The Voice- of Slovenia Year 2 No 16 December 2001

Total Page:16

File Type:pdf, Size:1020Kb

The Voice- of Slovenia Year 2 No 16 December 2001 The voice- Of Slovenia Of Slovenia Year 2 No 16 December 2001 Science Prize Reward Media Seminar Australian Excellence For achievement in the Slovenia life science, September 2001 MINISTER’S PRIZE dr. Boštjan Kobe The Science Prizes are a national tribute to excellent and dedicated Mitja Meršol - Editor /Delo/, work and are part of the Govern- ment’s ongoing commitment to sup- Stanka Gregorič and porting and promoting the impor- Dragica Bošnjak tant contribution made to our daily lives by Australian innovations in science and technology. The Prime Minister and Minister Foto: Florjan Auser for Industry, Science and Resources presented the 2001 Science Prizes to the winners during a gala dinner in the Great Hall of Parliament With dr. Dimitrij Rupel, Minister for Foreign Affairs House on 25 September 2001. Australia’s premier science award, the $300,000 Prime Minister’s Prize for Science, was won this year by Emeritus Professor Donald Metcalf of The Walter and Eliza Hall Institute of Medical Research, Melbourne, for his life-saving white blood cell research. The Science Prizes also celebrate the efforts of Australia’s young sci- entists who are 35 years of age or younger. Elica Rizmal at RAI The $35,000 Malcom McIntosh television in Trieste dr. Zvone Žigon and At the University Library in Ljubljana Prize for Achievement in the Physi- Magdalena Tovornik cal Sciences was awarded to Dr Pe- Dear Stanka, ter Bartlett who, while researching at the Australian National Univer- Adrian Vatovec and sity in Canberra, made significant Vlado Kreslin I have pleasure enclosing a preview CD of Vlado Kreslin advances in discovering how a com- performing one of my compositions called Play with puter can do what so many living Play with Fire Fire. The recording took place in Adelaide last year creatures can do: learn. when Vlado was here with his band as the headline act The $35,000 Minister’s Prize for for the Victor Harbor Folk Festival, an event that at- Achievement in Life Sciences was tracts some 10,000 people. awarded to Associate Professor Play with Fire has a rhythm and blues feel about it with Bostjan Kobe of the University of added central European texture as only Vlado and his Queensland, for his invaluable re- search in exploring the shape of ba- musicians can uniquely muster. As author Richard sic building blocks-proteins. Flanagan says about Kreslin’s stature in the musical world - ‘ … a musician of such standing that everyone who 2001 Winners: comes to central Europe – from Dylan to REM – plays with him …’ The Age, Melbourne, December 30, 2000. - 2001 PRIME MINISTER’S PRIZE FOR SCIENCE It was certainly a pleasure to work with Vlado in the Emeritus Professor Donald Metcalf, studio. Thanks must go to Helena Drnovšek Zorko from AC FAA FRC the Slovenian Embassy in Canberra for arranging the introduction with Vlado. - 2001 MALCOLM MCINTOSH The preview CD of Play with Fire has been sent to some PRIZE radio stations in Australia and American university/col- FOR ACHIEVEMENT IN THE lege radio stations. The song is being well received. PHYSICAL SCIENCES Other versions of the song are in the pipeline for later Professor Peter Bartlett release. Yours sincerely, - 2001MINISTER’S PRIZE Adrian Vatovec FOR ACHIEVEMENT IN THE Adelaide, October 23, 2001 LIFE SCIENCES Associate Professor Bostjan Kobe 2 December 2001 TH ASSOCIATE PROFESSOR 27 Annual Slovenian Concert DR. BOŠTJAN KOBE FUSION 2001 By Lenti Lenko The 2001 Minister’s Prize for ‘This is like a big microscope where The 27th annual Slovenian concert accordion maestros, Peter Grivic, Achievement in Life Sciences is we look in the finest detail at how was held this year on the 6th of Rudi Crnčec and Frank Petelin. It awarded to Associate Professor things fit and from there we begin October at the Slovenian Reli- was pleasing to see so much Bostjan Kobe, of the University of to understand how they work to- young talent on the stage particu- Queensland, for his groundbreaking gious and Cultural Centre in gether,’ he says. ‘It’s complicated larly from our 2nd and 3rd genera- work which is helping to piece to- because so many different proteins Merrylands NSW. Once again, gether the jigsaw of how our cells Slovenians from different parts of tion Slovenian youth. Of course work together-we have decades of st work. research ahead of us before we will Australia got together to show off our 1 generation folk also showed see the full, integrated picture. For their talents and abilities no mat- us what they are capable of! All The 35-year-old Associate Profe- example, we know that the whole ter what their age as these concerts in all, no matter what our abilities ssor is doing so by exploring the human genome has thousands of are now also open to people of all we all gathered together to once shape of basic building blocks-pro- proteins, but the real challenge we teins. There is enormous potential ages and not just the youth. again show our community that face is that we only actually know whether born in Slovenia or Aus- for this work. Associate Professor how a fraction of them work.’ Kobe’s research will be invaluable Associate Professor Kobe is in- There were 33 different acts rang- tralia, we are proud of our for developing highly-targeted ing from poetry recitals, solo and Slovenian heritage, culture, mu- drugs that can manipulate what a spired by the work of others in the same field, including Australian choral singing and folklore danc- sic and language. protein does and, as a result, suc- ing to various bands, solo instru- cessfully fight off deadly viruses scientists in Melbourne who deve- like HIV. loped the flu drug, Relenza. mental performances and dance The next morning a special youth Piecing together the jigsaw by sol- ‘It is an exciting area to be involved items. As always our proud mass was celebrated at St. ving the three-dimensional struc- in. We’re looking at three-dimen- Slovenian youth showed us their Rapheals church in Merrylands ture of proteins is detailed and time- sional shapes of molecules that no abilities to the fullest. There are with our very own Pater Ciril one has seen before-we’re the first consuming, but important work. so many talented names I would Bozic (whom we are very fortu- Proteins perform many important scientists to see them in such in- credible detail. Of course, you have love to mention however space nate to have with us again in Aus- functions in every cell in every or- unfortunately does not permit this! ganism. The way protein molecules to go through a lot of work to make tralia!) giving an inspirational interact with one another controls a discovery, but not knowing exactly One name I will mention however homily to everybody present. Af- the way all living things grow and what you will find tomorrow excites is our young 6 year old Mathew ter mass, we gathered in the hall reproduce. ‘Each type of molecule me’, he says. Bratina from Melbourne who put for a BBQ lunch and then it was has a complex three-dimensional Associate Professor Kobe already on a fantastic show both at the time to depart for the long trip shape which influences how they has an outstanding publication concert and the next mor-ning in back to Melbourne. behave. If we can learn exactly how record for a young researcher, with church and stole everyone’s hearts they are shaped, we will be able to papers in the top scientific journals in the process! use this information to work out of the field. For example, the pres- The theme for this years concert ways of regulating how they func- tigious international journal Nature for ‘FUSION’. And this concert, tion’, explains Associate Professor published an article on his work in A group of dedicated people got (like all other past concerts) really Kobe. December 1999. together a number of months in showed this to the fullest - a FU- Each protein has pockets and Associate Professor Kobe’s passion advance to organise this very ma- SION of Slovenia and Australia, grooves that determine how it fits, jor annual event in the Slovenian for scientific discovery began as a a FUSION of the old and the new binds and reacts with other proteins young child in Slovenia. After community calender. It is impor- and a of course a FUSION of dif- and molecules within a cell. studying chemistry there, he wor- tant to note that the majority of the ‘Once we have determined the ferent people who lead very dif- ked in the United States where he organisers were not born in structure, we can use it as a tem- obtained his PhD. He was more re- fering and varying lifestyles in plate to help us design drugs that Slovenia but are proud of their may manipulate how a protein func- cently at St. Vincent’s Institute of different part of this God blessed Medical Research in Melbourne, Slovenian heritage and want to do tions. This information will help us something positive for the Slo- country of Australia who came fight the viruses that attack our before last year moving to the Uni- together from near and far to keep versity of Queensland’s Department venian community in Australia cells, like HIV. By understanding and that is why they got involved. the Slovenian spirit and tradition the shapes of the molecules that of Biochemistry and Molecular Bio- alive and kicking! enable a virus to function, we can logy and Institute for Molecular They must all be contratulated- design chemicals that will find and Bioscience.
