GlossaryGlossary This glossary contains definitions, terms, and abbreviations to help you understand telecommunications and computer terminology.

A Absorb and Unlock.

AA See Auto-Answer.

AAAI See American Association for Artificial Intelligence.

AABS Automated Alternate Billing Service

AABSACBF A register that is incremented when AABS is unable to complete an account code billing call request from the VSN due to a bad request or an error detected by the DMS switch.

AABSACBS A register that is incremented when AABS successfully completes an account code billing call after being handled by the VSN.

AABSCCSC A register that counts AABS calls that are billed to a calling card and successfully handled by a VSN.

AABSCOSC A register that counts AABS collect calls that are successfully handled by a VSN.

AABSRCVR A register that is incremented each time the VSN requests that the DMS switch attach a dual-tone multi-frequency receiver.

AABSSTPD A register that counts the number of automated calls that had a billing class of station paid and were not billed to an account code.

AABSTHSC A register that counts AABS calls that are billed to a third number and successfully handled by a VSN.

AACCPT Automatic Directory Assistance Call Completion (ADACC) offers accepted. AACCPT is incremented when a subscriber accepts an automatic call completion offer.

AARs Automatic Answering and Recording Systems.

AAU Automatic Answering Unit.

AB Abandoned Before Dialing.

ABANDON 1. The number of calls abandoned by the caller before reaching a busy, no answer, or ringing. This number is incremented for the relevant key each time the caller hangs up before reaching a busy, no answer, or ringing. 2. ABDBONG + ABDSERS1 + ABDSERS2 + ABDALTSS + ABDAFTSS + ABDFELS

ABANDON1 The total number of calls abandoned by the caller on the first try. This number is incremented for the relevant key each time the caller hangs up during the first name recording attempt.

abandoned call A call in which the calling party disconnects without canceling the call, before a report of “busy” or “do not answer” has been received. Glossary 2

abbreviated number The numerical code sent by a telephone caller using abbreviated dialing which identifies the telephone number of the party to whom they wish to be connected.

ABD See Average Business Day.

ABDAFTSS 1. This register will be incremented for the relevant key whenever the caller hangs up after the service stage but before reaching a busy signal, treatment, or ringing. This may happen during the front-end language selection (only if the caller has chosen a service), name recording, back-end language selection, or any operator requested prompts. 2. ABDSEQ + ABANDON1 + ABDAFT12 + ABDBELS + calls abandoned in calling card service

ABDAFT12 The number of times the caller hung up during the prompt for the 10-digit billing number. This number is incremented for the relevant key each time the caller hangs up during the billing number prompt but after selecting 12 for third-number billing during service selection.

ABDALTSS The number of calls abandoned during the service selection for alternate billing. This number is incremented for the relevant key each time the caller hangs up during the service selection for alternate billing.

ABDBELS This OM gets pegged each time the user abandons a call by hanging up while being prompted for back-end language.

ABDBILBP The number of times the billed party hangs up before the prompt for billing accep- tance. This number is incremented for the relevant key each time the billed party hangs up before the billing acceptance prompt is played. (The call is counted as an automated call.)

ABDBONG The number of calls abandoned after the first bong tone and at or before the wel- come message. This number is incremented for the relevant key each time the caller hung up during or after the first bong tone, and at or before the welcome message.

ABDCLG The number of times the caller hangs up unexpectedly during billing verification. This number is incremented for the relevant key each time billing verification starts with the billed party answering the phone and ends with the caller hanging up. The call is either routed to the operator or floated.

ABDFELS This OM gets pegged each time the user abandons a call by hanging up while being prompted for front-end language.

ABDSEQ The total number of caller hang-ups during the second or more attempts to record a name. This number is incremented for the relevant key each time the caller hangs up during subsequent name recording attempts or when the call is routed to the operator because the retry count has been reached. (Calls abandoned while waiting for the operator are not counted.)

ABDSERS1 The number of calls abandoned after the first service selection prompt and before the next voice prompt. This number is incremented for the relevant key each time the caller hangs up during or after the first selection message but before the next voice prompt. The message can be either an error message or a service selection message.

ABDSERS2 The number of calls abandoned after the second service selection prompt. This number is incremented for the relevant key each time the caller hangs up during or after the second voice prompt.

ABEND The number of calls abnormally ended. This number is incremented for the relevant

2001-8.0-RFM03-0302 Glossary 3

key each time a call is terminated due to a) an error detected in the call information when the call is presented to TOPS VSN b) an error detected within TOPS VSN entities c) unexpected instructions from the DMS to end the call

ABI American Bell Incorporated.

ABNDN (Abandoned calls to attendant) A register for OM group IBNSG that counts when a caller in the subgroup queue abandons the call before a console answers. The caller abandons the call as the caller listens to audible ringing.

Abort The procedure for terminating a program when a mistake, malfunction, or error occurs.

ABOVETH (Above Threshold) A dual mode register for wireless OM group OMMTXHO that counts when a locating channel receiver (LCR) response message is received from the serving subcell. This condition indicates the measured received signal strength indicator (RSSI) of the subscriber unit is greater than the minimum RSSI sent in the LCR request message.

ABS See Average Busy Season.

ABSBH See Average Busy Season Busy Hour.

absolute address Refers to a fixed location in the computer’s memory.

absorber, digit A unit of telephone switching equipment into which an excess digit can be dialed without causing any response except to make the equipment ready to receive the next digit dialed. Usually a function of a selector.

abstract A summary of a document.

AC 1. Authentication Center. 2. See Alternating Current.

ACAUTHRQ (Authentication Center authentication requests) A register for the wireless OM group AUTHCTR that counts when the AC attempts to authenticate a mobile. This register pegs on AUTHREQ messages with access types, origination, termination, registration, flash, and unspecified.

