DOCSLIB.ORG

Identification of an Overprinting Gene in Merkel Cell Polyomavirus Provides Evolutionary Insight Into the Birth of Viral Genes

Total Page：16

File Type：pdf, Size：1020Kb

Download full-text PDF Read full-text
Identification of an Overprinting Gene in Merkel Cell Polyomavirus Provides Evolutionary Insight Into the Birth of Viral Genes Identification of an overprinting gene in Merkel cell polyomavirus provides evolutionary insight into the birth of viral genes Joseph J. Cartera,b,1,2, Matthew D. Daughertyc,1, Xiaojie Qia, Anjali Bheda-Malgea,3, Gregory C. Wipfa, Kristin Robinsona, Ann Romana, Harmit S. Malikc,d, and Denise A. Gallowaya,b,2 Divisions of aHuman Biology, bPublic Health Sciences, and cBasic Sciences and dHoward Hughes Medical Institute, Fred Hutchinson Cancer Research Center, Seattle, WA 98109 Edited by Peter M. Howley, Harvard Medical School, Boston, MA, and approved June 17, 2013 (received for review February 24, 2013) Many viruses use overprinting (alternate reading frame utiliza- mammals and birds (7, 8). Polyomaviruses leverage alternative tion) as a means to increase protein diversity in genomes severely splicing of the early region (ER) of the genome to generate pro- constrained by size. However, the evolutionary steps that facili- tein diversity, including the large and small T antigens (LT and ST, tate the de novo generation of a novel protein within an ancestral respectively) and the middle T antigen (MT) of murine poly- ORF have remained poorly characterized. Here, we describe the omavirus (MPyV), which is generated by a novel splicing event and identification of an overprinting gene, expressed from an Alter- overprinting of the second exon of LT. Some polyomaviruses can nate frame of the Large T Open reading frame (ALTO) in the early drive tumorigenicity, and gene products from the ER, especially region of Merkel cell polyomavirus (MCPyV), the causative agent SV40 LT and MPyV MT, have been extraordinarily useful models of most Merkel cell carcinomas. ALTO is expressed during, but not to study the viral and host processes required for cellular trans- required for, replication of the MCPyV genome. Phylogenetic anal- formation (9–11). More recently, a new oncogenic polyomavirus, ysis reveals that ALTO is evolutionarily related to the middle T Merkel cell polyomavirus (MCPyV), was discovered in Merkel cell antigen of murine polyomavirus despite almost no sequence sim- carcinoma (MCC), a rare but aggressive form of skin cancer, ilarity. ALTO/MT arose de novo by overprinting of the second exon providing the first established case of a human cancer stemming EVOLUTION of T antigen in the common ancestor of a large clade of mamma- from a polyomavirus infection (12, 13). lian polyomaviruses. Taking advantage of the low evolutionary In comparison with other human polyomaviruses, the MCPyV divergence and diverse sampling of polyomaviruses, we propose LT protein contains an expanded, highly divergent region of evolutionary transitions that likely gave birth to this protein. We ∼200 amino acids encompassing two conserved short linear suggest that two highly constrained regions of the large T antigen motifs (Fig. 1A and SI Appendix, Fig. S1). Given the precedent of ORF provided a start codon and C-terminal hydrophobic motif nec- protein diversity generated from the ER of polyomaviruses, we essary for cellular localization of ALTO. These two key features, investigated the implications of this highly divergent MCPyV LT together with stochastic erasure of intervening stop codons, region. We identified an alternate T antigen ORF, hereafter resulted in a unique protein-coding capacity that has been pre- referred to as ALTO, overprinting within this region in MCPyV served ever since its birth. Our study not only reveals a previously LT (Fig. 1A) in the +1 frame relative to the second exon of LT. fi unde ned protein encoded by several polyomaviruses including ALTO is expressed during, but is not required for, viral genome MCPyV, but also provides insight into de novo protein evolution. replication. Interestingly, despite almost no sequence similarity, ALTO