KASEEMA Barn 47 Hip No. 1513

Total Page：16

File Type：pdf, Size：1020Kb

Consigned by Bluewater Sales LLC, Agent I Barn KASEEMA Hip No. 47 Dark Bay or Brown Mare; foaled 2004 1513 Northern Dancer Storm Bird ............................ South Ocean Storm Cat .............................. Secretariat Terlingua ................................ Crimson Saint KASEEMA Raise a Native Mr. Prospector ...................... Gold Digger Onaga .................................... (1994) Northern Dancer Savannah Dancer .................. *Valoris II By STORM CAT (1983). Black-type winner of $570,610, Young America S. [G1] , etc. Leading sire twice, sire of 21 crops of racing age, 1452 foals, 1111 starters, 177 black-type winners, 8 champions, 811 winners of 2387 races and earning $128,331,744. Leading broodmare sire 3 times, sire of dams of 284 black-type winners, 14 champions, including Lord Kanaloa, Kizuna, Phalaenopsis, Shared Belief, Close Hatches, Honor Code, Speightstown, Folklore, Cuqui's Love, Light Cat, Pachangera, Halagadora. 1st dam ONAGA, by Mr. Prospector. Placed to 4, $23,925. Sister to SHA THA [G2] (Total: $363,999), half-sister to BRIER CREEK [G3] (Total: $170,117). Dam of 8 registered foals, 8 of racing age, 7 to race, 4 winners, incl.-- ARAGORN (IRE) (c. by Giant's Causeway). Placed in 1 start at 2, 2,737, in Ireland; 5 wins in 9 starts at 3 and 4, $1,508,400, in N.A./U.S.€, Eddie Read H. [G1] (DMR, $240,000)-ncr, 1 1/8 mi. in 1:44 3/5, Shoemaker Breeders' Cup Mile S. [G1] (HOL, $204,600), Del Mar Breeders' Cup H. [G2] (DMR, $240,000), etc.; winner at 3, £9,424, in England, 3rd Cheve - ley Park Stud King Charles II S. [L]. (Total: $1,529,325). Sire. Luce (f. by Sadler's Wells). Unplaced in England. Dam of 5 winners, incl.-- KING OF ARNOR (g. by Monsun). 3 wins at 3, 85,850, in France, Prix Frederic de LaGrange [L], etc. (Total: $121,0€76). Rosie Cotton (f. by King's Best). Winner at 3, 57,500, in France, 3rd Prix Volterra [L], Prix Melisande [L], Prix de M€ontretout [L]; placed in 1 start at 4 in England, 3rd Princess Elizabeth S. [G3] . (Total: $76,387). RACE RECORD: In England. At 2, one win in 2 starts; at 3, unplaced. Earned £8,048. (Total: $15,447). PRODUCE RECORD: 2009 Misfaat, f. by Haafhd. Placed at 3, 2,600, in France. (Total: $3,454). 2010 Musayeh, c. by Invasor (ARG). Unr€aced, died at 2. 2011 Arbaab, c. by Dynaformer. Placed at 2 in England. 2012 Bishara, f. by Dubawi. Placed in 2 starts at 3 in England. 2013 not mated; 2015 aborted single foal. 2014 Zainhom , c. by Street Cry (IRE). Winner at 2, £37,065, in England, 2nd Dubai 100 Autumn S. [G3] , 3rd JLT Greenham S. [G3] , Matchbook Trad- ers Conference Heron S. [L]; placed at 4 and 5, 2019, 107,300 dirhams, in U.A.E., 3rd HH The President Cup [L]. (Total: $76,533). 2016 Wajeeha, f. by Medaglia d'Oro. Unraced. 2017 Ahnaf, c. by Street Sense. Unraced. 2018 c. by Kitten's Joy; 2019 not pregnant. Mated to Street Sense (Street Cry (IRE)--Bedazzle), last service February 26, 2019. (Believed to be PREGNANT ). NTRA..