ACAUTHRM (AC authentication successes) A register for the wireless OM group AUTHCTR that counts when the AC finds an AUTHR mismatch while a mobile is being authenti- cated.

ACAUTHSC (AC authentication failure, AUTHR mismatch) A register for the wireless OM group AUTHCTR that counts when the AC attempts to authenticate a mobile.

ACB 1. Account Code Billing. 2. Automatic Call Back (also an OM group).

ACBABT A register that counts ACB requests that terminate during delayed processing because of interswitch problems like network congestion, or system errors (results in SYFL treatment).

ACBACBN A register that counts call attempts made on a line with the ACB feature that termi- nate on a network.

ACBATT A register that increases when a user dials the ACB feature activation code.

2001-8.0-RFM03-0302 Glossary 4

ACBDATT A register that increases when a user dials the ACB feature deactivation code.

ACBDENY A register that counts counts the number of ACB universal access attempts denied because the DENYACB option is in effect.

ACBDLAY A register that counts delays in processing that occur when the subscriber dials the ACB feature activation code. This condition occurs if the called line is busy.

ACBFAIL Measures unsuccessful ACB calls. This register is pegged each time AABS is unable to complete a call for any reason. This includes failures covered by register ACBRETFL.

ACBFDEN A register that increases when a user cannot activate ACB because the feature is not available on the line or in the office. It also increases when other features in use prevent the use of ACB. For example, the system cannot cause ACB on the second leg of a three-way call.

ACBH See Average Consistent Busy Hour.

ACBIMED A register that increases when a subscriber dials the ACB feature activation code and ACB occurs immediately.

ACBINV Measures the number of account code entry attempts that were invalid.

ACBLTDA A register that increases when a caller receives a long-term denial announcement after an attempt to activate ACB.

ACBNIMED A register that counts when the system immediately processes an internodal ACB request.

ACBOP Measures the number of times an operator request is made during ACB calls.

ACBOSCN A register that increases when an ACB request results in originating scanning.

ACBOVFL A register that increases when a call receives short-term denial tone. A call receives short-term denial tone because software resources are not available to activate ACB.

ACBRACT A register that increases when the subscriber dials an ACB activation code for a call that already has an ACB or automatic recall request.

ACBRETFL Measures the number of times an ACB call fails because the maximum number of retries has been exceeded before a valid account code is entered.

ACBRSCN A register that increases when scanning resumes for ACB after the originating office receives an indication that the called line is busy.

ACBRSCR A register that increases when the system uses the ACB against a line with the SCR option.

ACBSTDA A register that increases when the system routes a call to a short-term denial an- nouncement that follows an attempt to activate ACB. The system does not process the ACB request because the called line has a call forwarding service activated.

ACBSTDT A register that increases when a call receives short-term denial tone that follows an attempt to ACB.

ACBSTR A register that increases when a subscriber deactivates an ACB request.

2001-8.0-RFM03-0302 Glossary 5

ACBSUCC Measures successful ACB calls. This register is pegged each time AABS successfully floats an ACB call.

ACBSYSDR (Attendant console busy position duration) A usage register (10 s scan rate) for OM group IBNSG that records if an attendant console is position busy.

ACBTIME A register that counts ACB requests that exceed the time out period during delayed processing. This condition occurs when T10 or T6 expires, or when the number of ringbacks not answered reaches the maximum count.

ACBTSCN A register that increases when an ACB request receives confirmation of terminating scanning. This register increases for each ACB request.

ACBUNIV A register that counts each time a universal user dials an ACB access code.

ACBVAFT Measures the number of valid account code entries on the first attempt.

ACCCONG (Automatic congestion control) A register for OM group TRK that counts the number of times that a trunk group enters Automatic Congestion Control (ACC) congestion. accept In data transmission, the condition assumed by a primary or secondary station upon accepting a correctly received frame for processing. access 1. Retrieve data from a storage device or a peripheral. 2. Ability of a user to enter a given network. access charge Payments made by a long distance carrier to a U.S. local telephone company for use of local facilities, and by telephone subscribers to obtain access to local networks. access circuit Relay set or junction which routes a call into a particular item of equipment. access code 1. A group of characters or number that identifies a user to the computer system. 2. The preliminary digits a user must dial to be connected to a particular outgoing trunk group or line. access line A circuit between a subscriber telephone or PBX and the switching center which serves them. Modern designation for “subscriber loop” and “PBX trunk”. access mechanism A mechanical device in the disk storage unit that positions the read/write heads on the proper tracks. access minutes That usage of exchange facilities in interstate or foreign service for the purpose of calculating chargeable usage. On the originating end of an interstate or foreign call, usage is to be measured from the time the originating end user’s call is delivered by the telephone company and acknowledged as received by the interexchange carrier’s facilities connected with the originating exchange. On the terminating end of an interstate or foreign call, usage is to be measured from the time the call is received by the end user in the terminating exchange. Timing of usage at both the originating and terminating end of an interstate or foreign call shall terminate when the calling or called party disconnects, whichever event is recognized first in the originating and terminating end exchanges, as applicable. access points A class of junction points in dedicated outside plant. access service Services and facilities provided for the origination or termination of any interstate or foreign telecommunication.

2001-8.0-RFM03-0302 Glossary 6

Access Settlement Advisory Group Handles issues that involve the reporting of access settlement pooling data.

access tandem System that performs the switching and distribution function for inter-LATA traffic.

access time The access time of a memory device is the time interval between the instant the computer asks for data and the instant at which the data are delivered to the com- puter.

accessibility, limited Access is given only to a limited number of trunks.

accessory A peripheral device, such as a floppy disk drive.

accounting rate The rate per traffic unit agreed upon to establish international telecommunications accounts.

ACCS Automatic Calling Card Service.

accumulator A register where a computer stores the results of an arithmetic or logic operation. For example, the assembly language command ADD 5 means to add the contents of memory address 5 to the number in the accumulator, then store the result in the accumulator.