most probably shares a common evolutionary origin with gene evolution | synonymous substitution | disordered motifs the other known case of overprinting in polyomaviruses, the second exon of MT from MPyV. Indeed, we find that preserva- he birth of new genes has fascinated biologists for decades. tion of the overprinting ALTO/MT ORF defines a large mono- TAlthough the steps required to generate a new gene by gene phyletic clade of mammalian polyomaviruses. By comparing LT duplication or gene rearrangement have been characterized, less genes in a phylogenetic context among polyomaviruses within is known about the birth of new genes de novo. One particularly and outside this clade, we propose an evolutionary model for the intriguing mechanism of de novo gene birth is via “overprinting,” generation of a previously undiscovered viral gene de novo by in which a novel overprinting gene is encoded as an alternate ORF overprinting. within an ancestral “overprinted” gene (1). Overprinting results in two unrelated functional proteins encoded as overlapping ORFs Results within the same DNA sequence. However, the origins of such A Previously Uncharacterized Overprinting ORF in MCPyV. We noted a complex evolutionary solution have remained elusive. that the expanded, highly divergent region of MCPyV LT could Viruses appear to be especially adept at this form of evolu- encode a previously undefined protein, which we named ALTO. tionary innovation. This frequent use of overprinting is likely the ALTO is the result of an overprinting ORF that is +1 frameshifted result of the severe constraints imposed on viral genome size, making gene innovation more likely to occur as overprinting rather than within a noncoding region (2). Due to the numerous Author contributions: J.J.C., M.D.D., H.S.M., and D.A.G. designed research; J.J.C., M.D.D., examples of overprinting in single-stranded RNA viruses, a great X.Q., A.B.-M., G.C.W., and K.R. performed research; A.B.-M. and G.C.W. contributed new deal of research has focused in particular on this class of viruses reagents/analytic tools; J.J.C., M.D.D., X.Q., A.R., H.S.M., and D.A.G. analyzed data; and (3–6). However, small DNA viruses, such as adenoviruses, pap- J.J.C., M.D.D., H.S.M., and D.A.G. wrote the paper. illomaviruses, and polyomaviruses, have a similar requirement to The authors declare no conflict of interest. maximize the coding capacity of their genomes. In this study, we This article is a PNAS Direct Submission. have taken advantage of our identification of an overprinting gene 1J.J.C. and M.D.D. contributed equally to this work. born in the ancestor of a large clade of polyomaviruses to in- 2To whom correspondence should be addressed. E-mail: [email protected]. vestigate the steps that allowed generation of this unique protein. 3Present address: Institute for Systems Biology, Seattle, WA 98109. ∼ Polyomaviruses are nonenveloped viruses containing an 5-kb This article contains supporting information online at www.pnas.org/lookup/suppl/doi:10. circular double-stranded DNA genome that infect a wide range of 1073/pnas.1303526110/-/DCSupplemental. www.pnas.org/cgi/doi/10.1073/pnas.1303526110 PNAS Early Edition | 1of6 Downloaded by guest on September 30, 2021 Region of low are being evolutionarily preserved and protected from pre- A 100 similarity between MCPyV LT and sumably deleterious nonsynonymous changes. We investigated other human LTs whether the region of LT that overlaps ALTO displays decreased 50 synonymous site variation. We first compared divergence at % identity synonymous sites (dS) in LT genes in sequenced isolates of 0 900 MCPyV and found that the dS within the ALTO-encoding re- Amino acid = MCPyV LT DNAj j YGS/T LxCxE OBDD ATPase/HelicaseAT gion is 2.5 times lower than the rest of the gene (dS 0.048 for the region of overlap vs. 0.12 for nonoverlap). We found a sim- ALTO ilar pattern when we compared LT genes between MCPyV and B its closely related polyomaviruses (ChimpPyV1a, ChimpPyV2a, 196 429 861 3078 Transcript 1 Large T antigen and GorillaPyV), which also have the capacity to encode ALTO. (LT) In all pairwise comparisons, synonymous