Recommended publications
  • Koprska Škofija Po Letu 1945 the Koper Diocese After 1945 La
    ACTA HISTRIAE • 9 • 2001 • 1 prejeto: 2001-01-10 UDK 262.3(497.4 Koper)(091) KOPRSKA ŠKOFIJA PO LETU 1945 P. Marjan VOGRIN OFM Conv, SI-6330 Piran, Bolniška 30 ,=9/(ý(. Kratka predstavitev Koprske škofije po letu 1945 je samo utrinek njene bogate ]JRGRYLQH1DNUDWNRVRSUHGVWDYOMHQHYVHWULDGPLQLVWUDWXUHLQQMLKRYR]GUXåLWHYY enotno škofijo. Prav tako je na kratko predstavljeno povojno obdobje, skrb za vzgojo YHUQLNRYLQSUL]DGHYDQMD]DL]REUDåHYDQMHGXKRYQLNRY .OMXþQHEHVHGHDGPLQLVWUDWXUHDGPLQLVWUDWRUMLYHUVNLWLVNVHPHQLãþH LA DIOCESI DI CAPODISTRIA DOPO IL 1945 SINTESI La breve presentazione della diocesi di Capodistria dopo il 1945 rappresenta solo una piccola parte della sua ricca storia. Sono presentate in sintesi le tre amministrazioni apostoliche e la loro unione nella diocesi. Altrettanto brevemente sono trattati il periodo post bellico, l'educazione dei fedeli e l'istruzione dei sacer- doti. Parole chiave: amministrazioni apostoliche, amministratori apostolici, stampa reli- giosa, seminario 271 ACTA HISTRIAE • 9 • 2001 • 1 p. Marjan VOGRIN: KOPRSKA ŠKOFIJA PO LETU 1945, 271-284 UVOD 7DNRNRWVRVHY]DþHWNXVWROHWMDQDWHPNRSUVNHPSURVWRUXPHQMDYDOHSROL WLþQHREODVWL %HQHþDQL$YVWULMFL)UDQFR]LSDVSHW$YVWULMFLLWG SRGREQRMHELORSR GUXJLVYHWRYQLYRMQLVDPRGDVHQLWDNRSRJRVWRPHQMDYDODSROLWLþQDREODVWSDþSD cerkvena uprava. Sedanja Koprska škofija obsega tri nekdanje administrature (go- ULãNRWUåDãNRNRSUVNRLQUHãNR ]DWRMHSRWUHEQRYVHWULSUHGVWDYLWLGDODKNR]D]QD mo, kako je bila obnovljena sedanja koprska škofija. Do leta 1947 so torej na tem ozemlju uradno obstajale: Goriška
    [Show full text]
  • Letno Poročilo Katoliške Cerkve V Sloveniji 2015
    Letno poročilo Katoliške cerkve v Sloveniji 2015 Slovenska škofovska konferenca Letno poročilo Katoliške Cerkve v Sloveniji 2015 Podatke za objavo je zbralo in uredilo Tajništvo SŠK Odgovarja: p. dr. Tadej Strehovec OFM, generalni tajnik SŠK Strokovni pregled: p. dr. Tadej Strehovec OFM, generalni tajnik SŠK Strokovni pregled zgodovinskih podatkov: dr. France M. Dolinar Fotografije: arhiv (nad)škofij in njihovih služb, arhiv založbe Družina, arhiv SŠK in spletni viri Viri podatkov: Tajništvo SŠK, slovenske (nad)škofije, Slovenska karitas, Finančna uprava RS, Ministrstvo za kulturo RS, Statistični urad RS, Državni zbor RS Ljubljana, december 2015 Spremna beseda: msgr. Andrej Glavan, novomeški škof in predsednik Slovenske škofovske konference Stanje podatkov: 1. januar 2015 Zadnja posodobitev: 31. december 2015 2 Kratice CM Congregatio Missionis FURS Finančna uprava Republike Slovenije KI Katoliški inštitut Mt Evangelij po Mateju n. p. Ni podatka OFM Ordo Fratrum Minorum SPŠK Slovenska pokrajinska škofovska konferenca SŠK Slovenska škofovska konferenca SURS Statistični urad Republike Slovenije VV Vojaški vikariat pri Slovenski vojski ZCP Zakonik cerkvenega prava 3 Kazalo Kratice ..................................................................................................................................... 3 Kazalo ..................................................................................................................................... 4 Spremna beseda .....................................................................................................................