ACD See Automatic Call Distribution.

ACDABNDN A register for OM group ACDGRP that counts calls abandoned by the subscriber. These calls are calls in queue waiting for connection to an ACD agent or unanswered calls terminating to an ACD agent. This register doesn’t count calls the ACD agent answers and abandons.

ACDANSR A register for OM group ACDGRP that counts calls answered by agents in an ACD group.

ACDBLOCK A register for OM group ACDGRP that counts calls blocked for one of the following reasons: A.) The system cannot provide the correct treatment for the caller. For example, the caller should receive a recorded announcement, music, or ringback tone. The incoming call is routed to no software resources (NOSR) treatment. B.) The system cannot make a network connection between the incoming call and the agent. The incoming call is routed to negative acknowledgement (NACK) treatment.

ACDCIF A register for OM group ACDGRP that counts ACD calls routed to a controlled interflow (CIF) route.

ACDCPK A register for OM group ACDGRP that counts calls calls parked by ACD agents.

ACDDFLCT A register for OM group ACDGRP that counts calls the system prevents from reaching an ACD agent because they exceed the maximum size call queue in field MAXCQSIZ or the maximum waiting time in field MAXWAIT in the table ACDGRP.

ACDDMCT A register for OM group ACDGRP that records the number of ACD calls denied termination by the ACD group because of DMCT screening. Incoming ACD calls denied by DMCT screening are not counted as incoming ACD calls offered to the ACD group. Register ACDOFFR is not incremented.

ACDENY (AC denied access) A register for wireless OM group AUTHCTR that counts when the AC denies access to a subscriber.

2001-8.0-RFM03-0302 Glossary 7

ACDICDQ A register for OM group ACDGRP that is incremented when it queues an incoming ACD group call because a receiving agent is not available.

ACDNS A register for OM group ACDGRP that counts call attempts to reach an ACD group with the Night Service feature active. When Night Service is active, the system forwards the incoming call to the route specified in field NSROUTE of table ACDGRP. If the call routes to an overflow ACD group that cannot accept it, the call receives BUSY treatment. The system does not deflect the call again. The system increments the correct register, ACDDFLCT or ACDNS, for the overflow ACD group that gives the BUSY treatment.

ACDOFFR A register for OM group ACDGRP that counts calls offered to all ACD directory numbers (DN) in the ACD group. Calls offered when the Night Service feature are active are not included in the count.

ACDREQD A register for OM group ACDGRP that counts calls queued multiple times when it must queue a call presented to an agent.

ACDRQABAN A register for OM group ACDGRP that counts the number of ACD calls abandoned after being enqueued multiple times.

ACDRQRTE A register for OM group ACDGRP that counts the number of ACD calls the system sends to the requeue route when the timer expires in the ACD group call queue.

ACDTMANS A register for OM group ACDGRP that counts calls answered in another group after being transferred to an overflow queue. Such calls overflow the original ACD group when they have been too long in the call queue.

ACDTMINF A register for OM group ACDGRP that counts calls that overflow the ACD call queue and are presented to another ACD group. The calls remain available to the original group.

ACDTMOFL A register for OM group ACDGRP that counts calls that overflow to another group because the TIME field in table ACDGRP was exceeded. The field TIME specifies the time in seconds that a call can wait in the priority 0 incoming call queue before the call moves to an overflow queue.

ACDUSAGE A register for OM group ACDGRP that increments when a scanned agent line is in the talking state. The system scans each agent line associated with an ACD group every 100% and records the ACD group usage.

ACDXFER A register for OM group ACDGRP that counts the number of ACD calls transferred between ACD agents. The system counts only transfers from one ACD INCALLS key to another ACD INCALLS key.

ACE Automatic Calling Equipment.

ACF See Advanced Communications Function.

ACFLSHRQ (AC authentication request for a flash) A register for wireless OM group AUTHCTR that counts when the AC authenticates a mobile’s flash.

ACG 1. Automatic Call Gapping. 2. A register for OM group CAINMSGR that counts the number of ACG messages received by the Service Switching Point.

ACGBLOCK (Register AIN Queries of HPC calls Blocked) A register for OM group HPCBASIC that counts the total number of AIN queries of all HPC calls blocked by AIN ACG controls.

2001-8.0-RFM03-0302 Glossary 8

ACGEXMPT (Register AIN Queries of HPC calls Exempted) A register for OM group HPCBASIC that counts the total number of AIN queries of all HPC calls exempted from AIN ACG controls.

ACGOVFLW A register for OM group CAINCRS that counts the number of ACG Overflow mes- sages which are sent by the switch.

ACGRESTR A register for OM group CAINMSGR that is used to count the number of ACG_Global_Control_Restore messages which are received by the SSP.

ACGRSCSS (ACG Global Control Restore Success messages) A register for OM group CAINCRS that counts the number of ACG_Global_Control_Restore_Success messages which are sent by the switch.

ACH Attempts per Circuit per Hour.

ack Acknowledgement.

ACM See Association for Computing Machinery.

ACMAPRM (MSC authentication failure, missing authentication parameters) A register for the wireless OM group AUTHCTR that counts when the MSC reports an authentication failure with the reason set to missing authentication parameters.

ACMARMM (MSC authentication failure, AUTHR mismatch) A register for the wireless OM group AUTHCTR that counts when the MSC reports an AUTHR mismatch in the AFREPORT.

ACMOFAIL (MSC authentication failure, other) A register for the wireless OM group AUTHCTR that counts when the MSC reports an authentication failure other than AUTHR mismatch, unique challenge failure, and unique challenge no response.

ACMRCMM (MSC authentication failure, RANDC mismatch) A register for the wireless OM group AUTHCTR that counts when the MSC reports a RANDC mistmatch.