divergence is decreased 196 754 Transcript 2 Small T antigen directly overlapping the ALTO-encoding region (Fig. 1D), con- (ST) Transcript 3 sistent with both reading frames being maintained throughout 196 429 861 1622 2778 3078 viral evolution. Interestingly, the ALTO coding sequence was Transcript 4 57kD T antigen (57kT) intact in all MCPyV sequences deposited in GenBank from healthy individuals (n = 31) and from nonlesional skin from 880 1624 Frame 1 Alternative T antigen MCC patients (n = 3) but was predicted to have truncating or Frame 2 open reading frame SI Appendix Frame 3 880 1622 27782785 (ALTO) frame shift mutations in 19 of 46 MCC tumors ( , Table S1). These same mutations have also been previously C shown to truncate LT (14). 880 MGPLNSKNGGDQEDSASGRHTNMGPIHTGPTQDPESLPPMHPGEPPVEAHHPTARALPLGMGPSQRPRLQ TPSPEDPIYLPNTMRNPPHPLDPVAERRPPIQEENPAHPMEPVYLEILPERMAPGRISSAMNHFPPLSLP ALTO Is Expressed in Cells During Viral DNA Replication. To validate RPLRSLRSPPPQEARPGSPRLPLPRRPRHLSLQMRNTDPPPSPPRRPLLHSQESENLGGPEALQALLVQQ that ALTO is a bona fide MCPyV expressed protein, we trans- VLQALHQSQKRTEKLLFLLIFLLIFLIILAMLYIVIKQ(QI) fected an intact circular MCPyV genome (SI Appendix, Fig. S3) 1624 2785 into human HEK293 cells and monitored protein expression and D 1 Region of viral DNA replication. Under these conditions, the MCPyV ge- decreased dS nome has been shown to replicate its DNA for several days (19, 20). Lysates from transfected cells were analyzed by immunoblot 0.5 using immune rabbit serum that had been generated against MCPyV-GorillaPyV1 a mixture of two ALTO peptides (Fig.1C). We detected ALTO Synonymous MCPyV-ChimpPyV1a A site divergence (dS) MCPyV-ChimpPyV2a at the expected size (27.6 kDa; Fig. 2 ) in cells transfected with 0 0-100 100-200 200-300 300-400 400-500 500-600 600-700 700-800 wild-type DNA. Importantly, the ALTO protein was not detec- Amino acid window ted using a MCPyV genome bearing a point mutation that MCPyV LT DNAj j YGS/T LxCxE OBDD ATPase/HelicaseAT eliminated the predicted ALTO initiation codon without af- ALTO fecting the LT encoded protein sequence.
Load more

Recommended publications
  • SV40 Large T Antigen Targets Multiple Cellular Pathways to Elicit Cellular Transformation
    Oncogene (2005) 24, 7729–7745 & 2005 Nature Publishing Group All rights reserved 0950-9232/05 $30.00 www.nature.com/onc SV40 large T antigen targets multiple cellular pathways to elicit cellular transformation Deepika Ahuja1,2, M Teresa Sa´ enz-Robles1,2 and James M Pipas*,1 1Department of Biological Sciences, University of Pittsburgh, Pittsburgh, PA 15260, USA DNA tumor viruses such as simian virus 40 (SV40) three proteins that are structural components of the express dominant acting oncoproteins that exert their virion (VP1, VP2, VP3) and two nonstructural proteins effects by associating with key cellular targets and termed large T antigen (T antigen) and small T antigen altering the signaling pathways they govern. Thus, tumor (t antigen). In addition, some members of the Polyoma- viruses have proved to be invaluable aids in identifying viridae encode additional proteins that are virus specific proteins that participate in tumorigenesis, and in under- or are encoded by a subset of viruses in the family. For standing the molecular basis for the transformed pheno- example, SV40 encodes three such proteins: agnopro- type. The roles played by the SV40-encoded 708 amino- tein, 17K T, and small leader protein. The genomes of acid large T antigen (T antigen), and 174 amino acid small all polyomaviruses can be divided into three elements: T antigen (t antigen), in transformation have been an early coding unit, a late coding unit, and a regulatory examined extensively. These studies have firmly estab- region (Figure 1). In a productive infection, expression lished that large T antigen’s inhibition of the p53 and Rb- of the early coding unit is effected by the cellular family of tumor suppressors and small T antigen’s action transcription apparatus and results in expression of the on the pp2A phosphatase, are important for SV40-induced large, small and 17K T antigens.
