UCLA Previously Published Works
Total Page:16
File Type:pdf, Size:1020Kb
Load more
Recommended publications
-
SPATA33 Localizes Calcineurin to the Mitochondria and Regulates Sperm Motility in Mice
SPATA33 localizes calcineurin to the mitochondria and regulates sperm motility in mice Haruhiko Miyataa, Seiya Ouraa,b, Akane Morohoshia,c, Keisuke Shimadaa, Daisuke Mashikoa,1, Yuki Oyamaa,b, Yuki Kanedaa,b, Takafumi Matsumuraa,2, Ferheen Abbasia,3, and Masahito Ikawaa,b,c,d,4 aResearch Institute for Microbial Diseases, Osaka University, Osaka 5650871, Japan; bGraduate School of Pharmaceutical Sciences, Osaka University, Osaka 5650871, Japan; cGraduate School of Medicine, Osaka University, Osaka 5650871, Japan; and dThe Institute of Medical Science, The University of Tokyo, Tokyo 1088639, Japan Edited by Mariana F. Wolfner, Cornell University, Ithaca, NY, and approved July 27, 2021 (received for review April 8, 2021) Calcineurin is a calcium-dependent phosphatase that plays roles in calcineurin can be a target for reversible and rapidly acting male a variety of biological processes including immune responses. In sper- contraceptives (5). However, it is challenging to develop molecules matozoa, there is a testis-enriched calcineurin composed of PPP3CC and that specifically inhibit sperm calcineurin and not somatic calci- PPP3R2 (sperm calcineurin) that is essential for sperm motility and male neurin because of sequence similarities (82% amino acid identity fertility. Because sperm calcineurin has been proposed as a target for between human PPP3CA and PPP3CC and 85% amino acid reversible male contraceptives, identifying proteins that interact with identity between human PPP3R1 and PPP3R2). Therefore, identi- sperm calcineurin widens the choice for developing specific inhibitors. fying proteins that interact with sperm calcineurin widens the choice Here, by screening the calcineurin-interacting PxIxIT consensus motif of inhibitors that target the sperm calcineurin pathway. in silico and analyzing the function of candidate proteins through the The PxIxIT motif is a conserved sequence found in generation of gene-modified mice, we discovered that SPATA33 inter- calcineurin-binding proteins (8, 9). -
The Role of Z-Disc Proteins in Myopathy and Cardiomyopathy
International Journal of Molecular Sciences Review The Role of Z-disc Proteins in Myopathy and Cardiomyopathy Kirsty Wadmore 1,†, Amar J. Azad 1,† and Katja Gehmlich 1,2,* 1 Institute of Cardiovascular Sciences, College of Medical and Dental Sciences, University of Birmingham, Birmingham B15 2TT, UK; [email protected] (K.W.); [email protected] (A.J.A.) 2 Division of Cardiovascular Medicine, Radcliffe Department of Medicine and British Heart Foundation Centre of Research Excellence Oxford, University of Oxford, Oxford OX3 9DU, UK * Correspondence: [email protected]; Tel.: +44-121-414-8259 † These authors contributed equally. Abstract: The Z-disc acts as a protein-rich structure to tether thin filament in the contractile units, the sarcomeres, of striated muscle cells. Proteins found in the Z-disc are integral for maintaining the architecture of the sarcomere. They also enable it to function as a (bio-mechanical) signalling hub. Numerous proteins interact in the Z-disc to facilitate force transduction and intracellular signalling in both cardiac and skeletal muscle. This review will focus on six key Z-disc proteins: α-actinin 2, filamin C, myopalladin, myotilin, telethonin and Z-disc alternatively spliced PDZ-motif (ZASP), which have all been linked to myopathies and cardiomyopathies. We will summarise pathogenic variants identified in the six genes coding for these proteins and look at their involvement in myopathy and cardiomyopathy. Listing the Minor Allele Frequency (MAF) of these variants in the Genome Aggregation Database (GnomAD) version 3.1 will help to critically re-evaluate pathogenicity based on variant frequency in normal population cohorts. -
