitted to start, (even if the car is in racing condition), they will not When a vehicle has stopped in front of the "A" be given a time card. Control sign, the marshal will enter the scheduled If under these circumstances, a team arrives start time of the car on the control sheet and verify DWWKH¿UVW&+&RQWURORIWKHGD\DQGWKHSRVW that the time on the time card is the same. The marshal allows the team to start (because he was marshal will make any necessary changes (e.g. if not aware of the circumstances), the team will still there is a delay in the start) if needed and return it be GLVTXDOL¿HG from the event, because they are to the competitor. At that moment, the marshal will acting in an unsporting manner. start a countdown aloud indicating 15 seconds i) For each Speed Section not completed or to start, then 10 and the last 5 seconds will be not started, a team will be given a maximum counted down one by one. At the end of the last pre-established time, set by the Organizing VHFRQGV WKH RႈFHU ZLOO JLYH WKH VWDUW VLJQDO Committee. This time consists of a penalty of the E\UHPRYLQJWKHZLQGVKLHOGÀDJDQGWKHYHKLFOH Speed Section not completed or not started and should start immediately. will be equal to the best time of their category + 2 minutes, + any penalties corresponding to the If a team does not immediately start the Speed Time Controls where the team did not pass. Section due to technical problems (e.g. engine or ,QWKHHYHQWWKDWQRWHDPRIWKHFDWHJRU\¿QLVKHG gearbox problems), the competitor must get out the Speed Section, the penalty will be the worst of the car and push it, even requesting help from time of the immediate higher category + 1 minute third parties in order to leave the control area and or the Steward of the Meeting will decide on a not block the path of the other competitors. If the WLPHWKDWZLOOEH¿QDODQGQRWRSHQWRDSSHDO car needs repairs, these must be done only with 61 La Carrera Panamericana RULE BOOK 2020
the equipment on board. In this case, the penalty word "ALTO" on a red background), is forbidden is 30 seconds (Article 26.4). and will be penalized with 1 minute.
Under no circumstances can a Speed Section be ,QWKH6SHHG6HFWLRQVLQDQUDFHWUDFNWKHÀDJZLOO initiated without complying fully with the safety not be waved at the end of the section. Only the measures (use of crash helmets, protection for FKHFNHUHGÀDJVLJQDOZLOOEHSODFHGRQDJUHHQ KHDG DQG QHFN ¿UHUHVLVWDQW FORWKLQJ DQG VHDW background in the exit lane of the section. It is belts fastened). If a competitor starts a Speed the responsibility of a team to keep track of the Section without meeting these requirements, the distance of the Speed Section and to know when penalty will be the immediate GLVTXDOL¿FDWLRQ from they must leave the track once they have covered the event. the required distance.
If the competitor commits this fault but stops when 7KHPDUVKDODW%&RQWUROZLOOWDNHWKHWLPHZKHQ leaving the Control Zone, and in view of the a team crosses the control post at the exit lane as marshal corrects the error, the penalty will be 5 WKH\DUH¿QLVKLQJWKH6SHHG6HFWLRQDQGOHDYLQJ minutes. In any of these cases, a marshal's report the track. The marshal will then inform the "C" is enough to apply the penalty. Control who will then write the time on the time card. A driver can learn about the last minute conditions The timing of the Speed Sections on the roads is of a Speed Section by reviewing the notices GRQH ZKHQ WKH YHKLFOH FURVVHV WKH OLQH DW % published on the notice board at Control "A". Control as indicated by a marshal waving a The signals that can appear on these notices FKHFNHUHG ÀDJ 7KH PDUVKDO ZLOO WDNH WKH WLPH are shown in Appendix 5. These signals will when the car crosses the control post and then be explained during the Instructions to Drivers inform the "C" Control who will then write the time Meeting, (Chapter III-Program). on the time card.
25.5. Delay of a start $WDGLVWDQFHRIWRPHWHUVDIWHUWKH¿QLVK The start of a Speed Section may only be delayed OLQH DW % &RQWURO WKH WHDP PXVW FRPH WR D by the post marshal at "A" Control only in a case complete stop and report to the "C" Control at the of "force majeure" or due to instructions from the red "ALTO" sign (stopping point), to have their Clerk of the Course. ¿QLVKLQJWLPHZULWWHQRQWKHLUWLPHFDUG
25.6. False start ,IWKH%&RQWUROFDQQRWLQIRUPWKH&&RQWURORI A false start of a special stage made before a DWHDP¶V¿QLVKLQJWLPHRIDVSHFLDOVWDJHWKH% marshal has given the starting signal will be &RQWUROZLOOWDNHWKHWLPHDWWKH¿QLVKOLQHDQGWKLV penalized with 5 seconds for each second will be the time that will be recorded on the team’s advanced. This penalty does not exclude time card. If it is impossible for the "C" Control additional stronger penalties that could be applied WRREWDLQWKH¿QLVKLQJWLPHRIWKHVSHFLDOVWDJH by the Steward of the Meeting, especially if the the marshal must sign the time card and the team fault is repeated. To apply this penalty, a report must continue with the scheduled Transit Section. from the marshal at "A" Control is enough. 25.8. Time not recorded 25.7. End of a Speed Section If through the fault of a team, the registered time 6SHHG6HFWLRQVHQGDWWKH%&RQWURO¿QLVKOLQH cannot be recorded on their time card (in any as indicated by a marshal waving a checkered type of control post), a penalty of 1 minute will be ÀDJ DQG D VLJQ RI D FKHFNHUHG ÀDJ RQ D JUHHQ imposed. (Article 23.6.d). background. Stopping between this green sign If a team does not stop at a "C" Control, but he and the stop sign at "C" Control (a sign with the does stop further down the road, he must proceed 62 La Carrera Panamericana RULE BOOK 2020 to leave the control area, as he is not allowed to 25.12. Interruption of a Speed Section. drive in reverse within this area. A competitor When a Speed Section is stopped for whatever must get out of the car and walk to the control reason before the last team has completed the full post to give their time card to the marshal. In this GLVWDQFHDFODVVL¿FDWLRQIRUWKDWVHFWLRQPD\EH case, a penalty will not be applied. If he drives established by giving to each team that is unable in reverse within the control area, the penalty will to complete the stage a pre-established time. EH WKH GLVTXDOL¿FDWLRQ IURP WKH VWDJH IURP WKDW control post onwards. To apply this penalty, a The assigned time will be the same for each of report from the marshal at "C" Control to the Clerk WKHWHDPVLQDVSHFL¿FFDWHJRU\DQGFRUUHVSRQG of the Course is enough. to the slowest time set by a competitor of that category under normal racing conditions before On a racetrack, if a team covers less distance the interruption occurred. than the indicated amount (a team missed one or more laps), the Speed Section will be considered 7KLV PRGL¿HG FODVVL¿FDWLRQ PD\ EH HVWDEOLVKHG DV QRW ¿QLVKHG DQG WKH WHDP ZLOO UHFHLYH WKH even if only one team was able to complete the "maximum time assigned for a Speed Stage" full distance under normal racing conditions. (Articles 24.3.i and 25.14), which is the time of a Speed Stage + 2 minutes; but, because it is held Only the Steward of the Meeting may make this on a racetrack the team will be penalized with 1 decision once the Clerk of the Course has additional minute (total: 3 minutes). informed him of the reasons for the interruption.
If a team does more laps, the time that will be Should the Steward of the Meeting consider the recorded is the time from the last time that the slowest time set as abnormal, he may choose WHDPSDVVHGWKURXJKWKH%&RQWURO,QWKLVFDVH another competitor’s time which seems the most the penalty corresponds to the additional time suitable for this purpose. that the team did to cover the extra laps. It is the responsibility of a team to do the exact number of No team that is totally or partially responsible for ODSVRIWKHWUDFNDVLQGLFDWHGLQWKH5RXWH%RRN VWRSSLQJDVHFWLRQPD\EHQH¿WIURPWKLVPHDVXUH If this is the case, the team will be assigned the 25.9. Time format maximum time for that Speed Section, (Articles The time recorded by the teams at each Speed 24.3.i and 25.14). Section will be expressed in hours, minutes and seconds (or points). Any time penalties, (technical, 25.13. Not starting a Speed Section Time Controls, etc.), will be added to this time to Any team that does not start a Speed Section at obtain the total accumulative time. the time and in the position indicated to them by the post marshal will be penalized 2 minutes. 25.10. Assistance from third parties %\ H[FHSWLRQ DQG DFFRUGLQJ WR $UWLFOH 25.14. Maximum time assigned to a Speed assistance by third parties during Speed Sections Section. is permitted only in the case that a car needs to The Organizing Committee will decide the be moved if it poses a dangerous obstacle to the maximum time assigned for each special stage other competitors on the route. according to the following criteria: 25.11. Starting intervals ,IDWHDPGRHVQRW¿QLVKRUVWDUWD6SHHG6HFWLRQ The starting intervals for Speed Sections are the the time assigned to them will be the best time same as for any other section: 30 seconds. recorded in their category + 2 minutes.