    [Show full text]
  • Examining the Process of De Novo Gene Birth: an Educational Primer on “Integration of New Genes Into Cellular Networks, and Their Structural Maturation”
    PRIMER Examining the Process of de Novo Gene Birth: An Educational Primer on “Integration of New Genes into Cellular Networks, and Their Structural Maturation” Seth Frietze and Judith Leatherman1 School of Biological Sciences, University of Northern Colorado, Greeley, Colorado 80639 SUMMARY New genes that arise from modification of the noncoding portion of a genome rather than being duplicated from parent genes are called de novo genes. These genes, identified by their brief evolution and lack of parent genes, provide an opportunity to study the timeframe in which emerging genes integrate into cellular networks, and how the characteristics of these genes change as they mature into bona fide genes. An article by G. Abrusán provides an opportunity to introduce students to fundamental concepts in evolutionary and comparative genetics and to provide a technical background by which to discuss systems biology approaches when studying the evolutionary process of gene birth. Basic background needed to understand the Abrusán study and details on comparative genomic concepts tailored for a classroom discussion are provided, including discussion questions and a supplemental exercise on navigating a genome database. Related article in GENETICS: Abrusán, G., 2013 Integration of New Genes into Cellular Networks, and Their Structural Maturation. Genetics 195: 1407–1417. Background duplication has occurred over and over during evolutionary history, leaving most species with “families” of related genes IFE as we know it is encoded by the DNA of our genomes. arising from multiple duplication events (Demuth and Hahn Every cellular being has its own genome specifying the L 2009). When an organism duplicates a gene, one gene copy information required for constructing and maintaining its exis- can continue to perform the original function of that gene tence (its genotype).
    [Show full text]
  • Merkel Cell Polyomavirus DNA in Immunocompetent and Immunocompromised Patients with Respiratory Disease
    Journal of Medical Virology 83:2220–2224 (2011) Merkel Cell Polyomavirus DNA in Immunocompetent and Immunocompromised Patients With Respiratory Disease Bahman Abedi Kiasari,1,3* Pamela J. Vallely,1 and Paul E. Klapper1,2 1Department of Virology, Genomic Epidemiology Research Group, School of Translational Medicine, University of Manchester, Manchester, United Kingdom 2Clinical Virology, Manchester Medical Microbiology Partnership, Manchester Royal Infirmary, Oxford Road, Manchester, United Kingdom 3Human Viral Vaccine Department, Razi Vaccine & Serum Research Institute, Hesarak, Karaj, Iran Merkel cell polyomavirus (MCPyV) was identi- INTRODUCTION fied originally in association with a rare but aggressive skin cancer, Merkel cell carcinoma. In the past few years, a number of new human poly- The virus has since been found in the respirato- omaviruses, KI, WU, human polyomavirus 6 (HPyV6), ry tract of some patients with respiratory human polyomavirus 7 (HPyV7), trichodysplasia spi- disease. However, the role of MCPyV in the nulosa virus (TSV), human polyomavirus 9 (HPyV9), causation of respiratory disease has not been and Merkel cell polyomavirus (MCPyV) have been established. To determine the prevalence of discovered [Allander et al., 2007; Gaynor et al., 2007; MCPyV in 305 respiratory samples from Feng et al., 2008; Schowalter et al., 2010; van der immunocompetent and immunocompromised Meijden et al., 2010; Scuda et al., 2011]. MCPyV was patients and evaluate their contribution to re- discovered by digital transcriptome subtraction from a spiratory diseases, specimens were screened human skin cancer, Merkel cell carcinoma [Feng for MCPyV using single, multiplex, or real-time et al., 2008]. The finding of MCPyV in human Merkel PCR; co-infection with other viruses was exam- cell carcinoma suggests a role for this virus in the ined.