Evolutionary Origin of Bone Morphogenetic Protein 15 And
Evolutionary origin of Bone Morphogenetic Protein 15 and growth and differentiation factor 9 and differential selective pressure between mono- and polyovulating species Olivier Monestier, Bertrand Servin, Sylvain Auclair, Thomas Bourquard, Anne Poupon, Géraldine Pascal, Stéphane Fabre To cite this version: Olivier Monestier, Bertrand Servin, Sylvain Auclair, Thomas Bourquard, Anne Poupon, et al.. Evo- lutionary origin of Bone Morphogenetic Protein 15 and growth and differentiation factor 9 and differ- ential selective pressure between mono- and polyovulating species. Biology of Reproduction, Society for the Study of Reproduction, 2014, 91 (4), pp.1-13. 10.1095/biolreprod.114.119735. hal-01129871 HAL Id: hal-01129871 https://hal.archives-ouvertes.fr/hal-01129871 Submitted on 27 May 2020 HAL is a multi-disciplinary open access L’archive ouverte pluridisciplinaire HAL, est archive for the deposit and dissemination of sci- destinée au dépôt et à la diffusion de documents entific research documents, whether they are pub- scientifiques de niveau recherche, publiés ou non, lished or not. The documents may come from émanant des établissements d’enseignement et de teaching and research institutions in France or recherche français ou étrangers, des laboratoires abroad, or from public or private research centers. publics ou privés. BIOLOGY OF REPRODUCTION (2014) 91(4):83, 1–13 Published online before print 6 August 2014. DOI 10.1095/biolreprod.114.119735 Evolutionary Origin of Bone Morphogenetic Protein 15 and Growth and Differentiation Factor 9 -
Mouse GDF-8/Myostatin Propeptide Antibody
Mouse GDF-8/Myostatin Propeptide Antibody Monoclonal Rat IgG2B Clone # 84231 Catalog Number: MAB7881 DESCRIPTION Species Reactivity Mouse Specificity Detects mouse GDF8 propeptide in direct ELISAs and Western blots. In direct ELISAs, no crossreactivity with recombinant mouse (rm) GDF1 propeptide, rmGDF3 propeptide, rmGDF5, or rmGDF6 is observed. Source Monoclonal Rat IgG2B Clone # 84231 Purification Protein A or G purified from hybridoma culture supernatant Immunogen Mouse myeloma cell line NS0derived recombinant mouse GDF8 Asn25Ser376 Accession # O08689 Formulation Lyophilized from a 0.2 μm filtered solution in PBS with Trehalose. See Certificate of Analysis for details. *Small pack size (SP) is supplied either lyophilized or as a 0.2 μm filtered solution in PBS. APPLICATIONS Please Note: Optimal dilutions should be determined by each laboratory for each application. General Protocols are available in the Technical Information section on our website. Recommended Sample Concentration Western Blot 1 µg/mL Recombinant Mouse GDF8/Myostatin Propeptide (Catalog # 1539PG) PREPARATION AND STORAGE Reconstitution Reconstitute at 0.5 mg/mL in sterile PBS. Shipping The product is shipped at ambient temperature. Upon receipt, store it immediately at the temperature recommended below. *Small pack size (SP) is shipped with polar packs. Upon receipt, store it immediately at 20 to 70 °C Stability & Storage Use a manual defrost freezer and avoid repeated freezethaw cycles. l 12 months from date of receipt, 20 to 70 °C as supplied. l 1 month, 2 to 8 °C under sterile conditions after reconstitution. l 6 months, 20 to 70 °C under sterile conditions after reconstitution. -