63 La Carrera Panamericana RULE BOOK 2020
Example: c) IQ WKLV FDVH D WHDP PXVW REH\ WKH RႈFHU V - Fastest time registered by a competitor of the request to repair the car. If the competitor does not same category: 10:23 minutes. obey this indication, the penalty will be 2 minutes. - Penalty: 2 minutes $QRႈFHU VUHSRUWLVHQRXJKWRDSSO\WKHSHQDOW\ - Maximum time assigned for that Speed Section: 12:43 minutes 26.3. Exceptions %\ H[FHSWLRQ DQG XQGHU WKH VXSHUYLVLRQ RI WKH ,QWKHHYHQWWKDWQRWHDPRIWKHFDWHJRU\¿QLVKHG FRUUHVSRQGLQJ RႈFHU WKH WHDP PD\ GR WKH the Speed Section, the penalty will be the one following in a training zone at the beginning of a indicated in Article 24.3.i stage:: a) Change a punctured or damaged tire. Article 26: Parc fermé b) HDYHDQHZZLQGVKLHOG¿WWHGZLWKKHOSIURPD third party, if necessary. These repairs must be completed before their start time, otherwise a 26.1'H¿QLWLRQ penalty corresponding to a "CH-P" Control will be The competing cars are subject to the "parc imposed. fermé" rules in the following cases: a) From the time they enter the formation area at 26.4. Assistance from third parties the beginning of a stage until they leave it. If a vehicle is unable to move by its own means at the entrance or exit of a "parc fermé" (especially b) From the time they enter a control area until within a control area), the penalty will be 30 they leave it. seconds.
c) FURPWKHWLPHWKH\UHDFKWKH¿QLVKDUFKDWWKH In this case, help from third parties may be end of a stage until 30 minutes after the arrival requested to push the car out of the control area; of the last team or until the Clerk of the Course but the penalty will be applied regardless. A report LQGLFDWHVWKH¿QLVKRIWKH"parc fermé". from the post marshal is enough to apply the penalty. d) FURPWKHWLPHWKH\UHDFKWKH¿QLVKDUFKDWWKH end of the event in Durango City, until the time for 26.5. "Parc fermé"DW¿QDOVWDJH lodging protests has expired. As soon as the teams have parked their car in the "parc fermé" at the end of the event in Durango 26.2. Rules for the "parc fermé" City, the competitors shall leave the "parc fermé" Failure to follow the "parc fermé" rules (below) will and no member of the team or their service UHVXOWLQGLVTXDOL¿FDWLRQIURPWKHVWDJH personnel are permitted to re-enter. a) While the vehicles are subject to "parc fermé", any repair, refueling or any other intervention to When the time for lodging protests has expired, the cars is strictly forbidden. the teams can then move their vehicles, except WKRVH LQYROYHG LQ D SURWHVW WKH VL[ ¿UVW SODFHV b) II DQ\ RႈFHU QRWHV WKDW D UDFH FDU LV QRW of each category and any cars selected by the in a condition for normal road use, they must Steward of the Meeting or the Clerk of the Course. immediately inform the Clerk of the Course of such a condition and request to the team that These cars must remain in the "parc fermé" the vehicle is repaired immediately upon leaving and the competitors and their service personnel the control area, specially at the start of a Speed can only enter the area once the Steward of the Section. Meeting allows them to do so and perform any interventions on the car as indicated by him. 64 La Carrera Panamericana RULE BOOK 2020
Yellow background Cream background with Stopwatch with a White Circle with transversal Indicates the start of a stripes Control Area. Indicates the end of a Once a car has entered Control Area. it cannot drive in reverse or stop there. A car with problems must stop after the signal.
Red background with Stopwatch Yellow background Indicates a & Checkered Flag “CH“ time control. :DUQLQJWR¿QLVKD The marshal writes the Speed Section. passage time of the teams. Early or late This signal is located arrival will be penalized. EHIRUHD%&RQWURO
Green background Blue background & Checkered Flag with Stopwatch Indicates the end of a Speed Section Indicates a %&RQWURO “CH-P“ time control. The car must be The marshal writes the prepared to STOP passage time of the ("ALTO") after the teams. Early arrival will FKHFNHUHGÀDJ not be penalized, late arrival is allowed up to 15 minutes.
Red background Red background with White Flag with the world "ALTO" Indicates the start of a Speed Section Indicates a "C" Control. (“A“ control). The car must completely The marshal writes the stop and the marshal will passage time, gives the write the passage time of start to the teams. WKHSUHYLRXV%&RQWURO
Competitors must use helmets and safety belts.
65 La Carrera Panamericana RULE BOOK 2020
66 La Carrera Panamericana RULE BOOK 2020
67 La Carrera Panamericana RULE BOOK 2020
7KHVHYHKLFOHVZLOOEHVXEMHFWWRD¿QDOLQVSHFWLRQ WKHLQIULQJHPHQWZDVGRQHDQGWKHGLVTXDOL¿FDWLRQ (Article 29). from the event if the infringement is made in the "parc fermé" at the end of the event in Durango. 26.6. Penalty Any infringement of the "parc fermé" rules, will UHVXOWLQWKHGLVTXDOL¿FDWLRQIURPWKHVWDJHLQZKLFK
X.- SCRUTINEERING
Article 27: Requirements Once the car has been checked, the scrutineering RႈFHUZLOODOORZWKHPWROHDYHWKHSUHPLVHV The data on the entry form of the participants and the technical and safety forms of the car must Article 28: Before the start and FRLQFLGH ZLWK WKH DFWXDO WHFKQLFDO VSHFL¿FDWLRQV during the event of the competing car. The information presented must be truthful. 28.1. Scrutineering Except for the team members (driver and co- To start the scrutineering process, the competitors driver), only one additional person per car may must be holders of a valid regular drivers license be present at the scrutineering area. To begin the and sports license from their country of origin as scrutineering process, a team must hand in their well as the one issued by the FEMADAC. registration card with the approval stamps from: a) Administrative checks It is the responsibility of the competitors to present b) Mexican Motorsports Federation (FEMADAC), the competing car for scrutineering with all the showing that they hold a valid racing license RႈFLDOVWLFNHUVDQGFRPSXOVRU\DGYHUWLVLQJ issued by them. c) Medical check-up (item 4 of the "VERY Once the inspection is approved, the competing IMPORTANT NOTES RELATED WITH THE car and the competitor’s helmets will have an PROGRAM" in Chapter III). approval sticker, which must remain attached to both the car and helmet during the entire event. The above requirements must be completed before beginning scrutineering. The technical The cars or competitors that are not approved and safety inspection will not be performed until FDQQRWVWDUWWKHHYHQWDQGZLOOEHGLVTXDOL¿HG a team has all the required stamps. A penalty of 1 minute will be applied if they do not. At the end of the race in the last arrival arc, WKH VFUXWLQHHULQJ RႈFHUV ZLOO LQGLFDWH WR WKH After scrutineering, if a vehicle does not comply competitors selected by the organization that with all rules and requirements, the Steward of the engine compartment of their cars should be the Meeting may set a deadline for the vehicle to sealed and that the cars should remain in "Parc do so. If the deadline expires and the car still does Fermé" to be moved later (approximately in one not comply fully with all rules and requirements, KRXU WRWKHVLWHZKHUHWKH¿QDOVFUXWLQHHULQJDQG the team will be excluded from the event. should also bring along their technical personnel, with the necessary tools to carry out the required 28.2. Items checked during scrutineering disassembling activites or any other technical The scrutineering process that is carried out DFWLRQ UHTXHVWHG E\ WKH VFUXWLQHHULQJ RႈFHUV before the start of the event is of a general nature. 68 La Carrera Panamericana RULE BOOK 2020 a) The chassis and cylinder block are marked and 28.3. Safety equipment of the competitors and seals are placed where the scrutineers consider the competing car convenient for possible future revisions during the All competitors and their competing cars must competition. comply with the safety requirements established b) Regardless of the above, if the Clerk of the in Chapter VIII. Non-compliance with these Course and/or the Steward of the Meeting requirements will cause a team to be excluded consider it necessary, a competing car may be from the event. checked in detail; even going as far as measuring the cylinder capacity of the engine, among other 28.4. Additional checks things. Additional checks of any of the competitors as c) If a car requires to have dead weight added to well as of the competing cars may be carried out LWWKLVPXVWEHZHOGHGRUVHFXUHO\¿[HGDQGZLOO at any time and place during the event. be marked for possible future revisions. d) Administrative checks are for the complete The competitors are responsible for ensuring that team (driver, co-driver, and spare driver/co- they meet all the administrative and technical driver), as follows: requirements, both for themselves and for their d.1) The drivers must present valid regular car throughout the entire event. driving licenses from their country of origin. d.2) The competitors must present a valid Refusal to present the competing car when sports license, both from their country of origin UHTXHVWHG E\ DQ RႈFHU IRU IXUWKHU LQVSHFWLRQ and the FEMADAC. or a request to review the compliance of all the d.3) A team must turn in a copy of their liability requirements for the competitor will cause the and third party insurance for their service GLVTXDOL¿FDWLRQIURPWKHVWDJHRUHYHQWKHHYHQW vehicles. This insurance must be valid for the subject to the judgment by the Steward of the entire duration of the event and in all Mexican Meeting. territory. e) The scrutineering for competitors and 28.5. Marks and stickers on car competing cars will be held on the dates and It is the responsibility of a team that the marks places indicated in Chapter III. or stickers placed on the competing car during scrutineering before the start are protected and 2QFHWKHVFUXWLQHHULQJSURFHVVKDV¿QDOL]HGWKH remain intact until the end of the event. Should corresponding authorization stickers will be given these marks or stickers go missing at any time; WRWKHWHDPZKLFKPXVWDႈ[WKHPWRWKHFDUDQG WKHWHDPZLOOEHLPPHGLDWHO\GLVTXDOL¿HGIURPWKH helmet of each competitor for the duration of the event. event. 28.6. Fraud These stickers will be given at the administrative Any fraud which is discovered, in particular , checks (Station 1 of the Registration Park) when retouching, relocating or removing the marks a team presents their registration card completely or stickers placed on the car will result in the ¿OOHGRXWDQGZLWKWKHFRUUHVSRQGLQJVWDPSVIURP LPPHGLDWH GLVTXDOL¿FDWLRQ RI WKH WHDP IURP WKH each area. event as well as any other person, (competitor, service personnel or team member) who was The cars and competitors that do not pass the involved in carrying out the fraudulent act. scrutineering will be excluded from the event.