    [Show full text]
  • Opportunistic Intruders: How Viruses Orchestrate ER Functions to Infect Cells
    REVIEWS Opportunistic intruders: how viruses orchestrate ER functions to infect cells Madhu Sudhan Ravindran*, Parikshit Bagchi*, Corey Nathaniel Cunningham and Billy Tsai Abstract | Viruses subvert the functions of their host cells to replicate and form new viral progeny. The endoplasmic reticulum (ER) has been identified as a central organelle that governs the intracellular interplay between viruses and hosts. In this Review, we analyse how viruses from vastly different families converge on this unique intracellular organelle during infection, co‑opting some of the endogenous functions of the ER to promote distinct steps of the viral life cycle from entry and replication to assembly and egress. The ER can act as the common denominator during infection for diverse virus families, thereby providing a shared principle that underlies the apparent complexity of relationships between viruses and host cells. As a plethora of information illuminating the molecular and cellular basis of virus–ER interactions has become available, these insights may lead to the development of crucial therapeutic agents. Morphogenesis Viruses have evolved sophisticated strategies to establish The ER is a membranous system consisting of the The process by which a virus infection. Some viruses bind to cellular receptors and outer nuclear envelope that is contiguous with an intri‑ particle changes its shape and initiate entry, whereas others hijack cellular factors that cate network of tubules and sheets1, which are shaped by structure. disassemble the virus particle to facilitate entry. After resident factors in the ER2–4. The morphology of the ER SEC61 translocation delivering the viral genetic material into the host cell and is highly dynamic and experiences constant structural channel the translation of the viral genes, the resulting proteins rearrangements, enabling the ER to carry out a myriad An endoplasmic reticulum either become part of a new virus particle (or particles) of functions5.
    [Show full text]
  • Uncovering De Novo Gene Birth in Yeast Using Deep Transcriptomics
    ARTICLE https://doi.org/10.1038/s41467-021-20911-3 OPEN Uncovering de novo gene birth in yeast using deep transcriptomics William R. Blevins 1,2,3, Jorge Ruiz-Orera 1,4, Xavier Messeguer5, Bernat Blasco-Moreno 6, ✉ José Luis Villanueva-Cañas 1,7, Lorena Espinar2,8, Juana Díez 6, Lucas B. Carey 2,9 & M. Mar Albà 1,10 De novo gene origination has been recently established as an important mechanism for the formation of new genes. In organisms with a large genome, intergenic and intronic regions 1234567890():,; provide plenty of raw material for new transcriptional events to occur, but little is know about how de novo transcripts originate in more densely-packed genomes. Here, we identify 213 de novo originated transcripts in Saccharomyces cerevisiae using deep transcriptomics and genomic synteny information from multiple yeast species grown in two different conditions. We find that about half of the de novo transcripts are expressed from regions which already harbor other genes in the opposite orientation; these transcripts show similar expression changes in response to stress as their overlapping counterparts, and some appear to translate small proteins. Thus, a large fraction of de novo genes in yeast are likely to co-evolve with already existing genes. 1 Evolutionary Genomics Group, Research Programme on Biomedical Informatics, Hospital del Mar Research Institute (IMIM) and Universitat Pompeu Fabra (UPF), Barcelona, Spain. 2 Single Cell Behavior Group, Department of Experimental and Health Sciences, Universitat Pompeu Fabra (UPF), Barcelona, Spain. 3 Single Cell Genomics Group, Centro Nacional de Análisis Genómico (CNAG), Barcelona, Spain. 4 Cardiovascular and Metabolic Sciences, Max Delbrück Center for Molecular Medicine in the Helmholtz Association (MDC), Berlin, Germany.