    [Show full text]
  • Suppressed Croatian–Slovenian Catholic Parish in San Francisco and Parishioners' Efforts for Its Reopening
    SUPPRESSED CROATIAN–SLOVENIAN CATHOLIC PARISH IN SAN FRANCISCO AND PARISHIONERS' EFFORTS FOR ITS REOPENING Dr. Gašper Mithans, Senior Research Associate Science and Research Centre Koper, Slovenia National parishes, which flourished among immigrants in the 19th century USA, were a compromise of Catholic leaders’ interest in keeping their followers and lay people’s desire to preserve their cultural heritage. However, over time the organizational strategy of the Church has changed: the church hierarchy incited adherents to join territorial parishes, and seldom approved the creation of new national parishes. This trend was only increased by the Second Vatican Council. In the 1980s, the US Catholic Church changed their viewpoint on parishes based on ethnic principle again with the introduction of the most recent Code of Canon Law (1983). A growing number of personal parishes today are an organizational alternative: an institutional response to religious diversification and meeting different ethnic and non-ethnic purposes.1 However, several personal parishes providing service to communities of European ancestry have been forced to close or to merge.2 An occurrence all over the USA is affecting territorial and personal parishes (except for Latino and Asian parishes) alike, usually because of lack of clergy, declining Mass attendance, as well as financial reasons.3 Also, several Slovenian parishes closed or merged, for example in Leadville, CO, Denver, CO, Sheboygan, 1 Tricia C. Bruce, Parish, and Place: Making Room for Diversity in the American Catholic Church (New York: Oxford University Press, 2017), pp. 5–7. 2 Cf. John C. Seitz, No Closure: Catholic Practice and Boston's Parish Shutdowns (Boston: Harvard University Press, 2011).
    [Show full text]
  • Historical and Cultural Perspectives on Slovenian Migration 13,50 € (Uredil Marjan Drnovšek) ISBN 978-961-254-043-2
    M I G R A C I J E “Over a decade ago, the history of migration was strongly disregarded in Slovenian historiography; in recent years, IoN especially because of the expansion of the research field and 1 Zvone Žigon: Iz spomIna v prIhodnost of the more systematic investigation of migration themes, 2 Mihael Kuzmič: slovenskI IzseljencI Iz it has contributed to a more thorough and deeper knowl- prekmurja v Bethlehemu v zda 1893–1924 edge of wider migration currents. /…/ This work offers the international scientific community a view of the results of 3 Zvone Žigon: IzzIvI drugačnostI Slovenian migration studies, acquainting it with various approaches and diverse subjects.” 4 sezonstvo In Izseljenstvo v panonskem Dr. Marta Verginella prostoru (Uredila Marina Lukšič - Hacin) 5 Marie Pislar Fernandez: slovencI v ŽeleznI lorenI (1919–1939) skozi družinske pripovedi / “The work is a group product of the collaborators of the slovÈnes en lorraIne du fer (1919–1939) à Institute for Slovenian Emigration Studies at the Scientific travers des récits de familles Research Centre of the Slovenian Academy of Sciences and Art (SRC SASA) and offers to the international scientific 6 Jure Gombač: esulI alI optantI? public a variegated multi-dimensional examination of the problems of migration, specifically of migrations in the 7 Zvone Žigon: ljudje odprtIh src Slovenian context. /…/ On the one hand it informs about 8 Dan Shiffman: korenIne multIkulturalIzma. Slovenian emigration and migration ‘cases’ and positions these phenomena in an international framework. On the 9 Maša Mikola: ŽIvetI med kulturamI other hand it points to the successful growth of Slovenian science in a methodological and interpretive confronta- 10 Damir Josipovič: učInkI prIseljevanja v tion.” slovenIjo po drugI svetovnI vojnI Dr.