69 La Carrera Panamericana RULE BOOK 2020
Article 29: Final control checked on the competing car. It is mandatory that the participants have an extra cylinder head 29.1. Final "parc fermé" gasket available for this purpose. As soon as a team arrives at the end of the event, they shall drive their car to the "parc fermé" where ,Q WKH FDVH RI SURWHVWV WKHVH PXVW EH VSHFL¿F a brief check will be carried out to verify: and only related to one concept per protest. a) That the car corresponds to the car submitted The protest must comply with the requirements at scrutineering before the start of the event, outlined in Article 31.1. (Article 28). b) If there is cause to apply any penalties.
29.2. Absence of marks or stickers 7KHDEVHQFHRIRQHRIWKHLGHQWL¿FDWLRQPDUNVRU stamps placed during the scrutineering before the VWDUW $UWLFOH ZLOO UHVXOW LQ GLVTXDOL¿FDWLRQ from the event.
29.3. Final inspection of winning cars 7KH FDUV RI WKH ¿UVW VL[ SODFHV LQ WKH JHQHUDO FODVVL¿FDWLRQ DQGRU IURP HDFK FDWHJRU\ RU DQ\ other car, may be selected for detailed inspection and even dismantling at the sole discretion of the Steward of the Meeting or if a protest is submitted against a car or team or by decision of the Clerk of the Course.
29.4. Cost of dismantling car Should the aforementioned dismantling be the result of a protest, in addition to the cost of the protest, a deposit of the expenses involved must be paid in advance to cover all costs of this operation, plus any expenses demanded by the protested and authorized by the Steward of the Meeting, must be paid by the claimant.
If the protest turns out to be founded, the deposit and 90% of the protest fee are reimbursed to the claimant and all expenses related to the dismantling are charged to the defaulting competitor (Article 31.2).
29.5. Further inspection In the event of a further inspection or dismantling at the end of the event, it is the responsibility of the competitor to have a person remove one of the cylinder heads of the engine to verify the displacement or anything else that needs to be 70 La Carrera Panamericana RULE BOOK 2020
XI.- PENALTIES AND REPRIMANDS
Article 30: Summary of penalties start and they must be driven by at least one of the registered team members. Not complying with and reprimands this requirement - Penalty: 30 seconds, (Chapter IIIa, Item 10). This chapter is a summary of the penalties and 6. Not attending the Service meeting – Penalty: 1 ZDUQLQJVPHQWLRQHGLQWKLV5XOH%RRN,IWKHUHLV minute, (Chapter IIIa, Item 9). D GLႇHUHQFH EHWZHHQ WKHVH VXPPDULHV DQG WKH WH[WRIWKHUXOHLQLWVVSHFL¿FVHFWLRQWKHWH[WRI 7. Not attending the Drivers' meeting (drivers and WKHVSHFL¿FVHFWLRQZLOOEHELQGLQJ/LNHZLVHLILQ co-drivers) - Penalty: 30 seconds, (Chapter IIIa, WKHERG\RIWKH5XOH%RRNWKHUHLVDSHQDOW\WKDW Item 7 and Article 33.5). is not in this summary, the penalty will be valid and may be applied by the Clerk of the Course or 8. Not attending the daily Drivers' meetings and the Steward of the Meeting. the trophy award ceremony of each stage, (at least one member of the team must be present) Therefore, this summary is only a guide for the - Penalty: The team will lose their right to receive competitors and serves as a quick reference of their corresponding trophy, (if they won one); the penalties and warnings. they also lose their right to appeal and protest the results of the stage of the day and to request a 30.1. Penalties revision of such results; in addition, the team will 1. Attending scrutineering without complying with incur a 30 seconds penalty, (Chapter IIIa, Item 13 the requirements of the compulsory advertising or and Article 33.5). LILWLVQRWDႈ[HGWRWKHFRPSHWLQJFDUPenalty: exclusion from the event, (Chapter IIIa, Item 3 9.1RWDWWHQGLQJWKH¿QDODZDUGFHUHPRQ\ZKHUH and Article 14.2). WKH¿QDOUHVXOWVDUHDQQRXQFHGDQGWKHWURSKLHV If the compulsory advertising is missing, is not presented in Durango (at least one member of YLVLEOHRULVQRWDႈ[HGSURSHUO\WRWKHFDUPenalty: the team must be present) - Penalty: The team 30 seconds per stage (Article 14.3). If the fault will lose their right to receive their corresponding persists, the sanction may be stronger, subject to trophy, (if they won one) and their right to protest the judgment of the Clerk of the Course. and appeal any decision made, (Chapter IIIa, Item 14 and Article 33.1). 2. Not having medical authorization - Penalty: Exclusion from the event, (Chapter IIIa, Item 4 10. Not obtaining the OK sticker that allows the and Article 28.1). team to take part in the event - Penalty: Exclusion from the event, (Chapter IIIa, Item 8.5). 3. Not attending the Co-drivers (navigators) meeting in Querétaro - Penalty: 30 seconds, 11. Not complying with the compulsory safety (Chapter IIIa, Item 5,). requirements, the eligibility of the competing car and competitors or not having the appropriate 4. Not attending the Instructions for Drivers licenses and required insurance - Penalty: meeting in Querétaro - Penalty: 30 seconds, Exclusion from the event, (Articles 4, 5, 8, 15, 16, (Chapter IIIa, Item 6,). 18 and 20).
5. All competing cars admitted to "La Carrera 12. Any improper, fraudulent or unsporting actions Panamericana" must take part in the ceremonial done by a competitor or a participant. The Steward
71 La Carrera Panamericana RULE BOOK 2020 of the Meeting will be the judge of these actions 23. Attending scrutineering without the and may impose warnings or penalties that could LGHQWL¿FDWLRQ ODEHO RI WKH WHDP PHPEHUV RQ WKH go as far as the GLVTXDOL¿FDWLRQ from the event, competing car - Penalty: Exclusion from the event, (Article 7.5). (Article 10.7).