ACMUCFL (MSC unique challenge failures) A register for wireless OM group AUTHCTR that counts when an MSC-initiated unique challenge fails. This includes unique challenge failure and unique challenge no response.

ACMUCNR (MSC unique challenge no response) A register for wireless OM group AUTHCTR that counts when MSC-initated unique challenge fails because the mobile does not respond to the unique challenge request.

ACMUNBSC (MSC authentication failure, other) A register for wireless OM group AUTHCTR that counts when the MSC reports an authentication failure withthe reason set to missing authentication parameters.

ACNOAUTH (AC no authentication) A register for the wireless OM group AUTHCTR that counts when the AC attempts does not perform AUTHR/AUTHU checking because the mobile’s SSD update state is “SSD_Update_Initial.” This initial state implies that AUTHR/AUTHUchecking is not done until the mobile has successfully updated its SSD.

ACO Accounting Control Office.

ACOFAIL (AC authentication failure, other) A register for the wireless OM group AUTHCTR that counts when the AC finds a failure other than AUTHR mismatch, unique challenge

2001-8.0-RFM03-0302 Glossary 9

failure, or unique challenge no response while a mobile is being authenticated.

ACORIGRQ (AC authentication request for an origination) A register for the wireless OM group AUTHCRT that counts when the AC authenticates a mobile’s origination. acoustic coupler A special type of modem which allows a standard telephone headset to be connected to a data terminal for the transmission of data.

ACPOSBY (Attendant console position busy) A register for OM group IBNSG that increases when the attendant presses the position busy key and makes the attendant console position busy.

ACREGRQ (AC authentication request for a registration) A register for the wireless OM group AUTHCTR that counts when the AC authenticates a mobile’s registration. acronym A word or name formed by joining the first letters (or first few letters) of a series of words.

ACSSDERR (AC SSD update error) A register for the wireless OM group AUTHCTR that counts when an error condition is encountered during the SSD update.

ACSSDUFL (AC SSD update failure) A register for the wireless OM group AUTHCTR that counts when an SSD update fails.

ACSSDUNA (AC SSD update not attempted) A register for the wireless OM group AUTHCTR that counts when an SSD update is not attempted by the serving system.

ACSSDUNC (AC SSD update not completed) A register for the wireless OM group AUTHCTR that counts when an SSD update is not able to complete. This happens when the report type in the ASREPORT for the SSD update is a success but the unique challenge report is not attempted.

ACSSDURQ (AC initiated SSD update request) A register for the wireless OM group AUTHCTR that counts when the AC instructs the serving system to perform an SSD update.

ACSSDUSC (AC SSD update success) A register for the wireless OM group AUTHCTR that counts when an SSD update is successful.

ACT Applied Computer Techniques.

ACTERMRQ (AC authentication request for a termination) A register for the wireless OM group AUTHCTR that counts when the AC authenticates a termination to a mobile. active file A file currently being used. active program Any program currently being executed in the computer.

ACTS See Automatic Coin Telephone Service.

ACTSABN (ACTS abandons) A register for OM group CDACTS that counts when a subscriber abandons a call while the call is connected to an initial DRAM message.

ACTSCHG (ACTS charge) A register for OM group CDACTS that counts when ACTS calls a coin phone because a subscriber has made a call for which charges are due.

ACTSCNFY (ACTS coin notify) A register for OM group CDACTS that counts when ACTS calls a coin phone because the subscriber has requested a notification message.

2001-8.0-RFM03-0302 Glossary 10

ACTSFAIL (ACTS failure) A register for OM group CDACTS that counts when a call cannot route to ACTS because a DRAM, CDC, or three-port conference circuit is not available.

ACTSINI (ACTS initial coin charges) A register for OM group CDACTS that counts when a subscriber dials a 1+ call on a line equipped with ACTS.

ACTSNFY (ACTS notify) A register for OM group CDACTS that counts when ACTS calls a non- coin subscriber because the subscriber has requested a notification message.

ACTSOPRI (ACTS calls initially routed to operator) A register for OM group CDACTS that counts when a call is routed to an operator because of timeout or subscriber flash during the initial DRAM message. This register is not incremented for calls that are routed to an operator because of hardware problems or unavailability of DRAM or coin receivers.

ACTSOPRR (ACTS calls that route to an operator on a recall) A register for OM group CDACTS that counts when a call is routed to an operator because of timeout or subscriber flash, during a recall or during the notify DRAM message. This register is not incremented for calls that are routed to the operator because of hardware problems or unavailability of DRAM or coin receivers.

ACTSSUCC (ACTS success) A register for OM group CDACTS that counts when a subscriber successfully completes an ACTS call.

ACTSTAC (ACTS time and charges) A register for OM group CDACTS that counts when a non- coin subscriber attempts to reach ACTS to receive time and charges information. Calls requiring treatments are routed to a TOPS operator.

ACTSTEST (ACTS coin tone generation test coin detection circuit (CDC) seizure) A register for OM group CDACTS that counts the number of times a coin detection circuit is seized for use in performing an ACTS coin tone generation test.

ACTSWALK (ACTS walkaway) A register for OM group CDACTS that counts when a subscriber at a coin phone does not answer a call requesting charges due within 30 seconds. ACTS initiates a call to request charges due if the subscriber goes on hook during a call before a DRAM is connected and the announcement sequence is started.

ACTVTU (Activated usage) A usage register (100s scan rate) for OM group IBNSG that records if an attendant console in a customer subgroup is active. A console is active as long as a headset is plugged in. The register also counts consoles in the “position busy” or “night” state.

ACU 1. See Automatic Calling Unit. 2. Alarm Control Unit.