Single Nucleotide Polymorphisms Within Calcineurin-Encoding Genes
Annals of Applied Sport Science, vol. 4, no. 2, pp. 01-08, Summer 2016 DOI: 10.18869/acadpub.aassjournal.4.2.1 Original Article www.aassjournal.com www.AESAsport.com ISSN (Online): 2322 – 4479 Received: 06/03/2016 ISSN (Print): 2476–4981 Accepted: 26/06/2016 Single Nucleotide Polymorphisms within Calcineurin-Encoding Genes are Associated with Response to Aerobic Training in Han Chinese Males 1Rong-mei Xu, 2Tao Lu, 2Lingxian Yan, 1Qinghua Song* 1The Center of Physical Health, Henan Polytechnic University, Jiaozuo 454000, Henan Province, China. 2 The Lab of Human Body Science, Henan Polytechnic University, Jiaozuo 454000, Henan Province, China. ABSTRACT Calcineurin, which functions in calcium signaling, is expressed in skeletal and cardiac muscle and has been linked to sensitivity to muscle strength training. It is also proposed to contribute to individual aerobic endurance. To investigate the relationship between calcineurin-encoding genes and aerobic endurance traits, 126 young-adult Han Chinese males were enrolled in an aerobic exercise training study. Participants were genotyped for polymorphisms within the 5 genes (PPP3CA, PPP3CB, PPP3CC, PPP3R1 and PPP3R2) encoding calcineurin using restriction fragment length polymorphism polymerase chain reaction (PCR-RFLP) or matrix-assisted laser desorption ionization time-of-flight mass spectrometry (MALDI-TOF MS). Participants underwent 18 weeks of aerobic exercise training (running). Before and after the training period, maximal oxygen uptake (VO2max) and 12 km/h running economy were measured. Statistical analyses were performed using chi-square test and analysis of variance. The baseline value of VO2max was significantly associated with rs3804423 and rs2850965 loci in the PPP3CA gene (P<0.05). -
A Computational Approach for Defining a Signature of Β-Cell Golgi Stress in Diabetes Mellitus
Page 1 of 781 Diabetes A Computational Approach for Defining a Signature of β-Cell Golgi Stress in Diabetes Mellitus Robert N. Bone1,6,7, Olufunmilola Oyebamiji2, Sayali Talware2, Sharmila Selvaraj2, Preethi Krishnan3,6, Farooq Syed1,6,7, Huanmei Wu2, Carmella Evans-Molina 1,3,4,5,6,7,8* Departments of 1Pediatrics, 3Medicine, 4Anatomy, Cell Biology & Physiology, 5Biochemistry & Molecular Biology, the 6Center for Diabetes & Metabolic Diseases, and the 7Herman B. Wells Center for Pediatric Research, Indiana University School of Medicine, Indianapolis, IN 46202; 2Department of BioHealth Informatics, Indiana University-Purdue University Indianapolis, Indianapolis, IN, 46202; 8Roudebush VA Medical Center, Indianapolis, IN 46202. *Corresponding Author(s): Carmella Evans-Molina, MD, PhD ([email protected]) Indiana University School of Medicine, 635 Barnhill Drive, MS 2031A, Indianapolis, IN 46202, Telephone: (317) 274-4145, Fax (317) 274-4107 Running Title: Golgi Stress Response in Diabetes Word Count: 4358 Number of Figures: 6 Keywords: Golgi apparatus stress, Islets, β cell, Type 1 diabetes, Type 2 diabetes 1 Diabetes Publish Ahead of Print, published online August 20, 2020 Diabetes Page 2 of 781 ABSTRACT The Golgi apparatus (GA) is an important site of insulin processing and granule maturation, but whether GA organelle dysfunction and GA stress are present in the diabetic β-cell has not been tested. We utilized an informatics-based approach to develop a transcriptional signature of β-cell GA stress using existing RNA sequencing and microarray datasets generated using human islets from donors with diabetes and islets where type 1(T1D) and type 2 diabetes (T2D) had been modeled ex vivo. To narrow our results to GA-specific genes, we applied a filter set of 1,030 genes accepted as GA associated. -