13. Inappropriate and incorrect use of the logo, 24. ,QIULQJHPHQWRIWUDႈFregulation – Penalties: graphics, and brand of "La Carrera Panamericana" a) Minimum penalty: 30 seconds. will be subject to sanctions (penalties) that will b) Maximum penalty: DLVTXDOL¿FDWLRQ IURP WKH EHGH¿QHGE\WKH&OHUNRIWKH&RXUVHDQGPD\ event subject to the judgment of the Steward of go as far as a legal action against the person the Meeting, (Article 11.1). responsible, (Article 7.7). 25. Repairing a car in a place not permitted - 14. Any competitor under the age of 18 driving Penalty: 2 minutes, (Article 12.1). a competition car during the event - Penalty: 'LVTXDOL¿FDWLRQIURPWKHHYHQW $UWLFOH 26. To tow, push or transport the competing car using another vehicle or to receive help from a 15. Lack of the required licenses - Penalty: third party - Penalties: Exclusion from the event, (Article 8.3). a) Minimum penalty 'LVTXDOL¿FDWLRQ IURP WKH section (maximum time assigned to the Speed 16. Only one competitor or more than two people Section + 1 minute in the Time Controls at the in a competing car - Penalty 'LVTXDOL¿FDWLRQIURP VWDUWDQG¿QLVKRIWKHVHFWLRQ the event, (Article 8.5). b) Maximum penalty 'LVTXDOL¿FDWLRQ IURP WKH stage or from the event if the fault is repeated or 17. Substituting a team member without notifying if the Steward of the Meeting decides so, (Article the Clerk of the Course and the Steward of 12.2). the Meeting; or substituting a team member with another non-registered person - Penalty: 27. %ORFN DQRWKHU FRPSHWLWRU QRW DOORZ EHLQJ 'LVTXDOL¿FDWLRQIURPWKHVWDJH $UWLFOH overtaken during a Speed Section, behaving in an unsporting manner at any time during the entire 18. Lack of the "ID card" of the team members in event - Penalty 'LVTXDOL¿FDWLRQ IURP WKH HYHQW the car or if it does not belong to them - Penalty: (Article 12.3). 'LVTXDOL¿FDWLRQIURPWKHVWDJH $UWLFOH 28. Not registering and identifying the service or 19. Lack of one side competition numbers - support vehicles - Penalty: 1 minute. If the fault is Penalty: 30 seconds for each stage, (Article 10.5). repeated the penalty is 3 minutes for each stage that the service or support vehicle is not registered 20. Lack of the rear competition number - Penalty: RULGHQWL¿HG $UWLFOHD 10 seconds for each stage, (Article 10.5). 29. Lack of a valid liability insurance that at least 21. Lack of both side competition numbers - covers the service vehicles for the duration of the Penalty: Exclusion from the stage, (Article 10.5). entire event - Penalty: Exclusion from the event, (Article 13.1.b). 22. 0LVVLQJ DQ LGHQWL¿FDWLRQ ODEHO RI D WHDP member on the competing car for a second time - 30. Service or support vehicles circulating Penalty: 1 minute in the stage where the fault was between the pace cars and the sweeper car and/ detected and an additional 1 minute each time the or overtaking the latter without authorization from fault is repeated, (Article 10.7). the RႈFHU driving the sweeper car - Penalty: 'LVTXDOL¿FDWLRQIURPWKHVWDJH $UWLFOH 72 La Carrera Panamericana RULE BOOK 2020
31. Service vehicles circulating or improperly of the Course, the Steward of the Meeting and the parked during the running of a special stage - entrant agree to this, (Articles 19.1 and 19.2). Penalty 'LVTXDOL¿FDWLRQ IURP WKH HYHQW $UWLFOH 13.3). 40. Using safety seat belts that are more than 5 years old from the date of manufacturing or if they 32. Not complying with the technical characteristics are not approved by the Director of Scrutineering established for the competing cars in a particular - Penalty: Exclusion from the event if detected FDWHJRU\ DQGRU PDNLQJ PRGL¿FDWLRQV WR D FDU before the start of the event, or denied the right which are not permitted as outlined in this Rule to continue in the event after an accident, (Article %RRN - Penalty 'LVTXDOL¿FDWLRQ IURP WKH HYHQW 20.5). (Articles 16 and 18). 41. $ႈ[LQJWKHVHDWVLQDZD\WKDWLVQRWDSSURYHG 33. Using tires that do not comply with the provisions - Penalty: Exclusion from the event, (Article 20.6). ofWKLV5XOH%RRN- Penalty 'LVTXDOL¿FDWLRQIURP the stage where the fault was detected, (Articles 42. It is not permitted to wear helmets prior to 16 and 18). WKH6QHOO)RXQGDWLRQ6$VSHFL¿FDWLRQRULWV equivalent authorized by the Scrutineer, helmets 34. Attending scrutineering without having for motorcycling or that the helmet is not labeled installed the MSD ignition module or the Mallory with the name, blood type, Rh factor and allergies RPM limiter - Penalty: Exclusion from the event, of the competitor - Penalty: Exclusion from the (Articles 16.1, 16.2, 16.4 and 16.8). event until the competitor uses the appropriate helmet. This will apply at all times during the 35. Using aviation gas - Penalty 'LVTXDOL¿FDWLRQ competition, (Article 20.9). from the event, (Article 17). 43. Attending scrutineering without a device to 36. Refueling in places other than gasoline protect the head and neck - Penalty: Exclusion stations or designated service areas. Transporting from the event, (Article 20.9.h). fuel in a competing car or service vehicles during the competition is also forbidden - Penalty: 44. Using race clothing which has not been 'LVTXDOL¿FDWLRQ IURP WKH VWDJH ZKHUH WKH IDXOW authorized by the Director of Scrutineering - was detected, (Article 17). Penalty 'LVTXDOL¿FDWLRQ IURP WKH HYHQW $UWLFOH 20.10). 37. 7KHXVHRIDZLQGVKLHOGPDGHIURPDGLႇHUHQW material other than safety shatterproof glass at any 45. Not complying with all mandatory safety time during the event - Penalty 'LVTXDOL¿FDWLRQ requirements and equipment - Penalty: Exclusion from the event, (Article 18.3). from the event, (Articles 20.11 and 28.3).
38.1RWFRPSO\LQJZLWKWKHVSHFL¿HGZHLJKWRIWKH 46. Late arrival at the formation area or crossing competing car - Penalty 'LVTXDOL¿FDWLRQIURPWKH the starting arch late when it is not blocked - stage where the fault was detected, (Articles 16 Penalties: and 18). a) 1 second for each minute late, up to 15 minutes. b) If the competitor is more than 15 minutes late: 39. Competition cars which do not comply with two minutes. the rules and requirements outlined in this Rule (Article 22.b) %RRNDIWHUKDYLQJSDVVHGVFUXWLQHHULQJ- Penalty: Exclusion from the event or the car may be 47. Arrive with a delay of more than 15 minutes at transferred to the Exhibition Category if the Clerk the formation area or crossing the starting arch of 73 La Carrera Panamericana RULE BOOK 2020
a stage - Penalty: 2 minutes, (Article 22.c). 54. (QWHULQJ D FRQWURO DUHD IURP D GLႇHUHQW Note: It is possible that due to a team’s lateness, direction than that of the event, crossing a control they cannot collect their time card, reset their post more than once, re-entering a control area or chip nor see the bulletins of the day; but this will driving in reverse within a control area - Penalty: 2 not justify the non-compliance of the information PLQXWHVDQGLIUHSHDWHGGLVTXDOL¿FDWLRQIURPWKH contained in the bulletins. VHFWLRQDQGLIUHSHDWHGDWKLUGWLPHGLVTXDOL¿FDWLRQ from the stage, (Article 23.5). 48. %ORFNLQJ WKH SDVVDJH RI DQRWKHU FRPSHWLWRU in the formation area at the beginning of a stage - 55. Unauthorized corrections or amendments Penalty: 1 minute, (Article 22.f). made to a time card - Penalty: 10 seconds, (Article 23.6.3). 49.3DVVLQJWKURXJKWKHVWDUWLQJDUFKLQDGLႇHUHQW position from their original starting order or target 56. Making a calculation mistake on the time card time - Penalty: 2 minutes, (Article 22.g). - Penalty: 30 seconds for each mistake. Handing LQ D WLPH FDUG DW WKH ¿QLVK DUFK ZLWKRXW KDYLQJ 50.$UULYLQJGLUHFWO\WRWKH¿UVW"CH" Control of the added the times of the Speed Sections - Penalty: day, without having passed through the starting 1 minute, (Article 23.6.d). arch and/or without their time card - Penalty: In addition to the penalty of 2 minutes, (see No. 47 57. Missing a time from a Time Control or passage above), the team will start behind all competitors control on the time card, not handing in a time card that did cross the arch. The team will keep this on time at a post control due to the team’s fault, new starting order for the remainder of the stage QRW KDQGLQJ D WLPH FDUG DW WKH ¿QLVK DUFK HYHQ and they will not incur any further penalties for not if the car did not pass through the arch on time having passed the arch at the beginning of the or lost the time card - Penalty: 1 minute (Articles day, (Article 22.i). 23.6.d and 25.8).
51. Not respecting the starting order - Penalty: 30 58. Not obeying the instructions of a post marshal seconds and any additional penalties incurred by - Penalty: Minimum 2 minutes. The penalty could this or other actions, (Article 22.2.b). be harsher, (Article 23.8).
52. Not reporting to a Time Control ("CH-P" or 59. &URVVLQJWKH¿QLVKDUFKDWWKHHQGRIDVWDJH "CH") or arriving more than 15 accumulated more than 15 minutes earlier or 15 minutes later; minutes late - Penalty: 30 seconds at that Time RUQRWUHSRUWLQJWRWKH¿QLVKDUFKDWWKHHQGRIWKH Control and at the following Time Controls until the stage - Penalty: 2 minutes (Article 24.1.c). end of the stage. Also, the team will be assigned the maximum time in the following Speed Sections 60. Time controls, ("CH-P" and "CH"): of the stage, (Articles 22.2.c and 24.3). a) Arrive less than 5 minutes earlier - Penalty: 15 seconds for each minute early. 53.1RWFRPSO\LQJZLWKWKHURXWHVSHFL¿HGLQWKH b) Arrive more than 5 minutes earlier - Penalty: 5 5RXWH%RRN- Penalty PLQXWHLQWKH¿UVW7LPH minutes. Control not passed and at the following Time c) Arrive more than 1 minute late and less than Controls until the end of that stage. Additionally, 15 accumulated minutes - Penalty: 5 seconds for the team will be assigned the maximum time in all each minute late. Speed Sections in the following Time Controls not d) Arrive more than 15 accumulated minutes late passed, (Article 22.4). - Penalty: (see No. 52 above). (Articles 24.2.g, 24.2.i and 24.3)
74 La Carrera Panamericana RULE BOOK 2020
61. Entering a control area more than one minute registered teams in that category. earlier - Penalty: 30 seconds. The penalty could This time is known as the "Maximum time assigned be harsher, (Article 24.2). to a Speed Section". (Article 24.3.j)
62. Arriving at a Time Control more than 15 67. Starting a Speed Section without wearing a accumulated minutes late in a stage or not helmet, not wearing protection for the head and showing up at all - Penalty: 30 seconds in that QHFN QRW ZHDULQJ ¿UHUHVLVWDQW FORWKLQJ RU WKH Time Control + the penalties indicated in Article seat belts not fastened - Penalty 'LVTXDOL¿FDWLRQ 22, (Articles 24.3.a and 24.3.b). from the event, (Articles 25.2 and 25.4).