Copy Link

Recommended publications

Gdowth Should Detudn...Some
INFORMATION AND ANALYSIS FOR THE THOROUGHBRED INVESTOR JUNE 2010 Yearling Sales Preview By Eric Mitchell 2. YEARLING AUCTION REVIEW GROWTH SHOULD RETURN...SOME BY SALE, '05-'07 hat will happen in the Thoroughbred yearling and the overall quality of the horses should improve 4. LEADING Wmarket is particularly hard to predict this year. as sellers become more selective about the yearlings CONSIGNORS OF Many influences of equal importance, both positive and they offer. The ROR should also improve slightly com- YEARLINGS '05-'07 negative, could shape the market, but which of these pared with 2009. The select 2-year-olds sales experi- influences will predominate is the big question. enced an increase in ROR to 70%, up from 30% in 2008. 5. LEADING BUYERS In 2009 the rate of return on pinhooked yearlings hit The average juvenile price improved to $160,732 from OF YEARLINGS a rock-bottom low of -42.2%. It didn’t help sellers that $147,528. Clearly, there is still an appetite for acquiring '05-'07 these horses had been bred on the highest average stud Thoroughbreds, so an increase in the average yearling fee ($31,462) seen in the last 10 years, and the average price between 5% and 10% is not unreasonable, though 6. RACING STATS yearling price also fell 31% as part of the fallout from the such an increase would still produce losing RORs for the FOR SUMMER global financial crisis. pinhook yearling market. The average pinhook yearling SIRES PROGENY Sellers don't get any relief on the cost side this year price would have to grow at least 18% to $57,884 for sell- because North American stud fees were still relatively ers to break even collectively.
[Show full text]
September Yearling Sales
SPECIAL ADVERTISING SECTION Yearling Section Advertising Index THE ACORN, LLC ALL STAR THOROUGHBREDS September Yearling Sales (www.allstarthoroughbreds.com) ASMUSSEN HORSE CENTER (www.asmussens.com) BARCLAYS COLLAR (www.barclayscollar.com) BETH BAYER, AGENT BARRY BERKELHAMMER BLOODSTOCK (www.abracadabrafarm.com BLACKBURN FARM (www.blackburnfarm.com) BONA TERRA STUD BREEDERS SALES CO. OF LOUISIANA (www.louisianabred.com) MICHAEL C. BYRNE, AGENT CANADIAN THOROUGHBRED HORSE SOCIETY (www.cthsont.com) WEBB CARROLL TRAINING CENTER CASTLE POST (www.thecastlepost.com) CLARKLAND FARM CLEAR CREEK STUD, LLC (www.clearcreekstudllc.com) CRESTWOOD FARM (www.crestwoodfarm.com) DARBY DAN FARM (www.darbydan.com) DOC’S EQUINE PRODUCTS (www.ocdpellets.com) EATON SALES AGENT (www.eatonsales.com) ECHO VALLEY HORSE FARM NTRA (www.supporthorseracing.org) EQUIADE PRODUCTS (www.equiade.com) EQUINETREX (www.equinetrex.com) 4M RANCH (www.4mranch.com) ANNE M. EBERHARDT GLENCREST FARM (www.glencrest.com) SEPTEMBER YEARLING SALES AND DATES GOOD WIN FARMS GREENFIELD FARM Sept. 1, Canadian Thoroughbred Horse Society Alberta summer yearling sale, Agri-Center, Red Deer, H. E. SUTTON FORWARDING CO. Alberta, Canada (www.suttonforwarding.com) Sept. 4-6, Ruidoso select yearling sale, Ruidoso Downs Racetrack, Ruidoso, NM IRON COUNTY FARMS, INC. Sept. 4-5, Baden-Baden yearling sale, Baden-Baden Sales Co., Baden-Baden, Germany KESMARC/Equine Oxygen Therapy Sept. 6, Canadian Thoroughbred Horse Society Manitoba division annual yearling sale, Assiniboia (www.kesmarc.com and Downs, Winnipeg, Manitoba, Canada www.equinehyperbarics.com) Sept. 8, Canadian Thoroughbred Horse Society Ontario division selected yearling sale, Woodbine LEGACY BLOODSTOCK Sales Pavilion, Toronto, Ontario, Canada (www.legacybloodstock.com) Sept. 8, Washington Thoroughbred Breeders Association summer yearling sale, M.J.