    [Show full text]
  • Res Novae 2 • 2017
    ISSN2464-0344 Res novae Revija za celovito znanost Journal for Integrated Science »Gospodarstvo namreč za svoje pravilno delovanje Andrej Naglič potrebuje etiko; ne katerekoli etike, temveč etiko, SVOBODA CERKVA V SLOVENIJI ki je človekova prijateljica.« Jurij Dobravec (zaslužni papež Benedikt XVI., VREDNOTENJE NARAVE Ljubezen v resnici, št. 45) IN EKOLOšKA FUNKCIJA LASTNINE Karmen Marguč 2 TRAJNOSTNA EVOLUCIJSKA ETIKA • KOT ODGOVOR NA PROBLEM VRZELI RACIONALNOSTI MED UMETNO INTELIGENCO IN POTROšNIKOM 2017 • Matic Batič VERSKI SKLADI NA SLOVENSKEM V ZGODOVINSKEM KONTEKSTU Simona Drenik RESTITUTION OF ISTRIA‘S TREASURES FROM TALY TO LOVENIA I S : Res novae 2 THE STATE OF INTERNATIONAL LAW AND PRACTICE Fakulteta za poslovne vede, Katoliški inštitut Faculty of Business Studies, Catholic Institute LETNIK 2 • 2017 • šTEVILKA 2 RES NOVAE Res novae Res novae: revija za celovito znanost Izdajatelj in založnik: Fakulteta za poslovne vede, Katoliški inštitut Naslov uredništva: Res novae, Ciril-Metodov trg 9, 1000 Ljubljana Glavni in odgovorni urednik: Andrej Naglič Namestnik glavnega urednika: Simon Malmenvall Spletni naslov: http://www.katoliski-institut.si/sl/raziskovanje/res-novae E-pošta: [email protected] Uredniški odbor: Philip Booth (Velika Britanija), Andrej Fink (Argentina), Aniko Noemi Turi (Madžarska), Mitja Steinbacher (Slovenija) Leto izida: 2017 Tisk: Primitus d. o. o., Ljubljana Oblikovanje in prelom: Breda Sturm Naklada: 200 izvodov Letna naročnina: 28€ (Slovenija), 40€ (Evropa), 57$ (ostalo navadno), 66$ (ostalo prednostno) ISSN (tiskana verzija): 2464-0344 ISSN (elektronska verzija): 2464-0352 Res novae Revija za celovito znanost Journal for Integrated Science Impressum Res novae je znanstvena recenzirana periodična publika- cija, ki jo izdaja Katoliški inštitut. Izhaja dvakrat letno v elektronski in tiskani obliki.
    [Show full text]
  • Misli NOVEMBER - DECEMBER 2008 LETO - YEAR 57 Thoughts ŠTEVILKA - NUMBER 6
    PRINT POST APPROVED PP318852/00020 Misli NOVEMBER - DECEMBER 2008 LETO - YEAR 57 Thoughts ŠTEVILKA - NUMBER 6 http://www.glasslovenije.com.au PB misli | november - december 2008 misli | november - december 2008 1 2 misli | november - december 2008 misli | november - december 2008 3 Prijetni so spomini na trude minile Misli Prijetni so spomini na trude minile, bi lahko rekli letos že večkrat, še to toliko bolj pa sedaj po obhajanju jubilejev vseh slovenskih November - cerkva v Avstraliji in ob bližajočem se prehodu leta 2008 v novo leto 2009. Smo namreč že v adventnem času in na adventnem vencu bodo december kmalu zagorele vse štiri sveče ter nas uvedle v sveti večer ter praznovanje rojstva Jezusovega. 2008 Letošnje leto je, bi lahko pritrdili patru Darku v teh Mislih, sveto leto 2008 z tako mnogimi milostmi za Avstralce, še posebej pa za avstralske Slovence. Vse leto smo se poglabljali v svetih odrešenjskih V S E B I N A skrivnostih, ko smo se nedeljo za nedeljo zbirali k skupnemu obhajanju svete daritve. Sledila je priprava na Svetovni dan mladih, romanje križa in Marijine podobe ter samo praznovanje tega, še prej pa dnevi po škofijah. Prijetni so spomini na trude minile …3 V juliju 2008 smo imeli v Avstraliji pol milijona mladih kristjanov z vsega Božično voščilo slovenskih škofov....4 sveta, 110 tudi iz Slovenije z duhovniki in škofom dr. Petrom Štumpfom. Naj vam nikoli ne zmanjka upanja … 5 Veličastni dnevi, obžarjeni z močjo Duha in navzočnostjo svetega očeta Sodelovanje, solidarnost Benedikta XVI. In sedaj, malo pred koncem leta, še ta čudovit praznični in razumevanje.....................……..6 čas jubilejev v Melbournu, Sydneyu, Wollongongu in Adelaidi.