63. Not having authorization from the Director 68. If a competitor starts a Speed Section without RI 6FUXWLQHHULQJ DQG WKH &KLHI 0HGLFDO 2ႈFHU a helmet, is not wearing protection for the head after an accident that would allow the car or both DQG QHFN RU ¿UHUHVLVWDQW FORWKLQJ RU GRHV QRW members of the team to continue in the event - have his seat belt fastened, but stops at the exit of Penalty 'LVTXDOL¿FDWLRQRIWKHFDURUH[SXOVLRQRI the control area and in plain sight of the marshal the injured team member from the event, (Article corrects the mistake before continuing - Penalty: 24.3.f.4 and 32.5). 5 minutes, (Article 25.4).
64. 1RW ¿QLVKLQJ D VWDJH DQG QRW LQIRUPLQJ WKH 69. Driving in the opposite direction of the event Clerk of the Course that day of the team’s intention in a special stage - Penalty 'LVTXDOL¿FDWLRQIURP of continuing in the competition on the following the event (Article 25.3). day - Penalty 'LVTXDOL¿FDWLRQIURPWKHIROORZLQJ stage, (Article 24.3.g). 70. Pushing a car within a control area (with or without help from a third party) - Penalty: 30 If under these circumstances a competitor arrives seconds, (Articles 25.4 and 26.4). at a "CH" Control and a marshal allows him to start (because the marshal did not know about 71. Jump starting the start of a Speed Section - WKH FLUFXPVWDQFHV RI KLV GLVTXDOL¿FDWLRQ WKH Penalty: 5 seconds for each second advanced. It FRPSHWLWRU ZLOO EH GLVTXDOL¿HG IURP WKH HYHQW may be harsher if repeated, (Article 25.6). (Article 24.3.h). 72. Stopping in a control area between control 65. ,IWKH&OHUNRIWKH&RXUVHLVQRWL¿HGLQZULWLQJ posts "%" and "C" - Penalty: 1 minute, (Article of a team’s intention to continue in the event on 25.7). the same day, but out of time, the team may start the next day only if it is authorized by the Steward 73. Absence of the start time or the end time of of the Meeting and the Director of the race. The a Speed Section on the Time Card - Penalty: 1 team will start after all competitors who already minute, (Article 25.8). have their starting time, once the Clerk of the Course has signed the time card (Article 24.3.g). 74. Driving in reverse within a "C" Control or within a control area - Penalty 'LVTXDOL¿FDWLRQIURPWKH 66. 1RW VWDUWLQJ RU ¿QLVKLQJ D 6SHHG 6HFWLRQ stage, (Article 25.8). - Penalty: the lowest time of the category + 2 minutes. 75. Covering less distance than the required amount during a Speed Section on a racetrack - If QRW D VLQJOH WHDP RI D FDWHJRU\ ¿QLVKHV D Penalty: Maximum time assigned for that Speed Speed Section - Penalty: the highest time of the Section + 3 minutes, (Article 25.8 immediate higher category + 1 minute for all the 75 La Carrera Panamericana RULE BOOK 2020
76. Covering more distance than the required 86. ,IVFUXWLQHHULQJKDV¿QLVKHGDQGLIWKHH[WUD amount during a Speed Section on a racetrack time that was awarded by the Steward of the - Penalty: Total recorded time, (this includes the Meeting has elapsed, and the competing car still additional time needed to complete the additional does not comply with the rules - Penalty: Exclusion laps), (Article 25.8). from the event, (Article 28.1).
77. Interrupting a Speed Section - Penalty: 87. Refusal to participate in a scrutineering Maximum time assigned to that Speed Section, revision (car or competitor) requested by an (Article 25.12). RႈFHU at any time or any place during the event - Penalty 'LVTXDOL¿FDWLRQ IURP WKH VWDJH RU WKH 78. Refusal to start a special stage - Penalty: 2 event subject to the discretion of the Steward of minutes, (Article 25.13). the Meeting, (Article 28.4).
79. Repair or refuel the car or perform any other 88. Missing the required marks or seals placed interventions on the competing car inside a "parc on the car during scrutineering - Penalty: fermé" - Penalty 'LVTXDOL¿FDWLRQIURPWKHVWDJH 'LVTXDOL¿FDWLRQIURPWKHHYHQW $UWLFOHVDQG (Articles 26.2 and 26.6). 29.2).
80. Disobeying an RႈFHU who requests a repair to 89. Committing fraud in relation to the marks or to the competing car - Penalty: 2 minutes, (Article seals placed on the car during scrutineering - 26.2). Penalty 'LVTXDOL¿FDWLRQ IURP WKH HYHQW $UWLFOH 28.6). 81. Exceeding the time given to repair a car within 90. Cooperating with or participating in fraudulent a starting area at the start of a stage - Penalty: activities related to the item above - Penalty: See No. 60 above, (Article 26.3). 'LVTXDOL¿FDWLRQIURPWKHHYHQW $UWLFOH
82. If a competing car cannot move by its own 91.1RWXVLQJWKHRႈFLDOSHUVRQDOL]HGLGHQWL¿FDWLRQ means at the entrance or exit of a "parc fermé" bracelet - Penalty 'LVTXDOL¿FDWLRQIURPWKHHYHQW (specially within a control area) - Penalty: 30 seconds, (Article 26.4). 30.2. Warnings a) A warning may be verbal or written and does 83. Violating the rules of "parc fermé" at the end not necessarily imply a penalty. However, at the of the event - Penalty 'LVTXDOL¿FDWLRQ IURP WKH sole discretion of the Steward of the Meeting, a event, (Article 26.6). warning may be converted into a penalty and/or GLVTXDOL¿FDWLRQ IURP D VWDJH RU WKH HYHQW LI WKH 84. Not passing scrutineering (car or competitor) - RႇHQVHLQTXHVWLRQLVVHULRXVHQRXJK Penalty: Exclusion from the event, (Article 27 and b) Warnings may also be given due to incorrect 28.2). or fraudulent actions or attitudes and may be accompanied by penalties, (Article 7.5). 85. Reporting to scrutineering with more people c) Not having a label of a team member on the than those permitted and/or without the technical competing car – Penalty: Verbal or written warning DQG VDIHW\ IRUPV ¿OOHG RXW IRU WKH FDU DQGRU IRUWKH¿UVWRႇHQVH without completing the administrative checks or medical examination - Penalty: 1 minute (Article 28.1).
76 La Carrera Panamericana RULE BOOK 2020
XII.- PROTESTS AND APPEALS
Article 31: Protests and appeals rejected immediately. Only formal protests will be considered.