ACUCFAIL (AC unique challenge failures) A register for the wireless OM group AUTHCTR that counts when an AC-initiated unique challenge fails (outside the context of an SSD update)

ACUCNA (AC unique challenge not attempted) A register for the wireless OM group AUTHCTR that counts when an AC-initiated unique challenge fails becuase it was not attempted by the serving system (outside the context of an SSD update)

ACUCNR (AC unique challenge no response) A register for the wireless OM group AUTHCTR that counts when an AC-initiated unique challenge fails because a mobile’s no response (outside the context of an SSD update)

ACUCREQ (AC initiated unique challenges) A register for the wireless OM group AUTHCTR that

2001-8.0-RFM03-0302 Glossary 11

counts when the CD initiates a unique challenge (outside the context of an SSD update)

ACUNSPRQ (AC authentication request for unspecified access) A register for the wireless OM group AUTHCTR that counts when the AC authenticates a mobile with unspecified access.

ACUSUCC (AC unique challenge successes) A register for the wireless OM group AUTHCTR that counts when an AC-initiated unique challenge succeeds (outside the context of an SSD update)

ACUTA Association of College and University Telecommunications Administrators.

AD Abandoned Before Dial Tone.

A/D Analog/Digital.

adapter 1. A printed circuit board that plugs into the system board allowing an external option to be attached to the system unit. 2. A device that allows compatibility between different equipment.

ADC See Analog-to-Digital Converter.

Add Addendum.

ADDER Automatic Digital Data Error Recorder. adder A device capable of forming the sum of two or more quantities. add-in A component that can be placed on a printed circuit board already installed in a computer. For example, the addition of additional memory chips to empty slots in a microcomputer. addition record A record that results from the creation of a new record during the processing of a file. address 1. That portion of a computer instruction that references the location of the data to be processed. 2. The destination of a message in a communications system. address bus A bus that conveys address data from one system component to another. address, call In North America, the last four digits of the telephone number. address decoder Circuitry that enables data to be obtained from a particular location when its charac- ter code is provided. address field In data transmission, the sequence of bits immediately following the opening flag of a frame identifying the secondary station sending, or designated to receive, the frame. addressing Techniques for locating a required piece of data. addressing, data communications A technique used in data communications networks to establish contact with a remote terminal. address, memory The location in a memory store of a byte or word of information.

2001-8.0-RFM03-0302 Glossary 12

address modification An operation that causes an address to be altered in a prescribed way by a computer.

address register A register containing the address of the instruction currently being executed.

address separator The character which separates the different addresses in the selection signals.

address signal A signal containing one element of the part of the selection signals which indicates the destination of an initiated call.

address space The complete range of addresses available to a computer user.

ADENY Automatic Directory Assistance Call Completion (ADACC) Denials. ADENY is incremented when a DAS request for automatic call completion is denied because of datafill, billing, carrier, or translation restrictions. ADENY is also incremented if ADACC is not offered by the DMS switch because of local or toll restrictions added by the ADACC Toll Restrictions feature. AREQST - ADENY = AOFFER

ADHOFF (analog to digital handoff) A dual mode register for wireless OM group OMMTXHO that counts when an analog-to-digital handoff has been completed against the target subcell.

ADI Address Incomplete.

adj Adjustment.

administrative processor A centralized processor for administrative purposes which serves several switching centers.

ADMS Automatic Digital Message Switch.

ADMSC Automatic Digital Message Switching Center.

ADOIT Automatically Directed Outgoing Intertoll Trunk.

ADP Automatic Data Processing.

ADPCM Adaptive Differential Pulse Code Modulation.

ADPE Automatic Data Processing Equipment.

ADPS Automatic Data Processing System.

ADSI Analog Display Services Interface.

ADSIATTS (ADSI Attempts) A register for OM group CNDXPM that records the total number of ADSI attempts during the last OM reporting period.

ADSICOMP (ADSI Completions) A register for OM group CNDXPM that records the total number of ADSI completions during the last OM reporting period.

ADT Automatic Data Transmission.

Advanced Communications Function Family of IBM software products incorporating Systems Network Architecture (SNA) and governing intercommunication between computers.

2001-8.0-RFM03-0302 Glossary 13

Advanced Information System Switched data network offered by Lucent.

Advanced Mobile Phone System/Service Bell’s cellular radio system for mobile telephones.

A & E Architect & Engineer.

AESC Automatic Electronic Switching Center.

AFT Analog Facility Terminal.

AFT AFT A protocol for detecting and correcting errors in data transmission. AFT error correction is built into some high-speed modems so that erroneous data are never sent to the computer.

AGCIFR A register for OM group CAINAGOM that counts the number of Call_Info_To_Resource messages received from the SCP.

AGCITR A register for OM group CAINAGOM that counts the number of Call_Info_From_Resource messages sent to the SCP.

AGCTRCLR A register for OM group CAINAGOM that counts the number of CTR_Clear messages sent by CAIN agents on the SSP.

AGCTRCNV A register for OM group CAINAGOM that counts the number of conversational Connect_To_Resource messages received by each type of CAIN agent on the SSP.

AGEDPNOT A register for OM group CAINAGOM that counts the number of Event Detection Point Notification messages the switch sends to the SCP on a per agency basis.

AGEDPRCD A register for OM group CAINAGOM that counts the number of times the switch receives a valid Request_Report_BCM_Event component on a per agency basis.

AGEDPRCD A register for OM group CAINAGOM that counts the number of Event Detection Point Requests the switch sends to the SCP on a per agency basis.

AGERROR A register for OM group CAINAGOM that counts the number of successful responses the switch receives from the SCP on a per agency basis. This trigger is pegged when the switch receives successfully decoded Analyze_Route, Disconnect, Continue, and Send_To_Resource messages and attempts the requested action.

AGRESPR A register for OM group CAINAGOM that counts the number of successful responses the switch receives from the SCP on a per agency basis. This trigger is pegged when the switch receives successfully decoded Analyze_Route, Disconnect, Continue, and Send_To_Resource messages and attempts the requested action.