    [Show full text]
  • Slovenska Osamosvojitev 1991 Pri^Evanja in Analize
    Republika Slovenija Dr`avni zbor Zveza zgodovinskih dru{tev Slovenije SLOVENSKA OSAMOSVOJITEV 1991 PRI^EVANJA IN ANALIZE Simpozij Bre`ice 21. in 22. junij 2001 ZBORNIK Ljubljana 2002 CIP - Katalo`ni zapis o publikaciji Narodna in univerzitetna knji`nica, Ljubljana 94(497.4)"1991"(063)(082) SLOVENSKA osamosvojitev 1991 : pri~evanja in analize : zbornik : simpozij, Bre`ice, 21. in 22. junij 2001 / [uredili Jurij Perov{ek [et al.] ; prevodi Cvetka Puncer]. Ljubljana : Dr`avni zbor Republike Slovenije : Zveza zgodovinskih dru{tev Slovenije, 2002. (Knji`na zbirka Dr`avnega zbora Republike Slovenije) ISBN 961-6415-03-4 (Dr`avni zbor Republike Slovenije) 1. Perov{ek, Jurij 117917952 SLOVENSKA OSAMOSVOJITEV 1991 Pri~evanja in analize : zbornik Zbornik sodi v Knji`no zbirko Dr`avnega zbora Republike Slovenije Urednik: Janez Pezelj Uredili: Jurij Perov{ek, Barbara [atej, Stane Granda, Damijan Gu{tin, Toma` Terop{i~ Prevodi: Cvetka Puncer Izdajatelja: Dr`avni zbor Republike Slovenije, Zveza zgodovinskih dru{tev Slovenije Ra~unalni{ki prelom: Franc ^uden, Medit d.o.o. Naslovnica: Multigraf d.o.o., Ljubljana Tisk: Tiskarna Dr`avnega zbora Republike Slovenije Naklada: 500 izvodov Zvezi zgodovinskih dru{tev Slovenije so pomagali: Dr`avni zbor Republike Slovenije, Ministrstvo za kulturo Republike Slovenije in Zveza veteranov vojne za Slovenijo Za vsebino prispevkov odgovarjajo avtorji. Knjigo lahko poi{~ete na elektronskem naslovu: www.dz-rs.si 2 Kazalo Zborniku na pot .................................................................................................... 5 Otvoritveni nagovor predsednika Zveze zgodovinskih dru{tev Slovenije Jurija Perov{ka ...................................................................................................... 7 Pozdravni nagovor predsednika Dr`avnega zbora Republike Slovenije Boruta Pahorja ...................................................................................................... 9 Pozdravni nagovor `upana ob~ine Bre`ice Vladislava Der`i~a ........................
    [Show full text]
  • Brat Frančišek 5/2009
    brat frančišek 5 »O, Gospod Jezus Kristus, prosim september/oktober 2009 te, da bi do dna občutil tisto bolečino, ki si jo ti prestal v svojem trpljenju. In da bi se moje srce, napojilo s tisto Letnik XIX (CXXX) • ljubeznijo, ki je razvnela tebe, da si tako vdano toliko pretrpel za nas grešnike.” La Verna – ponovno srečanje s Križanim Pogovor z novomašnikoma Romanje družin v Assisi Srečanje pokrajinskih bratstev FSR Ogrožanje in sožitje Uvodnik brat frančišek 5/2009 Kazalo Frančiškova duhovnost Mladi Frančišku Pismo generalnega ministra reda Frančiškov tabor 30 manjših bratov za praznik Gospod naj ti podari mir! sv. Klare 2009 7 Razvedrilo »O, Gospod Jezus Kristus,« je zavzdihnil Frančišek, ki je klečal Nagradna zlogovna izpolnjevanka 31 Naša evangelizacija pred votlino in gledal proti izhodu, kjer so se razgibale megle in je Slovenski misijon v Melbournu 10 Pravičnost in mir dan silil na zemljo, »prosim te, da mi podariš dve milosti, preden Napovednik dogodkov 12 Ogrožanje in sožitje 32 umrjem. Najprej te prosim, da bi do dna občutil v svoji duši in na Etični odgovori na globalna Iz naših družin vprašanja 34 svojem telesu tisto bolečino, ki si jo ti, o mili Jezus, prestal v svojem p. Ambrož Mušič OFM 13 Odpuščanje, obvezna stopnja bridkem trpljenju. In potem te prosim, da bi se moje srce, kolikor je p. Dominik Tikvič OFMConv 15 na poti sprave 34 le mogoče, napojilo s tisto brezmejno ljubeznijo, ki je razvnela tebe, Romanje družin v Assisi 16 Korenine in sadovi Sina Božjega, in te prisilila, da si tako vdano toliko pretrpel za nas br.