[Show full text]
NORTHERN CAUSEWAY Ch, 2008
NORTHERN CAUSEWAY ch, 2008 Dosage (4-1-23-0-0); DI: 1.43; CD: 0.32 See gray pages—Nearctic RACE AND (BLACK TYPE) RECORD Storm Bird, 1978 Northern Dancer, by Nearctic 6s, BTW, $169,181 Age Starts 1st 2nd 3rd Earned Storm Cat, 1983 682 f, 63 BTW, 2.26 AEI South Ocean, by New Providence 2 1 0 0 0 $560 8s, BTW, $570,610 3 11 4(2) 3 0 $211,311 1,414 f, 177 BTW, 2.94 AEI Terlingua, 1976 Secretariat, by Bold Ruler 17s, BTW, $423,896 4 10 1 0 3(1) $39,201 Giant's Causeway, ch, 1997 13s, BTW, $3,078,989 11 f, 9 r, 6 w, 2 BTW Crimson Saint, by Crimson Satan 5 6 0 1 0 $9,990 2,484 f, 193 BTW, 1.79 AEI Rahy, 1985 Blushing Groom, by Red God 6 2 0 0 1 $4,305 8.38 AWD 13s, BTW, $347,767 Totals 30 5(2) 4 4(1) $265,367 Mariah's Storm, 1991 1,133 f, 92 BTW, 2.19 AEI Glorious Song, by Halo 16s, BTW, $724,895 Won At 3 14 f, 11 r, 8 w, 2 BTW Immense, 1979 Roberto, by Hail to Reason British Columbia Derby (G3, $200,660, 9f in 1:50.22, 28s, BTW, $123,324 dftg. Jebrica, Arraignment, Commander, 6 f, 6 r, 5 w, 3 BTW Imsodear, by Chieftain Couldabenthewhisky, Northern Indy, Herbie D, Line Deputy Minister, 1979 Vice Regent, by Northern Dancer Change, Hurricane Lake, Inhisglory, Winter 22s, BTW, $696,964 Warlock, Fransor’s Finest).
[Show full text]
Graydar Oxbow
GRAYDAR OXBOW We have enjoyed tremendous success in standing/managing stallions over the last 20 years. KRIS S. SAINT BALLADO UNBRIDLED’S SONG 2 Dear Breeder, Taylor Made is a family owned and operated farm built on honesty, long-lasting relationships and horsemanship. Taylor Made Stallions’ mode of operation has always been – and remains – to focus on standing quality stallions that provide breeders great opportunities, whether they are breeding to race or sell. 2013 was a bounce-back year for commercial breeders, including a GSVRIVXYVRMRK/IIRIPERH7ITXIQFIVWEPIXLEXWE[KEMRWEGVSWWXLIFSEVHLMKLPMKLXIHF]WIZIR½KYVI]IEVPMRKWERHFSEWXMRK the third highest average of all time. The recent market results have proven that the well-conformed individual has re-emerged as the most important component SJEFY]IV´WWIPIGXMSRGVMXIVME,IVIEX8E]PSV1EHI[IQEOIWYVIIEGLSJSYVWXEPPMSRWVI¾IGXXLEXGSQTSRIRX3YVXIEQLEW been highly selective in providing the breeder a top group of well-conformed stallions whose progeny will be well received at the track and in the sales ring. Last year also marked a bittersweet landmark for one of the great sires of our time. While reaching 17 Grade 1 winners over his historic career in 2013, Unbridled’s Song passed away at the age of 20. Every person at Taylor Made has been touched by this amazing animal over the years. He leaves a lasting legacy that will never be forgotten across the industry he served so well. And yet there is much to look forward to in 2014. The legacy continues with our newest stallion, Graydar, the Grade 1-winning son of Unbridled’s Song. One of the most stunning physicals to come to the breeding shed in years, Graydar had a brilliant VEGIGEVIIVMRGPYHMRKEGSQQERHMRKZMGXSV]MRXLI(SRR,ERHMGET + EX+YPJWXVIEQ4EVO;IEVIGSR½HIRXLI[MPPFI a favorite among breeders as Taylor Made Stallions adds another chapter to its storied tradition.