AGREQCAN Agent Request Cancelled. AGREQCAN is incremented each time a call in one of the application’s call queues is removed from the queue by the CAM as a result of the agent being cancelled by the application. CALLQD = GOTAVAG + GOTSPCL + AGREQCAN

AGREQCN2 Extension register of AGREQCAN.

AGRSCLR A register for OM group CAINAGOM that counts the number of Resource_Clear Messages the switch sends to the SCP during conversational messaging on a per agency basis.

2001-8.0-RFM03-0302 Glossary 14

AGSTRCNV A register for OM group CAINAGOM that counts the number of Send_To_Resource Messages received in conversational messages on a per agency basis.

AGQUERY A register for OM group CAINAGOM that counts the number of CAIN queries sent to the Service Control Point (SCP) on a per agency basis.

AGVIPREQ A register for OM group CAINAGOM that counts the number of SCP requests for VIP handling through Send_To_Resource or Connect_To_Resource triggers.

AGVIPRSP A register for OM group CAINAGOM that counts the number of responses to an SCP with a normal ClearCause after VIP handling.

AH Ampere Hour.

AHT Average Holding Time.

AI See Artificial Intelligence.

AIM Awaiting Incoming Message.

AINABNDN (AIN Caller Abandons) A register for OM group CAINOM that counts the number of call abandons on all CAIN-capable calls.

AINACGBK (AIN ACB Block) A register for OM group CAINOM that counts the number of CAIN queries that are blocked by ACG controls.

AINACGRQ (AIN ACB Requeries) A register for OM group CAINOM that counts the number of times requeries are performed when a query is blocked by an ACG control.

AINBUFFR A register for OM group CAINUIF that counts the total number of buffering attempts by the UIF (User Interface Framework).

AINBUFOV A register for OM group CAINUIF that counts the total number of buffer overflow events by the UIF (User Interface Framework).

AINPDIAL A register for OM group CAINUIF that counts the total number of times partial dial was received by the UIF (User Interface Framework).

AINPSIGN A register for OM group CAINUIF that counts the total number of times permanent signal was received by the UIF (User Interface Framework).

AINRSCNA A register for OM group CAINUIF that counts the total number of times resources were determined to be unavailable by the UIF (User Interface Framework).

AINRSCNI A register for OM group CAINUIF that counts the total number of times resources were determined to be not implemented or installed by the UIF (User Interface Framework).

AINSBOUT (AIN Subsystem Out-of-service) A register for OM group CAINOM that counts the number of queries attempted while the CAIN subsystem is out of order.

AINTIMO (AIN Time Outs) A register for OM group CAINOM that counts the number of T1 timeouts that occur when the switch queries the SCP.

AINTOTAN A register for OM group CAINUIF that counts the total number of attempts to play an announcement by the UIF (User Interface Framework).

2001-8.0-RFM03-0302 Glossary 15

AINTOTDC A register for OM group CAINUIF that counts the total number of digit collection attempts by the UIF (User Interface Framework).

AINTOTTN A register for OM group CAINUIF that counts the total number of attempts to play a tone by the UIF (User Interface Framework).

AINTOVFL (AIN Timeout Overflows) A register for OM group CAINOM that counts the number of times a SCP overflow query is attempted after a T1 timeout occurs on a CAIN call.

AINTRDNA (AIN Transaction Identifiers Not Available) A register for OM group CAINOM that counts the number of queries attempts sent to the SCP when TCAP transaction identifiers are not available.

AINUSRAB A register for OM group CAINUIF that counts the total number of user abandons during use of the UIF (User Interface Framework). air line mileage Point-to-point straight line distance.

AIS See Advanced Information System.

AL See Analog Loop-back. alarm A warning signal displayed or activated whenever a critical deviation from normal conditions occurs. alarm sender A unit at an unattended office which analyzes locally generated alarms and sends a signal to the parent attended central office, enabling maintenance staff there to classify the fault and arrange for it to be given appropriate attention at a suitable time.

ALC Automatic Load Control. algorithm Prescribed set of instructions that tell a computer how to solve a problem. An algorithm must be specified exactly, so there can be no doubt about what to do next, and it must have a finite number of steps. all-number calling Calling using all numerical telephone numbers rather than letters and numerals. allocate To assign a resource for use in performing a specific job. allocation The assignment of computer storage areas for instructions or data. Allocation may be done by a programmer or automatically by a program. all trunks busy The condition when all trunks in a given trunk group are simultaneously in use. Commonly used to man ATB registrations, which is a count of the number of times such a condition occurs in a given time interval.

ALM See alarm.

ALOH ST Average Length of Haul State. alphabet An ordered set of letters or special symbols. alphanumeric A set of characters including numbers, letters and special symbols.

ALRM Alarm DMO.

2001-8.0-RFM03-0302 Glossary 16

ALT 1. Alarm Test. 2. Alternate Route.

Alternate (Alt) key The Alt key is used like a shift key; that is, you hold it down while pressing another key. The Alt key gives the other key a new meaning, which depends on the software being used.

alternate route A path provided to allow traffic that is overflowing from one group to be routed to another on an alternate trunk route.

alternate route network A network of trunks made up of one or more high usage groups, and the final or full group to which they overflow.

alternate routing Directing telephone long distance traffic to another route when the first choice route is busy.

alternating current The flow of free electrons in a conductor when their direction periodically reverses.

ALU See Arithmetic-Logic Unit . AMA See Automatic Message Accounting.

AMAEMTR A register that counts emergency transfers between AMA tape units.

AMAENT A register that counts AMA record entries the system generates for downstream processing.

AMAENT2 An extension register associated with OM group AMA and register AMAENT.

AMAFREE A register that counts AMA calls that the system routes free of charge. A call can be free of charge because recording devices or units are not available, or because of a dead process.

AMARC Automatic Message Accounting Recording Center.