31.1. The right to protest If this is the case, the protested team will be The right to protest is reserved only for competitors. advised that they will start under protest and will Nevertheless, the Steward of the Meeting or the EHQRWL¿HGRIWKHUHDVRQIRUWKHSURWHVWLQRUGHU Clerk of the Course may jointly or separately, to give the team the opportunity to correct the HYHQLQWKHDEVHQFHRIDSURWHVWWDNHDQ\RႈFLDO problem before the start, to decide whether to action that they consider necessary. start or not or to go ahead and start under protest. The following types of protests may be lodged: If a competing car has passed scrutineering a) A protest against a team, an individual satisfactorily and has started the event, but in a competitor or a car before the start of the VXEVHTXHQWVWDJHPRGL¿HVLWVFRQGLWLRQDQGDW¿UVW event in order to prevent another team’s sight the vehicle does not comply with the rules, In this case, the protest must be participation. but intends to start a new stage, then a protest lodged no later than 14:00, on October 13th due against that car must be presented in writing and to any of the following reasons: JLYHQDVVRRQDVSRVVLEOHWRDVWDUWLQJRႈFHUDW The competing car does not comply a.1) the starting arch before the stage is started. The with the rules – the exclusion from the event Steward of the Meeting or the Clerk of the Course is requested. The claimant must indicate or the Director of Scrutineering must be informed SUHFLVHO\WKHPHFKDQLFDOSLHFHRUVSHFL¿FSRLQW of the protest. in question that is the object of the protest. If the protest implies several mechanical pieces At the end of a stage, the written protest must be RU VHYHUDO VSHFL¿F SRLQWV WKH FODLPDQW PXVW given to the Steward of the Meeting for revision, present a separate protest for each case. and, if necessary, for the application of the a.2) The competing car does not correspond to corresponding penalty. In this case, the protested the category in which it has been authorized to team will be advised that a protest exists against compete in – a change of category is requested a competitor or the car. This gives the team WKHSURWHVWPXVWEHDVVSHFL¿FDVSRVVLEOH the opportunity to choose one of the previously a.3) The competitor does not comply with the mentioned options. administrative requirements – the exclusion from the event is requested, (the protest shall indicate the requirements not met). b) A protest against the result of the scrutineering procedure of a vehicle and/or In the case that a car does not comply with the the administrative checks of a competitor. In UXOHVDQGLWLVFRQVLGHUHGDYLRODWLRQDW¿UVWVLJKW this case, a protest must be lodged no later than (a violation of the rules that is plainly visible), the PLQXWHVDIWHUKDYLQJ¿QLVKHGWKHVFUXWLQHHULQJ protest against that vehicle must be presented procedure of that vehicle. ZLWKLQDQKRXUIROORZLQJWKH¿QLVKRIWKH'ULYHU¶V meeting on October 13th at Querétaro or at the The protest will be against the scrutineer and the IRUPDWLRQDUHDEHIRUHWKHVWDUWRIWKH¿UVWVWDJH claimant can request: Any protests against vehicles that commit a b.1) That the competing car, the driver or YLRODWLRQDW¿UVWVLJKWRQFHWKHHYHQWKDVVWDUWHG co-driver be allowed to start the event, if the will be considered "not founded" and will be necessary changes are made and they comply with the rules; or 77 La Carrera Panamericana RULE BOOK 2020
b.2) That the competing car is moved to a Course must then proceed to analyze the GLႇHUHQWFDWHJRU\ UHTXHVWLPPHGLDWHO\DQGKHPXVWWKHQRႇHUD FODUL¿FDWLRQRUDPRGL¿FDWLRQRIWKHSURYLVLRQDO c) A protest against another team/competitor at results. The updated results must be posted as the end of the event. The claimant can request soon as possible. WKDWDQRWKHUWHDPFRPSHWLWRUEHGLVTXDOL¿HGIURP e.2) $IWHUWKHFRUUHVSRQGLQJPRGL¿FDWLRQVKDYH the event. In this case, the protest must be lodged EHHQPDGHWKHDႇHFWHGFRPSHWLWRUVPXVWEH no later than 30 minutes after the last team has QRWL¿HG WR HQVXUH WKDW HYHU\RQH XQGHUVWDQGV entered the "parc fermé". the changes that have been made and agrees with them. If one of the competitors does The reasons for this type of protests are: QRW DJUHH ZLWK WKH ¿QDO UHVXOW KHVKH PD\ then proceed to submit a formal protest in c.1) A car does not comply with the rules for accordance with Article 31.2. some of its non-visible parts - the protest must EH DVVSHFL¿FDVSRVVLEOH DQG RQO\RQH LWHP 31.2. Fee for protest per protest will be accepted, (Article 29.5). Every protest shall be submitted in writing and c.2) A team or team member broke one of the addressed to the Steward of the Meeting or the UXOHV RXWOLQHG LQ WKLV 5XOH %RRN WKH SURWHVW Clerk of the Course accompanied by a fee of must be submitted at the end of the stage $10,000 Mexican pesos, which are non-refundable ZKHQWKHRႇHQVHZDVFRPPLWWHGDVLQGLFDWHG in case the protest is deemed to be unfounded. LQLWHPGEHORZ $QRႈFHUPXVWEHLQIRUPHG The fee must be given to the Clerk of the Course. RIWKHRႇHQVHDWWKHWLPHDQG SODFHZKHUH LW If the protest is deemed to be founded, then 90% was detected. of the fee will be returned to the claimant and 10% c.3) A competitor on board the competing car is retained by the Clerk of the Course. has not been registered. If the protest requires the dismantling and d) Regarding any of the cases mentioned in the UHDVVHPEO\ RI WKH HQJLQH RU GLႇHUHQW SDUWV RI previous section "c.", the protests may be lodged the competing car, the claimant must pay an at the end of any stage within 30 minutes after the additional deposit which will be determined by DUULYDORIWKHODVWWHDPWR¿QLVKDUFK,IWKHSURWHVW the Steward of the Meeting and must be enough is against the driver, the co-driver or the team, to cover all possible expenses for the required WKHSURWHVWVKDOOEHPDGHYHUEDOO\WRDQRႈFHUDW operation (Article 29.4). the moment it is detected. A formal protest must WKHQEHORGJHGDWWKHHQGRIWKHVWDJH7KHRႈFHU If a protest is deemed to be unfounded, the WKDWZDVQRWL¿HGHDUOLHUZLOODFWDVDZLWQHVVLQWKH corresponding protest fee, the additional deposit protest. nor any amount of the entry fee will be returned. e) $SURWHVWDJDLQVWWKH¿QDOUHVXOWRIWKHHYHQW,Q 31.3. Additional expenses If the protest is deemed to be unfounded this case, a protest must be lodged no later than any expenses incurred by the work and the one hour after the publication of the provisional transportation of the car will be covered by the UHVXOWVRQWKHRႈFLDOQRWLFHERDUG additional deposit. Conversely, if the protest is deemed founded, the protested competitor must The procedure is as follows: pay for all expenses. e.1) Once the provisional results have been 31.4. Unfounded protest SRVWHGDFRPSHWLWRUPD\UHTXHVWDFODUL¿FDWLRQ If the protest is unfounded and if the expenses of the results, (Article 31.7). The Clerk of the incurred by the protest (scrutineering, 78 La Carrera Panamericana RULE BOOK 2020 transportation, work, materials, etc.) are higher the Meeting will have 24 hours to make a decision WKDQ WKH DPRXQW RI WKH GHSRVLW WKH GLႇHUHQFH UHJDUGLQJDFODUL¿FDWLRQUHTXHVWDQGWRSRVWWKH must be paid by the claimant. Conversely, if the RႈFLDOUHVXOWVRIWKHVWDJHIURPWKHGD\EHIRUH H[SHQVHVDUHOHVVWKHGLႇHUHQFHZLOOEHUHWXUQHG along with the provisional results of the stage of to him/her. that day. $ UHTXHVW IRU FODUL¿FDWLRQ RI WKH UHVXOWV LV QRW 31.5. Inadmissible protests considered a formal protest; therefore, there is no Inadmissible protests are those against the need to pay a fee for this; but all requests must GHFLVLRQV RI WKH RႈFHUV ZKR LQ WKH H[HUFLVH RI comply with the following requirements: in writing, their duties and functions are judges of facts (for on time and addressed to the proper person for it example, the control marshals). to be considered.
31.6. Rights of claimant $ UHTXHVW IRU FODUL¿FDWLRQ E\ DQ\ RWKHU PHDQV The claimant and all concerned parties will have or one that does not follow this protocol will be the opportunity to be heard as soon as possible considered inappropriate and thus rejected. after a formal protest has been lodged. The concerned parties shall be summoned to appear If a competitor is not in agreement with the decision at a hearing. Witnesses may accompany them. RIKLVUHTXHVWIRUFODUL¿FDWLRQKHPD\WKHQORGJH The Steward of the Meeting must ensure that a formal protest following the procedure indicated the call for the hearing has been received by all above, (Article 31.1.e.). In this case, the protest parties. FDQQRW EH PDGH DJDLQVW WKH ¿QDO UHVXOWV EXW In the absence of any of the concerned parties DJDLQVW WKH RႈFLDO UHVXOWV RI WKH VWDJH IURP WKH or their witnesses, the ruling may be made by day before. The protest must comply with the default. requirements of a formal protest.