    [Show full text]
  • An Overview on Human Polyomaviruses Developing Cancer
    The Journal of Medical Research 2020; 6(4): 125-127 Review Article An overview on human polyomaviruses developing cancer in JMR 2020; 6(4): 125-127 humans July- August ISSN: 2395-7565 Mohammad Salim1, Mohammad Shahid Masroor2, Shagufta parween3, I.P. Prajapati1 © 2020, All rights reserved 1 Sanjay Gandhi Smriti Govt. Autonomous P.G. College, Sidhi, (affiliated to APS University, Rewa), Madhya Pradesh- www.medicinearticle.com 486661, India Received: 22-06-2020 2 People’s College of Dental Sciences & Research Center, People's University, Bhopal, Madhya Pradesh- 462037, Accepted: 14-07-2020 India 3 All India Institute of Medical sciences (AIIMS), Bhopal, Madhya Pradesh-462020, India Abstract The family Polyomaviridae included about a dozen of human polyomaviruses (HPyVs), of which MCPyV, SV-40, JCV and BKV viruses have been reported to cause cancer in human. Merkel cell carcinoma is a very aggressive type of skin cancer caused by the MCPyV5. Similarly, while SV-40 and JCV viruses developed brain tumor cancer, the BK virus has been linked to renal transplantations and nephropathy producing urinary bladder tumor and prostate cancer in human. In this paper we have tried to summarize the recent information gained in the field of human polyomaviruses causing cancer in human. Keywords: Human polyomaviruses, Cancer, Virus. INTRODUCTION Viruses are among the few causes of cancer contributing to a variety of malignancies. In 1966, when Peyton Rous was awarded a Nobel prize in physiology and medicine for his discovery of Rous chicken sarcoma virus as a cause of cancer, a renewed interest came in the field of microbial origin of cancer.
    [Show full text]
  • Viruses in Transplantation - Not Always Enemies
    Viruses in transplantation - not always enemies Virome and transplantation ECCMID 2018 - Madrid Prof. Laurent Kaiser Head Division of Infectious Diseases Laboratory of Virology Geneva Center for Emerging Viral Diseases University Hospital of Geneva ESCMID eLibrary © by author Conflict of interest None ESCMID eLibrary © by author The human virome: definition? Repertoire of viruses found on the surface of/inside any body fluid/tissue • Eukaryotic DNA and RNA viruses • Prokaryotic DNA and RNA viruses (phages) 25 • The “main” viral community (up to 10 bacteriophages in humans) Haynes M. 2011, Metagenomic of the human body • Endogenous viral elements integrated into host chromosomes (8% of the human genome) • NGS is shaping the definition Rascovan N et al. Annu Rev Microbiol 2016;70:125-41 Popgeorgiev N et al. Intervirology 2013;56:395-412 Norman JM et al. Cell 2015;160:447-60 ESCMID eLibraryFoxman EF et al. Nat Rev Microbiol 2011;9:254-64 © by author Viruses routinely known to cause diseases (non exhaustive) Upper resp./oropharyngeal HSV 1 Influenza CNS Mumps virus Rhinovirus JC virus RSV Eye Herpes viruses Parainfluenza HSV Measles Coronavirus Adenovirus LCM virus Cytomegalovirus Flaviviruses Rabies HHV6 Poliovirus Heart Lower respiratory HTLV-1 Coxsackie B virus Rhinoviruses Parainfluenza virus HIV Coronaviruses Respiratory syncytial virus Parainfluenza virus Adenovirus Respiratory syncytial virus Coronaviruses Gastro-intestinal Influenza virus type A and B Human Bocavirus 1 Adenovirus Hepatitis virus type A, B, C, D, E Those that cause
    [Show full text]
  • Detection and Quantification of Classic and Emerging Viruses by Skimmed
    View metadata, citation and similar papers at core.ac.uk brought to you by CORE provided by CONICET Digital water research xxx (2013) 1e14 Available online at www.sciencedirect.com journal homepage: www.elsevier.com/locate/watres Detection and quantification of classic and emerging viruses by skimmed-milk flocculation and PCR in river water from two geographical areas Byron Calgua a, Tulio Fumian b, Marta Rusin˜ola, Jesus Rodriguez-Manzano a, Viviana A. Mbayed c, Silvia Bofill-Mas a, Marize Miagostovich b, Rosina Girones a,* a Department of Microbiology, Faculty of Biology, University of Barcelona, Av. Diagonal 643, Barcelona 08028, Spain b Laboratory of Comparative and Environmental Virology, Oswaldo Cruz Institute, Avenida Brasil 4365, Rio de Janeiro, Brazil c Laboratory of Virology, Faculty of Pharmacy and Biochemistry, University of Buenos Aires, Junı´n 956, Buenos Aires, Argentina article info abstract Article history: Molecular techniques and virus concentration methods have shown that previously un- Received 24 September 2012 known viruses are shed by humans and animals, and may be transmitted by sewage- Received in revised form contaminated water. In the present study, 10-L river-water samples from urban areas in 16 February 2013 Barcelona, Spain and Rio Janeiro, Brazil, have been analyzed to evaluate the viral Accepted 21 February 2013 dissemination of human viruses, validating also a low-cost concentration method for virus Available online xxx quantification in fresh water. Three viral groups were analyzed: (i) recently reported vi- ruses, klassevirus (KV), asfarvirus-like virus (ASFLV), and the polyomaviruses Merkel cell Keywords: (MCPyV), KI (KIPyV) and WU (WUPyV); (ii) the gastroenteritis agents noroviruses (NoV) and Emerging virus rotaviruses (RV); and (iii) the human fecal viral indicators in water, human adenoviruses Polyomavirus (HAdV) and JC polyomaviruses (JCPyV).