AMAROUTE A register that increases for TOPS offices when no CAMA TOPS recording units (CTRU) are available to store call details. The AMA recording device receives an EM3 treatment application.

AMARS Automatic Message Accounting Recording System.

AMASCRN A register that counts the number of AMA records screened. Records could be screened because a call disconnects before a minimum billing interval expires or the switch only tandems a call from an incoming to an outgoing trunk.

ambient temperature The temperature surrounding a piece of equipment.

American Association for Artificial Intelligence A professional organization concerned with advancing artificial intelligence.

American National Standards Institute (ANSI) An organization supported by U.S. industry to establish uniformity of standards. ANSI standard languages are designed to make it possible to run the same program on any computer without worrying about variations in the details of the language.

AML Actual Measured Loss.

2001-8.0-RFM03-0302 Glossary 17 ampere An ampere (or amp, for short) is the unit for measuring electric current.

AMPS See Advanced Mobile Phone System/Service.

AMU Alarm Monitor Unit.

ANA Automatic Number Announcer. analog Refers to the representation of numerical quantities by the measurement of continu- ous physical variables. analog data A physical representation of information such that the representation bears an exact relationship to the original information. For example, the electrical signals on a telephone channel are analog data representation of the original voice data. analog loop-back Method of testing modem and business machines by disconnecting the telephone line and looping back the transmitted line signal into the local receiver. analog monitor A monitor that displays an unlimited range of brightness for each primary color, from fully on to fully off. As a result, a vast range of colors can be displayed. analog-to-digital converterA device that changes data from analog to digital form, making it possible to feed the data into a computer.

ANBH Average Network Busy Hour.

ANC See All-Number Calling.

AND Automatic Network Dialing. android A human-like male robot.

ANF (Invalid or no automatic number identification (ANI) signals) A register for OM group TRK that counts incoming centralized-automatic message accounting (CAMA) or TOPS calls for which: - the system receives invalid ANI signaling - the system did not receive ANI signaling - the numbering plan area code (N0/1X) or the central office code (NNX) of the calling number for the incoming trunk group is not correct Register ANF increases when the system attaches the necessary receiver to the call. The system generates this register for the following office types: OFF200, OFFCOMB, OFFCOMBLWW, OFFCOMBTOPS, OFF200TOPS ,OFF200300, OFF250 and OFF250IBN. For DMS-MTX switches and DMS-250 switches, this register increases when the DMS switch receives a calling number with a central office code. The code for the incoming CAMA trunk group concerned is not correct.

ANFC 1. Automatic Message Accounting Failure by CAMA Recording Office. 2. Auto- matic Number Identification Failure by CAMA Recording Office.

ANFL 1. Automatic Message Accounting Failure by Subtending Local Office. 2. Auto- matic Number Identification Failure by Subtending Local Office. angstrom A unit of measurement, 1/250 millionth of an inch. Angstroms are used to measure the elements in electronic components on a chip.

ANI See Automatic Number Identification.

2001-8.0-RFM03-0302 Glossary 18

ANLZRTE (Analyze_Route Message) A register for OM group CAINMSGR that counts the number of ‘Analyzer_Route’ messages the switch receives from the SCP.

ANNATT A register for OM group ANN that counts calls that route to an announcement.

ANNMBU A usage register for OM group ANN. The scan rate is 100 s. It records when an announcement is manual busy.

annotate Add explanatory comments, notes, or remarks to program instructions.

ANNOVFL A register for OM group ANN that counts calls that the system routes to a recorded announcement, but that does not connect to the announcement for two reasons. The maximum number of calls are connected to the announcement or the announce- ment is maintenance busy. This register does not count the number of calls that overflow because of network block.

announcer, intercept An automatic announcer which can be connected to vacant selector levels or vacant connector terminals and used to give a “vacant number announcement”.

ANNSBU A usage register for OM group ANN. The scan rate is 100 s. It records when an announcement is system busy.

ANNTRU A usage register for OM group ANN. The scan rate is 10 s. It records when an announcement is traffic busy. This scan rate is needed because a typical broadcast announcement is 10 to 15 seconds long.

ANS 1. Answer. 2. Calls waiting measurement used is before rounding. Reported for each call queue. ANS = CW ÷ (PS (IPS + TPS + RPS))

ANSCFW (Answered call forward calls) A register for OM group IBNSG that counts when an attendant answers a call that comes in to a station or when the call forward feature is set to “forward to the attendant”. The numbers five, six, or seven on the console display indicate that a call is call forwarded.

ANSDELAY (Answer delay) A register for OM group IBNSG that counts when an attendant answers a call that waits in the queue longer than a specified time. The customer assigns the specified time (from four to 60 seconds) in field ANSTIME in table CUSTCONS.

ANSDIAL0 (Answered dial 0) A register for OM group IBNSG that counts when an attendant answers an incoming call indicator (ICI) with the number 1 (ICI-1). The ICI-1 is associated with station-dialed zero calls, automatic station originations to the attendant, and incoming calls on attendant trunks. Table IBNXLA specifies the type of call assigned to field ICI-1.

ANSI See American National Standards Institute.

ANSINTRP (Answer intercept) A register for OM group IBNSG that increases when an attendant answers an intercept call. The number 8 on the console display indicates an intercept call. The following intercept call categories are included: station intercept, incoming intercepted DID, extended private switched communication service (EPSCS) calls, or calls incoming on intercept trunks from other PBXs.

ANSLDN (Answer listed directory numbers) A register for OM group IBNSG that increases when an attendant answers a call to the listed directory number (LDN). If a customer has more than one LDN, all LDN-answered calls increases this register. LDNs are in field DNNM in table WRDN.

2001-8.0-RFM03-0302 Glossary 19

ANSI screen control An ANSI standard specifies a set of sequences of characters (escape sequences) which, when sent to the screen of a computer, make it perform actions such as clearing the screen.