[Show full text]
Pedigree PROFILES Thursday, May 16
Pedigree PROFILES THURSDAY, MAY 16 PREAKNESS STAKES CONTENDERS Special Digital Report brought to you by & 2 2013 Pedigree Profiles rb will face a small field of would-be spoilers May 18 as he seeks to add the Preakness Stakes (gr. I) to his Kentucky Derby Presented by Yum! Brands (gr. I) score. Nine horses O will go to the post to contend for the 138th running of Pimlico’s classic, five fewer than the race’s 14-contestant maximum. Profiles of the entrants appear in the following pages. Accompanying each analysis is a four-generation pedigree chart with inbreeding notation. Sire line and female family notes at the end of each profile provide additional depth to the bloodlines analysis. Two popular pedigree-driven ratings appear in a chart on page 3. Dosage is a system that attempts to predict a horse’s aptitude by calculating the influence of prominent sires in his pedigree. TrueNicks, a service owned in part by Blood-Horse Publications, rates the strength of a pedigree’s sire/broodmare sire cross, or “nick.” Brisnet.com provides past-performance statistics for all Preakness contenders in the report’s final section. Post positions, morning line odds, and our experts’ selections round out the rich array of infor- mation contained in this pedigree overview of the 2013 Preakness contestants. Pedigree Analysts’ Picks Scot T. Gillies Avalyn Hunter Alan Porter Departing Orb Orb Orb Govenor Charlie Oxbow Itsmyluckyday Goldencents Will Take Charge Tom Hall Eric Mitchell Ian Tapp Orb Orb Goldencents Oxbow Oxbow Will Take Charge Departing Will Take
[Show full text]
TAKE CHARGE BRANDI Barn 12 & 14 Hip No
Consigned by Hill 'n' Dale Sales Agency, Agent Barn TAKE CHARGE BRANDI Hip No. 12 & 14 Chestnut Filly; foaled 2012 450 Storm Bird Storm Cat .......................... Terlingua Giant's Causeway .............. Rahy Mariah's Storm ................ Immense TAKE CHARGE BRANDI Mr. Prospector Seeking the Gold .............. Con Game Charming .......................... (2005) Dehere Take Charge Lady .............. Felicita By GIANT'S CAUSEWAY (1997). European horse of the year, black-type win - ner of $3,078,989, Esat Digifone Irish Champion S. [G1] , etc. Leading sire 3 times, sire of 12 crops of racing age, 2246 foals, 1670 starters, 155 black-type winners, 1099 winners of 3149 races and earning $134,467,- 480, 8 champions, including Shamardal ($1,931,770, Gainsborough Poule d'Essai des Poulains-French Two Thousand Guineas [G1] , etc.), Take Charge Brandi [G1] ($1,682,126), and of Aragorn (IRE) [G1] ($1,529,325). 1st dam CHARMING, by Seeking the Gold. Winner at 3, $43,155. Dam of 4 registered foals, 3 of racing age, including a 2-year-old of 2015, 2 to race, 2 winners-- TAKE CHARGE BRANDI (f. by Giant's Causeway). Champion, see record. Siete C (c. by Unbridled's Song). 3 wins at 4, $100,110. 2nd dam TAKE CHARGE LADY , by Dehere. 11 wins in 22 starts, 2 to 4, $2,480,377, Ash - land S. [G1] (KEE, $345,805), Overbrook Spinster S. [G1] (KEE, $338,520), Overbrook Spinster S. [G1] (KEE, $310,000), Walmac International Alcibi - ades S. [G2] , Fair Grounds Oaks [G2] (FG, $210,000), Arlington Matron H. [G3] (AP, $90,000), Silverbulletday S. [G3] (FG, $90,000), Dogwood S.