    [Show full text]
  • Genesis of Non-Coding RNA Genes in Human Chromosome 22—A Sequence Connection with Protein Genes Separated by Evolutionary Time
    non-coding RNA Perspective Genesis of Non-Coding RNA Genes in Human Chromosome 22—A Sequence Connection with Protein Genes Separated by Evolutionary Time Nicholas Delihas Department of Microbiology and Immunology, Renaissance School of Medicine, Stony Brook University, Stony Brook, New York, NY 11794-5222, USA; [email protected] Received: 16 July 2020; Accepted: 1 September 2020; Published: 3 September 2020 Abstract: A small phylogenetically conserved sequence of 11,231 bp, termed FAM247, is repeated in human chromosome 22 by segmental duplications. This sequence forms part of diverse genes that span evolutionary time, the protein genes being the earliest as they are present in zebrafish and/or mice genomes, and the long noncoding RNA genes and pseudogenes the most recent as they appear to be present only in the human genome. We propose that the conserved sequence provides a nucleation site for new gene development at evolutionarily conserved chromosomal loci where the FAM247 sequences reside. The FAM247 sequence also carries information in its open reading frames that provides protein exon amino acid sequences; one exon plays an integral role in immune system regulation, specifically, the function of ubiquitin-specific protease (USP18) in the regulation of interferon. An analysis of this multifaceted sequence and the genesis of genes that contain it is presented. Keywords: de novo gene birth; gene evolution; protogene; long noncoding RNA genes; pseudogenes; USP18; GGT5; Alu sequences 1. Introduction The genesis of genes has been a major topic of interest for several decades [1,2]. One mechanism of gene formation is by duplication of existing genes [1,3].
    [Show full text]
  • Chimeric Murine Polyomavirus Virus-Like Particles Induce Plasmodium Antigen-Specific CD8+ T Cell and Antibody Responses
    View metadata, citation and similar papers at core.ac.uk brought to you by CORE provided by ResearchOnline at James Cook University ORIGINAL RESEARCH published: 19 June 2019 doi: 10.3389/fcimb.2019.00215 Chimeric Murine Polyomavirus Virus-Like Particles Induce Plasmodium Antigen-Specific CD8+ T Cell and Antibody Responses David J. Pattinson 1,2*, Simon H. Apte 1, Nani Wibowo 3, Yap P. Chuan 3, Tania Rivera-Hernandez 3, Penny L. Groves 1, Linda H. Lua 4, Anton P. J. Middelberg 3 and Denise L. Doolan 1,2* 1 Infectious Diseases Programme, QIMR Berghofer Medical Research Institute, Brisbane, QLD, Australia, 2 Centre for Molecular Therapeutics, Australian Institute of Tropical Health and Medicine, James Cook University, Cairns, QLD, Australia, 3 Australian Institute for Bioengineering and Nanotechnology, University of Queensland, Brisbane, QLD, Australia, 4 Protein Expression Facility, University of Queensland, Brisbane, QLD, Australia Edited by: An effective vaccine against the Plasmodium parasite is likely to require the induction Alberto Moreno, Emory University School of Medicine, of robust antibody and T cell responses. Chimeric virus-like particles are an effective United States vaccine platform for induction of antibody responses, but their capacity to induce Reviewed by: robust cellular responses and cell-mediated protection against pathogen challenge has Giampietro Corradin, Université de Lausanne, Switzerland not been established. To evaluate this, we produced chimeric constructs using the + + Kai Huang, murine polyomavirus structural protein with surface-exposed CD8 or CD4 T cell or University of Texas Medical Branch at B cell repeat epitopes derived from the Plasmodium yoelii circumsporozoite protein, and Galveston, United States + Sean C.