Pak1 Kinase Controls Cell Shape Through Ribonucleoprotein Granules Joseph O Magliozzi, James B Moseley*
RESEARCH ARTICLE Pak1 kinase controls cell shape through ribonucleoprotein granules Joseph O Magliozzi, James B Moseley* Department of Biochemistry and Cell Biology, The Geisel School of Medicine at Dartmouth, Hanover, United States ABSTRACT Fission yeast cells maintain a rod shape due to conserved signaling pathways that organize the cytoskeleton for polarized growth. We discovered a mechanism linking the conserved protein kinase Pak1 with cell shape through the RNA- binding protein Sts5. Pak1 (also called Shk1 and Orb2) prevents Sts5 association with P bodies by directly phosphorylating its intrinsically disor- dered region (IDR). Pak1 and the cell polarity kinase Orb6 both phosphorylate the Sts5 IDR but at distinct residues. Mutations preventing phosphorylation in the Sts5 IDR cause increased P body formation and defects in cell shape and polarity. Unexpectedly, when cells encounter glucose star- vation, PKA signaling triggers Pak1 recruitment to stress granules with Sts5. Through retargeting experiments, we reveal that Pak1 localizes to stress granules to promote rapid dissolution of Sts5 upon glucose addition. Our work reveals a new role for Pak1 in regulating cell shape through ribonu- cleoprotein granules during normal and stressed growth conditions. Introduction Cell polarity signaling networks determine cell morphology by controlling growth machinery in time and space. Because active growth requires energy, these networks must also respond to changes in the environment such as glucose availability. The p21- activated kinase (PAK) family of protein kinases *For correspondence: are key mediators of cell polarity signaling in many eukaryotes (Hofmann et al., 2004). Following james. b. moseley@ dartmouth. activation by small GTPases like Cdc42, PAKs function in regulating the cytoskeleton and MAPK path- edu ways, and PAK dysregulation is associated with multiple human diseases. -
Protein Identities in Evs Isolated from U87-MG GBM Cells As Determined by NG LC-MS/MS
Protein identities in EVs isolated from U87-MG GBM cells as determined by NG LC-MS/MS. No. Accession Description Σ Coverage Σ# Proteins Σ# Unique Peptides Σ# Peptides Σ# PSMs # AAs MW [kDa] calc. pI 1 A8MS94 Putative golgin subfamily A member 2-like protein 5 OS=Homo sapiens PE=5 SV=2 - [GG2L5_HUMAN] 100 1 1 7 88 110 12,03704523 5,681152344 2 P60660 Myosin light polypeptide 6 OS=Homo sapiens GN=MYL6 PE=1 SV=2 - [MYL6_HUMAN] 100 3 5 17 173 151 16,91913397 4,652832031 3 Q6ZYL4 General transcription factor IIH subunit 5 OS=Homo sapiens GN=GTF2H5 PE=1 SV=1 - [TF2H5_HUMAN] 98,59 1 1 4 13 71 8,048185945 4,652832031 4 P60709 Actin, cytoplasmic 1 OS=Homo sapiens GN=ACTB PE=1 SV=1 - [ACTB_HUMAN] 97,6 5 5 35 917 375 41,70973209 5,478027344 5 P13489 Ribonuclease inhibitor OS=Homo sapiens GN=RNH1 PE=1 SV=2 - [RINI_HUMAN] 96,75 1 12 37 173 461 49,94108966 4,817871094 6 P09382 Galectin-1 OS=Homo sapiens GN=LGALS1 PE=1 SV=2 - [LEG1_HUMAN] 96,3 1 7 14 283 135 14,70620005 5,503417969 7 P60174 Triosephosphate isomerase OS=Homo sapiens GN=TPI1 PE=1 SV=3 - [TPIS_HUMAN] 95,1 3 16 25 375 286 30,77169764 5,922363281 8 P04406 Glyceraldehyde-3-phosphate dehydrogenase OS=Homo sapiens GN=GAPDH PE=1 SV=3 - [G3P_HUMAN] 94,63 2 13 31 509 335 36,03039959 8,455566406 9 Q15185 Prostaglandin E synthase 3 OS=Homo sapiens GN=PTGES3 PE=1 SV=1 - [TEBP_HUMAN] 93,13 1 5 12 74 160 18,68541938 4,538574219 10 P09417 Dihydropteridine reductase OS=Homo sapiens GN=QDPR PE=1 SV=2 - [DHPR_HUMAN] 93,03 1 1 17 69 244 25,77302971 7,371582031 11 P01911 HLA class II histocompatibility antigen, -