[Show full text]
FED BIZ Bay Horse; Foaled 2009 Storm Bird Storm Cat
FED BIZ Bay Horse; foaled 2009 Storm Bird Storm Cat .......................... Terlingua Giant's Causeway .............. Rahy Mariah's Storm ................ Immense FED BIZ Icecapade Wild Again ........................ Bushel-n-Peck Spunoutacontrol .............. (1996) Mr. Prospector Yarn .................................. Narrate By GIANT'S CAUSEWAY (1997). European horse of the year, black-type win - ner of $3,078,989, Esat Digifone Irish Champion S. [G1] , etc. Leading sire 3 times, sire of 13 crops of racing age, 2342 foals, 1788 starters, 165 black- type winners, 1171 winners of 3444 races and earning $145,243,033, 8 champions, including Shamardal ($1,931,770, Gainsborough Poule d'Essai des Poulains-French Two Thousand Guineas [G1] , etc.), Take Charge Brandi [G1] ($1,692,126), and of Aragorn (IRE) [G1] , Carpe Diem [G1] . 1st dam SPUNOUTACONTROL , by Wild Again. 4 wins in 5 starts to 4, $86,405, Singing Beauty S.-R (LRL, $26,145). Dam of 8 foals, 5 to race, all winners, incl.-- FED BIZ (c. by Giant's Causeway). Black-type winner, below. SPUN SILK (f. by A.P. Indy). 2 wins at 3, $65,750, Ride Sally S.-R (AQU, $40,050). Dam of 3 foals to race, including-- JOKING (g. by Distorted Humor). 9 wins, 3 to 7, 2016, $636,138, True North S. [G2] (BEL, $137,500), Diablo S. [L] (BEL, $60,000). Whichwaydidshego (f. by Storm Cat). Winner at 2, $32,420. Dam of-- MARK MY WAY (g. by Noonmark). 7 wins, 2 to 5, 2016, $235,594, New York Stallion S.-R (BEL, $60,000), New York Stallion Series S.-R (SAR, $60,000).
[Show full text]
CARPE DIEM Chestnut Horse; Foaled 2012 Storm Bird Storm Cat
CARPE DIEM Chestnut Horse; foaled 2012 Storm Bird Storm Cat .......................... Terlingua Giant's Causeway .............. Rahy Mariah's Storm ................ Immense CARPE DIEM Unbridled Unbridled's Song .............. Trolley Song Rebridled Dreams ............ (2000) Corridor Key Key Cents .......................... Centimeter By GIANT'S CAUSEWAY (1997). European horse of the year, black-type winner of $3,078,989, Esat Digifone Irish Champion S. [G1] , etc. Leading sire 3 times, sire of 15 crops of racing age, 2435 foals, 1831 starters, 168 black- type winners, 1210 winners of 3563 races and earning $149,977,145, 8 champions, including Shamardal ($1,931,770, Gainsborough Poule d'Essai des Poulains-French Two Thousand Guineas [G1] , etc.), Take Charge Brandi [G1] ($1,692,126), and of Aragorn (IRE) [G1] ($1,529,325), Giant Oak [G1] . 1st dam REBRIDLED DREAMS , by Unbridled's Song. 4 wins at 2 and 3, $134,663, Money Penny S. (HAW, $25,920), 3rd Silverbulletday S. [G2] (FG, $16,500). Dam of 9 foals, 8 to race, 7 winners, including-- CARPE DIEM (c. by Giant's Causeway). Black-type winner, below. J. B.'S THUNDER (c. by Thunder Gulch). 2 wins at 2, $280,130, Dixiana Breeders' Futurity [G1] (KEE, $240,000). FARRELL (f. by Malibu Moon). 4 wins in 6 starts at 2 and 3, 2017, $361,357, Rachel Alexandra S. [G2] (FG, $120,000), Golden Rod S. [G2] (CD, $115,320), Silverbulletday S. [L] (FG, $90,000), 3rd Rags to Riches S. (CD, $8,087). DONCASTER ROVER (c. by War Chant). 5 wins, 2 to 5, £198,107, in Eng - land, Debenhams City of York S., Flight Centre Chester Queensferry S., Novae Bloodstock Insurance Hopeful S., 2nd Timeform Jury John of Gaunt S.