    [Show full text]
  • Cancer Patients Have a Higher Risk Regarding COVID-19–And Vice Versa?
    pharmaceuticals Opinion Cancer Patients Have a Higher Risk Regarding COVID-19–and Vice Versa? Franz Geisslinger, Angelika M. Vollmar and Karin Bartel * Pharmaceutical Biology, Department Pharmacy, Ludwig-Maximilians-University of Munich, 81377 Munich, Germany; [email protected] (F.G.); [email protected] (A.M.V.) * Correspondence: [email protected] Received: 29 May 2020; Accepted: 3 July 2020; Published: 6 July 2020 Abstract: The world is currently suffering from a pandemic which has claimed the lives of over 230,000 people to date. The responsible virus is called severe acute respiratory syndrome coronavirus 2 (SARS-CoV-2) and causes the coronavirus disease 2019 (COVID-19), which is mainly characterized by fever, cough and shortness of breath. In severe cases, the disease can lead to respiratory distress syndrome and septic shock, which are mostly fatal for the patient. The severity of disease progression was hypothesized to be related to an overshooting immune response and was correlated with age and comorbidities, including cancer. A lot of research has lately been focused on the pathogenesis and acute consequences of COVID-19. However, the possibility of long-term consequences caused by viral infections which has been shown for other viruses are not to be neglected. In this regard, this opinion discusses the interplay of SARS-CoV-2 infection and cancer with special focus on the inflammatory immune response and tissue damage caused by infection. We summarize the available literature on COVID-19 suggesting an increased risk for severe disease progression in cancer patients, and we discuss the possibility that SARS-CoV-2 could contribute to cancer development.
    [Show full text]
  • Gene Regulation and Quality Control in Murine Polyomavirus Infection
    viruses Review Gene Regulation and Quality Control in Murine Polyomavirus Infection Gordon G. Carmichael Department of Genetics and Genome Sciences, UCONN Health, Farmington, CT 06030, USA; [email protected]; Tel.: +1-860-679-2259 Academic Editors: J. Robert Hogg and Karen L. Beemon Received: 19 September 2016; Accepted: 11 October 2016; Published: 17 October 2016 Abstract: Murine polyomavirus (MPyV) infects mouse cells and is highly oncogenic in immunocompromised hosts and in other rodents. Its genome is a small, circular DNA molecule of just over 5000 base pairs and it encodes only seven polypeptides. While seemingly simply organized, this virus has adopted an unusual genome structure and some unusual uses of cellular quality control pathways that, together, allow an amazingly complex and varied pattern of gene regulation. In this review we discuss how MPyV leverages these various pathways to control its life cycle. Keywords: quality control; transcription; RNA decay; RNA editing; nuclear retention 1. The Virus Murine polyomavirus (MPyV) is highly oncogenic in rodents and has a small circular double-stranded DNA (dsDNA) genome of about 5300 base pairs. The genome is divided into “early” and “late” regions, which are expressed and regulated differently as infection proceeds (Figure1)[ 1–4]. The early and late transcription units extend in opposite directions around the circular genome from start sites near the bidirectional origin of DNA replication [2,5]. Primary RNA products from the early transcription unit are alternatively spliced to yield four early mRNAs which encode the large T antigen (100 kDa), the middle T antigen (56 kDa), the small T antigen (22 kDa) and the tiny T antigen (10 kDa) [6].
    [Show full text]