If a ruling cannot be made immediately after 31.8. Appeals hearing the parties involved, they must be A competitor can lodge an appeal against a informed of a place and time at which a decision decision made against him by the Steward of will be given. the Meeting. The appeal must be made in writing and submitted to The National Rally Commission, 5HTXHVWIRUFODUL¿FDWLRQRIUHVXOWV (CNRM), within two days after a decision of a Every competitor has the right to request a protest has been made; provided that within an FODUL¿FDWLRQ RI WKH SURYLVLRQDO UHVXOWV SRVWHG DW KRXU IROORZLQJ WKH QRWL¿FDWLRQ RI WKH GHFLVLRQ the end of each stage within one hour following the Steward of the Meeting receives in writing their publication. the intention of a competitor to lodge an appeal DJDLQVW WKDW GHFLVLRQ ,I WKLV QRWL¿FDWLRQ WR WKH $OO FODUL¿FDWLRQ UHTXHVWV ZLOO EH DWWHQGHG WR EXW Steward of the Meeting is not made on time, the any request not made within the time limit will be competitor forfeits his right to appeal. rejected immediately. The appeal must be accompanied by a fee of $OOFODUL¿FDWLRQUHTXHVWVPXVWEHPDGHLQZULWLQJ $25,000.00 Mexican pesos. The decision of the and addressed to the Clerk of the Course who is &150ZLOOEHFRQVLGHUHGDV¿QDODQGFDQQRWEH responsible for analyzing them along with the post appealed. The CNRM must make its decision PDUVKDOVDQGVFRULQJRႈFHUV7KH6WHZDUGRIWKH within 10 days of receiving the appeal. Meeting, who had already signed the provisional results must be informed of all requests for FODUL¿FDWLRQDQGWKHGHFLVLRQVWDNHQLQHDFKFDVH The Organizing Committee and the Steward of 79 La Carrera Panamericana RULE BOOK 2020
XIII.- CLASSIFICATION AND TROPHIES
$UWLFOH &ODVVL¿FDWLRQ 32.5. Provisional stage results At the end of each stage, the organizers publish a 2YHUDOOFODVVL¿FDWLRQ SURYLVLRQDOFODVVL¿FDWLRQWRGHWHUPLQHWKHVWDUWLQJ The race times, as well as the penalties, are order for the following stage. expressed in hours, minutes and seconds. The The starting order of the following stage will not ¿QDOUHVXOWVDUHGHWHUPLQHGE\DGGLQJWKHWLPHV LQFOXGH WKH FRPSHWLWRUV WKDW GLG QRW ¿QLVK WKH obtained in the Speed Sections + the time of any SUHYLRXVVWDJHXQOHVVWKH\QRWL¿HGWKH&OHUNRI penalties incurred. the Course of their intention to rejoin the event, the Director of Scrutineering approved the re-start 7KH ¿UVW ¿YH RYHUDOO SODFHV RI WKH HYHQW PXVW RIWKHFRPSHWLQJFDUDQGWKH&KLHI0HGLFDO2ႈFHU correspond to the Panamerican Cars Group. The cleared the participants if an accident occurred. EHVW FODVVL¿HG WHDP RI WKH +LVWRULF &DUV *URXS will be placed from sixth place onwards. 7KH UHVXOWV EHFRPH ¿QDO RQH KRXU DIWHU WKH provisional results have been posted on the The team of the Panamerican Cars Group with RႈFLDOQRWLFHERDUGDWWKHHQGRIHDFKVWDJHDQG the lowest overall time will be proclaimed the at the end of the event, unless there are requests overall winner of La Carrera Panamericana 2018. IRUFODUL¿FDWLRQRUWKHUHLVDSURWHVWUHJDUGLQJWKH The team with the next lowest overall time will be results. the second place and so on. The results for each category are determined on the same basis. 5HTXHVWVIRUFODUL¿FDWLRQDQGSURWHVWV ,I WKHUH DUH DQ\ UHTXHVWV IRU FODUL¿FDWLRQ RU 32.2. Tie protests lodged, the results will be considered In the case of a tie, the team that had the best ¿QDO XQWLO VXFK FODUL¿FDWLRQV DQG SURWHVWV KDYH WLPHRQWKH¿UVW6SHHG6HFWLRQRIWKHHYHQWZLOOEH EHHQ UHVROYHG DQG WKHUH DUH QR QRWL¿FDWLRQV RI proclaimed the winner. If this does not break the the intention to appeal. tie, then the times of the second, third, fourth, etc. Speed Sections will be considered until a winner If a protested competitor is eligible to receive any FDQEHGH¿QHG trophies, these will be withheld until the protests This can be applied at any time during the event and/or appeals have been resolved. to break a tie, especially to determine the starting RUGHUIRUDVWDJHWDNLQJLQWRDFFRXQWWKH¿UVW6SHHG 0RUHRYHULIDSURWHVWDႇHFWVWKHSDUWLFLSDQWVZKR Section of the day in which the tie occurred. are eligible to receive a trophy, the results must be published as provisional and all trophies must be 32.3. Posting of results ZLWKKHOGXQWLOWKHGH¿QLWLYHUHVXOWVDUHSXEOLVKHG The results are posted as outlined in the program, only when the protests and appeals have been (Chapter III). resolved or when the time limit has expired for a resolution. )LQDOFODVVL¿FDWLRQ 7KHFODVVL¿FDWLRQZLOOEHFRQVLGHUHGDV¿QDODWWKH +RZHYHULIDSURWHVWRUDSSHDORQO\DႇHFWVVRPH end of the event after one hour has passed after of the competitors who are eligible to receive a the provisional results have been posted and no trophy, their trophy will be withheld; while those protests have been lodged or decisions made ZKR DUH QRW DႇHFWHG E\ WKH SURWHVW ZLOO UHFHLYH WKDWDႇHFWWKHRYHUDOOUHVXOWV their trophy.
80 La Carrera Panamericana RULE BOOK 2020
Article 33: Trophy presentation, -seconds penalty and will lose the competitor’s right to appeal and protest the results of the stage award dinners, and Drivers' RI WKDW GD\ DQG WR UHTXHVW D FODUL¿FDWLRQ RI WKH meetings results. The team also loses its right to receive any trophies they may have won. 33.1. Trophies presentation The trophy presentation for La Carrera Teams who had an accident and wish to restart Panamericana 2018 will be held on October 19, the following day, must inform the Clerk of the 2018 in Durango City at 11:30 hrs. during the Course, the Director of Scrutineering and Chief ¿QDO DZDUG EUXQFK 7URSKLHV ZLOO EH JLYHQ WR 0HGLFDO2ႈFHULQZULWLQJRIWKHLULQWHQWLRQWRGR competitors of the winning team of the event. VR2WKHUZLVHWKH\ZLOOEHGLVTXDOL¿HGIURPWKH event. $OO FODVVL¿HG FRPSHWLWRUV PXVW DWWHQG WKH ceremony. The presence of the complete team (driver and If a competitor is eligible to receive a trophy and co-driver) at the Driver’s meeting held at the does not attend the ceremony, he/she loses their Registration Park before the start of the event right to the trophy and also loses their right to is mandatory. Not attending will result in a 30 lodge a protest or an appeal. -seconds penalty.
33.2. Overall trophies Double trophies (driver and co-driver) will be awarded to the 1st, 2nd and 3rd. places of the RYHUDOO¿QDOFODVVL¿FDWLRQWRWKH3DQDPHULFDQ&DUV group and the Historic Cars group in Durango.
33.3. Category trophies Double trophies (driver and co-driver) will be DZDUGHGWRWKHVWQGDQGUGSODFHVRIWKH¿QDO FODVVL¿FDWLRQRIHDFKFDWHJRU\LQ'XUDQJR
33.4. Awards per stage Medals will be given to each driver and co- GULYHUZKRFRPSOHWHWKHVWDJHDWWKH¿QLVKDUFK Additionally, double trophies (driver and co- GULYHU IRUWKH¿UVWSODFHVRIHDFKFDWHJRU\IRU each stage will be given during the daily Driver’s meeting / Award Dinners.
33.5. Award dinners and drivers' meetings The results of each stage and the starting order for the following stage, are posted at the end of each VWDJHRQWKHRႈFLDOERDUGV$'ULYHU¶VPHHWLQJ Award Dinner will be held every day at 20:30. $WOHDVWRQHFRPSHWLWRUIURPHDFKRIWKHFODVVL¿HG teams that have the possibility and intention to start the following stage must attend these dinners. In case of not attending, the team will receive a 30
81 La Carrera Panamericana RULE BOOK 2020
APPENDIX 1 - GLOSSARY
Registration Park very close to each other; and considering that the Area where the competing cars attend scrutineering VHUYLFHDUHDLVXVXDOO\FORVHGRႇWKHGLVWDQFHWR before the event and repairs and interventions to cover is considered "zero". The time indicated the cars are permitted. It is forbidden to refuel in LQ WKH 5RXWH %RRN WR FRYHU WKHVH VHFWLRQV LV this area. The cars are free to enter and exit this calculated considering that there are no delays area when necessary. during the stage.