    [Show full text]
  • FATIMSKA MARIJA ROMARICA NAS VABI V STIČNO Od Četrtka, 12
    www.kapitelj.com FATIMSKA MARIJA ROMARICA NAS VABI V STIČNO od četrtka, 12. junija, do nedelje, 22. junija 2008 SKUPNI PROGRAM ZA VSE DNI 10.00 molitvena ura 11.00 sv. maša 15.00 molitvena ura 16.30 enourni film o Fatimi (v župnijskem domu) 18.00 oznanila, rožni venec pred Najsvetejšim, blagoslov, polurni nagovor, polurni odmor 20.00 slovesna sv. maša, • po prošnji po obhajilu izročitev in posvetitev Marijinemu in Jezusovemu Srcu, • procesija z Marijinim kipom in svečami, • vmes litanije Matere Božje in fatimska pesem Nedeljske maše: • 6h, • 8h, • 10h (15. junija ob 11h zaradi birme) • Če želite poseben program ob drugih urah, javite v samostan. Cerkev bo odprta podnevi in ponoči. Zaželeno je dežurstvo ponoči. Prijavite se. Prihode avtobusov javite vsaj en teden prej na telefon: 01/78 77 100. 1 www.kapitelj.com VEČERNI PROGRAM NA POSAMEZNE DNI POD VODSTVOM NAŠIH ŠKOFOV od 18.00 do 21.30 • Po možnosti pridite že pred 18. uro, o da lahko opravite spoved, o obiščete Marijo, o ji napišete osebne prošnje o in izpolnite kartonček z izročitvijo in posvetitvijo Marijinemu in Jezusovemu Srcu (tisti kateri se po pripravi doma posvetite prvič). o Za procesijo z Marijinim kipom si boste nabavili lončke in sveče. Zaželene so narodne noše. 12. JUNIJ, četrtek, vabljena • Škofija Novo mesto, Bogu posvečeni in drugi • 19.00 sprejem kipa pred cerkvijo, pozdrav v cerkvi (p. Anton Nadrah), nagovor (Miloš Košir) • 20.00 sv. mašo in procesijo vodi novomeški škof msgr. Andrej Glavan po procesiji molitev rožnega venca pred Najsvetejšim z blagoslovom 13. JUNIJ, petek, fatimski dan, vabljena • Nadškofija Maribor, romarji in drugi • 18.00 rožni venec pred Najsvetejšim z blagoslovom, nagovor (p.
    [Show full text]
  • Letno Poročilo Katoliške Cerkve V Sloveniji 2020
    Slovenska škofovska konferenca Letno poročilo Katoliške cerkve v Sloveniji 2020 Slovenska škofovska konferenca LETNO POROČILO KATOLIŠKE CERKVE V SLOVENIJI 2020 Izdala: Slovenska škofovska konferenca Ljubljana, december 2020 ISSN 2464-0263 Letno poročilo Katoliške cerkve v Sloveniji 2020 2 Letno poročilo Katoliške cerkve v Sloveniji 2020 Letno poročilo Katoliške cerkve v Sloveniji 2020 Podatke za objavo je zbralo in uredilo Tajništvo Slovenske škofovske konference (SŠK) Odgovarja: p. dr. Tadej Strehovec OFM, generalni tajnik SŠK Strokovni pregled: p. dr. Tadej Strehovec OFM, generalni tajnik SŠK Fotografije: arhiv (nad)škofij in njihovih služb, arhiv založbe Družina, arhiv SŠK in spletni viri Viri podatkov: Tajništvo SŠK, slovenske (nad)škofije, Slovenska karitas, Misijonsko središče Slovenije, Finančna uprava RS, Ministrstvo za kulturo RS, Statistični urad RS, Državni zbor RS, Ministrstvo za notranje zadeve RS Ljubljana, december 2020 Stanje podatkov: 31. december 2019 Zadnja posodobitev: 1. december 2020 ISSN 2464-0263 3 Letno poročilo Katoliške cerkve v Sloveniji 2020 4 Letno poročilo Katoliške cerkve v Sloveniji 2020 Kazalo Kazalo ............................................................................................................................... 5 Kratice .............................................................................................................................. 9 Spremna beseda predsednika Slovenske škofovske konference ............................ 10 Uvodnik generalnega tajnika Slovenske škofovske konference
    [Show full text]