[Show full text]
NORTHERN CAUSEWAY Ch, 2008
Enters Stud in 2015 NORTHERN CAUSEWAY ch, 2008 Dosage (4-1-23-0-0); DI: 1.43; CD: 0.32 See gray pages—Nearctic RACE AND (STAKES) RECORD Storm Bird, 1978 Northern Dancer, by Nearctic 6s, SW, $169,181 Age Starts 1st 2nd 3rd Earned Storm Cat, 1983 681 f, 64 SW, 2.27 AEI South Ocean, by New Providence 2 1 0 0 0 $560 8s, SW, $570,610 3 11 4(2) 3 0 $211,311 1,414 f, 181 SW, 2.96 AEI Terlingua, 1976 Secretariat, by Bold Ruler 17s, SW, $423,896 4 10 1 0 3(1) $39,201 Giant's Causeway, ch, 1997 13s, SW, $3,078,989 11 f, 9 r, 6 w, 2 SW Crimson Saint, by Crimson Satan 5 6 0 1 0 $9,990 2,030 f, 156 SW, 1.84 AEI Rahy, 1985 Blushing Groom, by Red God 6 2 0 0 1 $4,305 8.51 AWD 13s, SW, $347,767 Totals 30 5(2) 4 4(1) $265,367 Mariah's Storm, 1991 1,131 f, 96 SW, 2.22 AEI Glorious Song, by Halo 16s, SW, $724,895 Won At 3 12 f, 10 r, 7 w, 2 SW Immense, 1979 Roberto, by Hail to Reason British Columbia Derby (Can-III, $200,660, 9f in 28s, SW, $123,324 1:50.22, dftg. Jebrica, Arraignment, Commander, 6 f, 6 r, 5 w, 3 SW Imsodear, by Chieftain Couldabenthewhisky, Northern Indy, Herbie D, Line Deputy Minister, 1979 Vice Regent, by Northern Dancer Change, Hurricane Lake, Inhisglory, Winter 22s, SW, $696,964 Warlock, Fransor’s Finest).
[Show full text]
Mating Analysis Morning Line
MATING ANALYSIS You may submit your mare online at lanesend.com or call 859-873-7300 to discuss your matings with CHANCE TIMM, [email protected], JILL MCCULLY, [email protected] or LEVANA CAPRIA, [email protected]. MORNING LINE Tiznow - Indian Snow, by A.P. Indy 2007 Dkb/br | 16.2 Hands Morning Line is a grade one winning sprinter/miler with a powerful pedigree. A son of Horse of the Year and outstanding sire, Tiznow, Morning Line’s dam is by A.P. Indy out November Snow, a multiple grade one winning daughter of Storm Cat. Morning Line is free of Mr. Prospector and Tiznow and sons have done well over a number of branches of this line. There are grade one winners out of mares by Mr. Prospector himself, Lord Carson (whose sire, Carson City, is a very positive influence for Tiznow); and graded winners out of mares by Unbridled’s Song (by Unbridled), and Pentelicus (a three-quarters brother to Unbridled); Smart Strike: and Mr. Greeley and Grand Slam (both by Gone West, whose son West By West is also broodmare sire of a stakes winner from this line); and stakes winners out of mares by Seeking the Gold and Street Cry. Morning Line’s second dam is by Storm Cat, and the cross of Tiznow over a Storm Cat mare produced Champion Two-Year-Old Filly Folklore. It may well be worth duplicating Storm Cat through such as Stormy Atlantic and Stormin Fever (both reverse crosses to the dam of Morning Line), Hennessy and Tabasco Cat (both broodmare sires of graded winners by Tiznow), Tale of the Cat, Storm Boot, Forest Wildcat, Forestry and Giant’s Causeway.