At the registration park, besides scrutineering, Speed Section with a Transit Section the administrative checks, medical exams, These sections always start at an "A" Control and distribution of the OMDAI-FIA and FEMADAC ¿QLVKDWD&+RU&+3&RQWURO OLFHQVHV GLVWULEXWLRQ RI WKH RႈFLDO VWLFNHUV DQG registration and authorization to compete in La The time for these sections is indicated in the Carrera Panamericana take place 5RXWH%RRNDQGRQDWHDP¶VWLPHFDUGV
"Parc fermé" These sections always start with a Speed Section Area where repairs, interventions on the cars or DWDQ$&RQWURO WKH6SHHG6HFWLRQ¿QLVKHVDW UHIXHOLQJLVIRUELGGHQ H[FHSWIRUFDVHVVSHFL¿FDOO\ D%&RQWURODQGWKHSDVVDJHWLPHIRUWKLVODVW LQGLFDWHGLQWKLV5XOH%RRN control is written on the time card of the team at "C" Control; the place where a new Transit Section Stage will start until the following "CH" or "CH-P" Control The daily segment of the event. The start and indicating the end of that section. ¿QLVKRIWKHGD\¶VHYHQWV VWDUWLQJLQRQHFLW\DQG ¿QLVKLQJ LQ DQRWKHU /D &DUUHUD 3DQDPHULFDQD Race Bulletins 2020 will have 7 stages, as indicated in Chapter I. 2ႈFLDO EXOOHWLQV IRUP DQ LQWHJUDO SDUW RI WKH (DFKVWDJHLVGLYLGHGLQWRGLႇHUHQWVHFWLRQV rules of the event. There are two types of - Transit Sections 5DFH %XOOHWLQV 5HJXODWRU\ %XOOHWLQV which - Service Sections DQQRXQFH PRGL¿FDWLRQV FODUL¿FDWLRQV WR WKH - Speed Section with a Transit Section UXOHV ZKLFK FRPSOHPHQW WKH 5XOH %RRN DQG ,QIRUPDWLYH %XOOHWLQV ZKLFK DQQRXQFH LPSRUWDQW Transit sections announcements to the competitors that deal with These sections are between: the route, schedule, social events, etc. a) Two "CH-P" Time Controls The bulletins must be dated, numbered and duly b) A "CH-P" Control and a "CH" Control authorized. Participants must take note of these EXOOHWLQV ZKLFK ZLOO EH SXEOLVKHG RQ WKH RႈFLDO The times to cover these sections are indicated boards when necessary. LQWKH5RXWH%RRNDQGRQWKHWLPHFDUGVRIWKH team. The time given to a team to cover the Transit The bulletins are issued by the Clerk of the Course Sections is enough to allow them to respect the up until the date of scrutineering in Querétaro. ODZWUDႈFVLJQDOVDQGOHJDOVSHHGOLPLWV These are published as soon as possible and will be located in the Permanent Secretariat on Service Sections WKH RႈFLDO ERDUGV DQG RQ WKH RႈFLDO ZHE VLWH 7KHVHVHFWLRQVDOZD\VVWDUWDQG¿QLVKZLWKD&+ at: http://www.lacarrerapanamericana.com. P" Control. mx/2018/en/race-bulletins/ Generally, both controls are in the same place or 82 La Carrera Panamericana RULE BOOK 2020
Time card It is the card that is used to register the times of the teams as they pass the Time Controls of the Speed Sections. Each team receives a time card for each stage that indicates their start time that must be adhered to.
'LVTXDOL¿FDWLRQIURPDVHFWLRQ The maximum penalty of a section. This includes a penalty of 30 seconds at each of the Time &RQWUROVDWWKHVWDUWDQG¿QLVKRIWKHVHFWLRQ the maximum time assigned to the Speed Section of that section.
'LVTXDOL¿FDWLRQIURPDVWDJH The maximum penalty of a stage. This includes a penalty of 30 seconds at each of the time and passage controls, + the maximum time assigned to each of the Speed Sections of that stage.
([FOXVLRQRUGLVTXDOL¿FDWLRQIURPWKHHYHQW A team is excluded from the event if they fail to comply with the technical and safety rules and UHTXLUHPHQWVEHIRUHWKHHYHQWRႈFLDOO\VWDUWV
Once the event has started the team that fails to abide by the rules and comply with all requirements ZLOOEHGLVTXDOL¿HG
In both cases, a team will not be permitted to start the following section/stage from the moment a WHDP LV QRWL¿HG DQG GHSHQGLQJ RQ WKH GHFLVLRQ PDGHE\WKHRႈFHUV
83 La Carrera Panamericana RULE BOOK 2020
APPENDIX 2 - SAFETY
Safety
1. Roll-cage:
Drawing of the basic roll-cage Drawing showing how to screw WKH¿[LQJSODWH
Drawing showing how to screw Drawing showing how to screw WKH¿[LQJSODWH WKH¿[LQJSODWH
Drawing of the diagonal member Drawing of the diagonal member
84 La Carrera Panamericana RULE BOOK 2020
Drawing of the diagonal member Drawing of the doors reinforcement
Drawing of the doors reinforcement Drawing of the doors reinforcement
Drawing of the roof reinforcement Drawing of the roof reinforcement
85 La Carrera Panamericana RULE BOOK 2020
Drawing of the roof reinforcement Drawing of the anchorage of the seats
Drawing of the additional back member which may also serve Drawing of the anchorage of the WR¿[WKHVKRXOGHUVWUDSV7KH straps when screws are used member must be drilled in the in the back member place indicated with "A"
Drawing of the angles to install the belts
86 La Carrera Panamericana RULE BOOK 2020
7KHIROORZLQJGUDZLQJVKRZVKRZWRDQFKRUWKH¿[LQJSRLQWVRIWKHKDUQHVVHVRIWKHVDIHW\EHOWV7KH arrow indicates how to place the reinforcement plate for each point anchored to the chassis.
'UDZLQJRIWKH¿[LQJSRLQWVRIWKHVDIHW\EHOWV
* The drawings of the roll-cage have been extracted from Article 253, Appendix "J" of the International Sporting Code of the FIA.
2. Cutter Picture of the cutter that must be used (Article 20.8 b)
87 La Carrera Panamericana RULE BOOK 2020
3. Seats: Examples of the labels of the seats that are valid for La Carrera Panamericana 2018.
4. Seat Belts: Examples of the labels of the seat belts that are valid for La Carrera Panamericana 2018.
88 La Carrera Panamericana RULE BOOK 2020
5. Overalls: Examples of the labels of the overalls that are valid for La Carrera Panamericana 2018.
6. Shoes: Examples of the labels of the shoes that are valid for La Carrera Panamericana 2018.
89 La Carrera Panamericana RULE BOOK 2020
7. Head and neck support devices: Examples of the labels of the head and neck support devices that are valid for La Carrera Panamericana 2018.
8. Helmets: Examples of the labels of the helmets that are valid for La Carrera Panamericana 2018.
* The images of the labels of the safety equipment have been extracted from Article 253, Appendix "J" of the International Sporting Code of the FIA.
90 La Carrera Panamericana RULE BOOK 2020
APPENDIX 3 Sequence of Control Signals and the "A" Control Blackboard
Signals to link: - a Transit Section with a Service Section - a Transit Section with another Transit Section - a Service Section with a Transit Section
Signals to START a Speed Section
Signals to END a Speed Section
b) Sequence of the control signals for Passage Control "CH-P" and to indicate a Control Area. These signals are used to link a Transit Section with a Service Section, a Transit Section with another Transit Section or a Service Section with a Transit Section.
Sequence of signals - Passage Control "CH-P" - START of Time Control. END of Control Area Passage time taken Control Area
START END 91 La Carrera Panamericana RULE BOOK 2020 c) Sequence of the control signals for the "CH" Time Control, to indicate the START of a Speed Section "A" and Control Area. These signals are used to indicate the END of a Speed Section. Sequence of signals - Start of Speed Section - START of Time Control. START of END of Control Area Passage time taken Speed Section Control Area Time Control Start of Speed Direction of Event End of the Section Section Control 15 - 20mt 50 - 100mt 15 - 20mt START Control Area END d) 6HTXHQFHRIWKHFRQWUROVLJQDOVIRUWKHHQGRID%&6SHHG6HFWLRQDQGWRLQGLFDWHD&RQWURO$UHD These signals are used to indicate the END of a Speed Section. Sequence of signals - End of Speed Section - START of END of Speed Section Control END of END of Control Area DO NOT STOP Speed Section Control Area Direction of Event 50 - 100mt 100 - 800mt 15 - 20mt START Control Area END 92 La Carrera Panamericana RULE BOOK 2020 e) Sequence of the control signals for a complete Speed Section and its Control Areas. These signals are used for a complete Speed Section: From the "CH" Time Control of the end of the previous Transit 6HFWLRQ3DVVDJHDWDQ$&RQWURO7KHHQGRIWKH6SHHG6HFWLRQDWWKH%&RQWURODQGWKH$/72VLJQ &&RQWURO where the next Transit Section will start.. Sequence of signals - Complete Speed Section - Control Area Control Area START END SPEED SECTION Direction of the event 93 La Carrera Panamericana RULE BOOK 2020 SIGNALS FOR THE BOARD AT "A" CONTROL SECTION CANCELLED OPEN ROAD - BEWARE OF TRAFFIC - FALLING ROCKS CATTLE AHEAD LOOSE GRAVEL 94 La Carrera Panamericana RULE BOOK 2020 APPENDIX 4 Reference drawing to build a new chassis 95 La Carrera Panamericana RULE BOOK 2020 NOTES 96 La Carrera Panamericana RULE BOOK 2020 NOTES 97 La Carrera Panamericana RULE BOOK 2020 NOTES 98 La Carrera Panamericana RULE BOOK 2020 NOTES 99 RULEBOOK Oaxaca Av. Lindavista 312, Col. Lindavista, 2020 Veracruz C.P. 07300, Ciudad de México. CDMX Tels.: +52 (55) 5586 6898 +52 (55) 5754 6052 Queretaro www.lacarrerapanamericana.com.mx Morelia Guanajuato Zacatecas Durango