UCN2 (NM 033199) Human Tagged ORF Clone – RC201333 | Origene
OriGene Technologies, Inc. 9620 Medical Center Drive, Ste 200 Rockville, MD 20850, US Phone: +1-888-267-4436 [email protected] EU: [email protected] CN: [email protected] Product datasheet for RC201333 UCN2 (NM_033199) Human Tagged ORF Clone Product data: Product Type: Expression Plasmids Product Name: UCN2 (NM_033199) Human Tagged ORF Clone Tag: Myc-DDK Symbol: UCN2 Synonyms: SRP; UCN-II; UCNI; UR; URP Vector: pCMV6-Entry (PS100001) E. coli Selection: Kanamycin (25 ug/mL) Cell Selection: Neomycin ORF Nucleotide >RC201333 ORF sequence Sequence: Red=Cloning site Blue=ORF Green=Tags(s) TTTTGTAATACGACTCACTATAGGGCGGCCGGGAATTCGTCGACTGGATCCGGTACCGAGGAGATCTGCC GCCGCGATCGCC ATGACCAGGTGTGCTCTGCTGTTGCTGATGGTCCTGATGTTGGGCAGAGTCCTGGTTGTCCCAGTGACCC CTATCCCAACCTTCCAGCTCCGCCCTCAGAATTCTCCCCAGACCACTCCCCGACCTGCGGCCTCAGAGAG CCCCTCAGCTGCTCCCACATGGCCGTGGGCTGCCCAGAGCCACTGCAGCCCCACCCGCCACCCTGGCTCG CGCATTGTCCTATCGCTGGATGTCCCCATCGGCCTCTTGCAGATCTTACTGGAGCAAGCCCGGGCCAGGG CTGCCAGGGAGCAGGCCACCACCAACGCCCGCATCCTGGCCCGTGTCGGCCACTGC ACGCGTACGCGGCCGCTCGAGCAGAAACTCATCTCAGAAGAGGATCTGGCAGCAAATGATATCCTGGATT ACAAGGATGACGACGATAAGGTTTAA Protein Sequence: >RC201333 protein sequence Red=Cloning site Green=Tags(s) MTRCALLLLMVLMLGRVLVVPVTPIPTFQLRPQNSPQTTPRPAASESPSAAPTWPWAAQSHCSPTRHPGS RIVLSLDVPIGLLQILLEQARARAAREQATTNARILARVGHC myc-FLAG tag Chromatograms: https://cdn.origene.com/chromatograms/mk6125_c07.zip Restriction Sites: SgfI-MluI This product is to be used for laboratory only. Not for diagnostic or therapeutic use. View online » ©2021 OriGene -
Evaluation of Mutations in Kras and Braf Genes in Iranian Population with Diffuse Gastric Cancer
WCRJ 2019; 6: e1352 EVALUATION OF MUTATIONS IN KRAS AND BRAF GENES IN IRANIAN POPULATION WITH DIFFUSE GASTRIC CANCER M. SANEIPOUR1,2, A. MORIDNIA3 1Department of Medical Biochemistry, School of Medicine, Shoushtar University of Medical Sciences, Shoushtar, Iran 2Department of Medical Biochemistry, School of Medicine, Dezful University of Medical Sciences, Dezful, Iran 3Department of Genetics and Molecular Biology, School of Medicine, Dezful University of Medical Sciences, Dezful, Iran Abstract – Objective: RAS proteins control signaling pathways which are the main regulators of the normal cell growth and malignant transformation cells. The point mutations in the KRAS gene are current event in numerous human cancers including pancreatic, lung, colon, and breast cancer. BRAF protein is located in the downstream of KRAS and it is revealed to be somatically mutated in various human cancers. KRAS and BRAF mutated genes have a vital role in the estab- lishment and development of tumors. Since there is a little information about BRAF and KRAS mutations in gastric cancer, the present study has been designed. Materials and Methods: We assessed 31 cases that experienced gastrectomy for diffuse gas- tric cancer, according to the histopathological criteria confirmed by pathologist. The patients were hospitalized in the Al-Zahra hospital in the Isfahan province (central Iran) and in the Alaa Cancer Control Center from 2011 to 2016. The DNA sequencing was completed by amplification exon 2 of KRAS and exon 15 of BRAF genes. Results: According to the electropherogram of DNA sequencing we did not find any alterations in the codon 12 and 13 of KRAS and codon 600 of BRAF genes. -