[Show full text]
ANGLIANAANGLIANA 2002 Chestnut - Dosage Profile: 7-1-25-1-0; DI: 1.52; CD: +0.41
ANGLIANAANGLIANA 2002 Chestnut - Dosage Profile: 7-1-25-1-0; DI: 1.52; CD: +0.41 Nearctic RACE AND (STAKES) RECORD Northern Dancer Natalma Age Starts 1st 2nd 3rd Earnings Storm Bird New Providence 2 2 1 0 0 $27,450 South Ocean Shining Sun 3 8 1 1(1) 2 58,765 Storm Cat Bold Ruler 4 7 2 3(2) 0 112,447 Secretariat Somethingroyal 5 2 0 1(1) 1(1) 29,220 Terlingua Crimson Satan 6 9 1(1) 4(1) 3(3) 161,880 Crimson Saint Bolero Rose Giant's Causeway (1997) 7 2 0 0 0 170 Red God Blushing Groom (FR) 8 1 0 0 0 1,200 Runaway Bride (GB) Rahy 31 5(1) 9(5) 6(4) $391,132 Halo Glorious Song Ballade Mariah's Storm At 2, WON a maiden special weight race at Aqueduct (1 Hail to Reason Roberto Bramalea 1/16 mi., defeating Curlew Road, King’s Choice, Cap- Immense Chieftain tain Slew, etc.). Imsodear Ironically At 3, WON an allowance race at Belmont Park (1 3/8 mi., Angliana Native Dancer Raise a Native turf, defeating Prep School, Swordsman (GER), Victory Raise You Mr. Prospector Circle, etc.), 2nd Lawrence Realization S.-L at Nashua Gold Digger Sequence Belmont Park (1 1/8 mi., to Taming the Tiger, defeating Jade Hunter Lyphard Crown Point, Swordsman (GER), etc.). Pharly Comely (FR) At 4, WON an allowance race at Delaware Park (1 1/16 mi., top Jadana (IRE) *Match II Janina weight of 123 lbs., defeating Golden Rainbow, Belongs to Jennifer Pratella (1995) Joe, Letterman’s Humor, etc.), an allowance race at Del- Hail to Reason Halo Cosmah aware Park (1 1/16 mi., by 4 3/4 lengths, defeating Pay the Devil's Bag *Herbager Preacher, Orlop, Baby League, etc.), 2nd Red Smith H.- Ballade Miss Swapsco G3 at Aqueduct (1 1/4 mi., to Naughty New Yorker, de- Dancing Devlette Northern Dancer Nijinsky II feating Crown Point, Chilly Rooster, etc.), Gallant Fox Flaming Page Terpsichorist H.
[Show full text]
Essential Quality Gray Or Roan Colt; Apr 09, 2018 A.P
equineline.com Product 40P 12/26/20 14:01:54 EST Essential Quality Gray or Roan Colt; Apr 09, 2018 A.P. Indy, 89 dk b/ Pulpit, 94 b Preach, 89 b Tapit, 01 gr/ro Unbridled, 87 b Essential Quality Tap Your Heels, 96 gr/ro Ruby Slippers, 82 ro Foaled in Kentucky Gone West, 84 b Elusive Quality, 93 b Delightful Quality, 09 dk Touch of Greatness, 86 b b/ Storm Cat, 83 dk b/ Contrive, 98 dk b/ Jeano, 88 b By TAPIT (2001). Stakes winner of $557,300, Wood Memorial S. [G1] (AQU, $450,000), etc. Leading sire 3 times, sire of 13 crops of racing age, 1467 foals, 1204 starters, 140 stakes winners, 7 champions, 894 winners of 2674 races and earning $164,077,966 USA, including Untapable (Champion in U.S., $3,926,625, Breeders' Cup Distaff [G1] (SA, $1,100,000), etc.), Stardom Bound (Champion in U.S., $1,861,610, Breeders' Cup Juvenile Fillies [G1] (OSA, $1,080,000), etc.), Hansen (Champion in U.S., $1,810,805, Breeders' Cup Juvenile [G1] (CD, $1,080,000), etc.), Unique Bella (Champion twice, $1,272,400, Beholder Mile S. [G1] (SA, $240,000), etc.), As de Trebol (Champion in Spain, $246,135 USA, 2nd Prix du Palais-Royal [G3], etc.), Chachkova (Champion twice in Turkey, $210,276 USA, Marmara S. [L], etc.). 1st dam Delightful Quality, by Elusive Quality. Winner at 3 and 4, $253,900, 2nd Correction S. [L] (AQU, $20,000), Mandys Gold S. -R (SAR, $20,000), Garland of Roses S.
[Show full text]