Amh) Relative to Sox9a, Sox9b, and Cyp19a1a, During Gonad Development
Gene Expression Patterns 5 (2005) 655–667 www.elsevier.com/locate/modgep Characterization and expression pattern of zebrafish anti-Mu¨llerian hormone (amh) relative to sox9a, sox9b, and cyp19a1a, during gonad development Adriana Rodrı´guez-Marı´, Yi-Lin Yan, Ruth A. BreMiller, Catherine Wilson, Cristian Can˜estro, John H. Postlethwait* Institute of Neuroscience, University of Oregon, 1425 E. 13th Avenue, Eugene, OR 97403, USA Received 28 January 2005; received in revised form 28 February 2005; accepted 28 February 2005 Available online 19 April 2005 Abstract The role of Anti-Mu¨llerian hormone (Amh) during gonad development has been studied extensively in mammals, but is less well understood in other vertebrates. In male mammalian embryos, Sox9 activates expression of Amh, which initiates the regression of the Mu¨llerian ducts and inhibits the expression of aromatase (Cyp19a1), the enzyme that converts androgens to estrogens. To better understand shared features of vertebrate gonadogenesis, we cloned amh cDNA from zebrafish, characterized its genomic structure, mapped it, analyzed conserved syntenies, studied its expression pattern in embryos, larvae, juveniles, and adults, and compared it to the expression patterns of sox9a, sox9b and cyp19a1a. We found that the onset of amh expression occurred while gonads were still undifferentiated and sox9a and cyp19a1a were already expressed. In differentiated gonads of juveniles, amh showed a sexually dimorphic expression pattern. In 31 days post-fertilization juveniles, testes expressed amh and sox9a, but not cyp19a1a, while ovaries expressed cyp19a1a and sox9b, but not amh.In adult testes, amh and sox9a were expressed in presumptive Sertoli cells. In adult ovaries, amh and cyp19a1a were expressed in granulosa cells surrounding the oocytes, and sox9b was expressed in a complementary fashion in the ooplasm of oocytes. -
Supplemental Table 1. Complete Gene Lists and GO Terms from Figure 3C
Supplemental Table 1. Complete gene lists and GO terms from Figure 3C. Path 1 Genes: RP11-34P13.15, RP4-758J18.10, VWA1, CHD5, AZIN2, FOXO6, RP11-403I13.8, ARHGAP30, RGS4, LRRN2, RASSF5, SERTAD4, GJC2, RHOU, REEP1, FOXI3, SH3RF3, COL4A4, ZDHHC23, FGFR3, PPP2R2C, CTD-2031P19.4, RNF182, GRM4, PRR15, DGKI, CHMP4C, CALB1, SPAG1, KLF4, ENG, RET, GDF10, ADAMTS14, SPOCK2, MBL1P, ADAM8, LRP4-AS1, CARNS1, DGAT2, CRYAB, AP000783.1, OPCML, PLEKHG6, GDF3, EMP1, RASSF9, FAM101A, STON2, GREM1, ACTC1, CORO2B, FURIN, WFIKKN1, BAIAP3, TMC5, HS3ST4, ZFHX3, NLRP1, RASD1, CACNG4, EMILIN2, L3MBTL4, KLHL14, HMSD, RP11-849I19.1, SALL3, GADD45B, KANK3, CTC- 526N19.1, ZNF888, MMP9, BMP7, PIK3IP1, MCHR1, SYTL5, CAMK2N1, PINK1, ID3, PTPRU, MANEAL, MCOLN3, LRRC8C, NTNG1, KCNC4, RP11, 430C7.5, C1orf95, ID2-AS1, ID2, GDF7, KCNG3, RGPD8, PSD4, CCDC74B, BMPR2, KAT2B, LINC00693, ZNF654, FILIP1L, SH3TC1, CPEB2, NPFFR2, TRPC3, RP11-752L20.3, FAM198B, TLL1, CDH9, PDZD2, CHSY3, GALNT10, FOXQ1, ATXN1, ID4, COL11A2, CNR1, GTF2IP4, FZD1, PAX5, RP11-35N6.1, UNC5B, NKX1-2, FAM196A, EBF3, PRRG4, LRP4, SYT7, PLBD1, GRASP, ALX1, HIP1R, LPAR6, SLITRK6, C16orf89, RP11-491F9.1, MMP2, B3GNT9, NXPH3, TNRC6C-AS1, LDLRAD4, NOL4, SMAD7, HCN2, PDE4A, KANK2, SAMD1, EXOC3L2, IL11, EMILIN3, KCNB1, DOK5, EEF1A2, A4GALT, ADGRG2, ELF4, ABCD1 Term Count % PValue Genes regulation of pathway-restricted GDF3, SMAD7, GDF7, BMPR2, GDF10, GREM1, BMP7, LDLRAD4, SMAD protein phosphorylation 9 6.34 1.31E-08 ENG pathway-restricted SMAD protein GDF3, SMAD7, GDF7, BMPR2, GDF10, GREM1, BMP7, LDLRAD4, phosphorylation