ANSU (Answered calls usage register) A register for OM group TRK that provides a usage measurement of answered calls for each trunk group on a DMS-100I. This register increases when the extended multiprocessor system (XMS)-based peripheral module (XPM) detects an answer line signal from the outgoing trunk. The register decreases when the XPM detects an exit message from the outgoing trunk. The system gener- ates this register for office types OFF100, OFF200, OFFCOMB, and OFFCOMBITOPS. This register is optional for office type OFFCOMB and is only present if the system loads package NTXB22AA (OM Enhancements).

ANSWER (Answer supervisions) An answer register for OM group TRK for the outgoing trunk - when an incoming line/trunk originates a call and an outgoing trunk reports an answer indication to the computer module (CM), the register increases. Table 1 shows the interworking supported for releases LEC0011 and above. Table 2 shows the interworking supported for release EUR004 and above. This register only gener- ates for the following office types: - OFF100 - OFF200 - OFF200300 - OFF250 - OFF300 - OFFCOMB - OFFCOMBLWW - OFFCOMBITOPS - OFF200TOPS - OFFCOMBTOPS - OFF250IBN - OFF100OESD - OFF200OESD - OFFCOMBOESD For DMS-MTX switches and DMS-250 switches, this register counts hardware or audio answer supervisions received on the trunk group. For the DMS-100EUR switch, the only valid value for office parameter OFFICETYPE is OFF100. answer jack Those jacks on a switchboard (usually located in the bottom 1/3 of the board) that are used for incoming calls to the operator. answer lamp A switchboard lamp positioned over the answer jack to indicate to the operator when a call requires answering. When the operator inserts the cord into the jack, the answer lamp goes out. answer mode The ability of a modem to accept an incoming call from another modem. answer/originate In telecommunications, refers to the alternatives of sending (originating) or receiving (answering) a phone call. answer supervision An off-hook signal transmitted toward the calling end of a switched connection when the called party answers.

ANSXFRAT (Answered transfer attendant) A register for OM group IBNSG that increases when an attendant answers a call a station transferred to an attendant by switch-hook flash and dialing zero. This register also increases when a station does not answer for a

2001-8.0-RFM03-0302 Glossary 20

specified amount of time and recalls the attendant. The specified time before the station recalls the attendant is in field CWNATO in table CUSTCONS.

antistatic mat A floor mat placed in front of a device such as a disk unit that is sensitive to static, to prevent shocks that could cause loss of data during human handling of the unit.

AO Answer Only.

AOF (Automatic number identification (ANI) office failure) A register for OM group TRK that counts incoming calls for which the originating office detects an ANI failure. Failure can be detected despite correct key pulse and signaling terminal control signals. The missing information digits, missing category code or the complete lack of digits indicates an ANI failure. Register AOF generates for office types OFF100, OFFCOMB, OFFCOMBLWW, OFFCOMBTOPS, OFF200TOPS, OFF200300, OFF250, and OFF250IBN.

AOFFER Automatic Directory Assistance Call Completion (ADACC) Offers. AOFFER is incremented when a subscriber is offered automatic call completion. AOFFER = AREQST - ADENY

AOP Average Occupied Positions. This traffic office measurement is the average number of operators at positions in a particular team during a period of time.

AOP = AOPWV + AOPIDLT QMS FM PERIOD

AOPWV is measured for each period and includes audit information for NCWV and CBWV which has not ended for the measured period. AOPIDLT is measured for each period and includes audit information for IDLT which has not ended for the measured period.

AP Abandoned Partial Dial.

APEX Automated Private Exchange.

append To add on, for example, to add new records to a data base or to add to the end of a character string or list.

APPLERRR A register for OM group CAINMSGR that counts the number of Application_Error messages the switch receives from the SCP.

APPLERRS A register for OM group CAINMSGS that counts the number of Application_Error messages sent to the SCP.

applications packages Prewritten programs for common applications, such as a word processor, a spread- sheet, an accounting system, or an engineering program.

approx 1. Approximate. 2. Approximately.

AR 1. Absorb Repeatedly. 2. Awaiting Reply. 3. Automatic Recall, an OM group.

ARABT A register counts AR requests that are abnormally terminated during delayed process- ing because of: interswitch protocol, communications problems such as network congestion, and system errors. The call routes to SYFL treatment if a system error occurs. This register is not supported on the DMS-100G switch.

ARARN A register counts call attempts made on a line with the AR line feature that terminate

2001-8.0-RFM03-0302 Glossary 21

on a network.

ARATT A register that increases when a user dials the AR feature activation code.

ARDATT A register that increases when a user dials the AR feature deactivation code. This register is not supported on the DMS-100G switch.

A/R Alternate Route.

ARB All Routes Busy.

ARBDIN A register that counts two-level activations of AR that cannot be completed because a subscriber enters a wrong number or a timeout occurs.

ARC A popular data compression program. It takes one or more files, compresses them, and combines them into an “archive” file (with a name ending in .ARC), which ARC can later decompress. ARC is often used for files that are to be transmitted by telephone because the compressed file takes less time to transmit; also, a group of files is easily kept together by storing them in a single archive. architecture 1. The physical structure of a computer’s internal operations, including its registers, memory, instruction set, input/output structure, and so on. 2. The art of building with solid materials, enclosing space in a useful and pleasing way. 3.The composite of specific components and the way in which they interact, that form a computer system. archival storage Storage for data that must be kept for a long time but will seldom be used, such as backup copies of working programs.

ARCVRFL A register that counts when the DMS switch fails to attach a receiver to the calling port in response to a request by the VSN.

ARCVRSUC A register that counts when the DMS switch, in response to a request by the VSN, attaches a dual-tone multifrequency receiver; the register is also incremented to indicate that a receiver is already attached.

ARDENY A register that counts the number of AR universal attempts that the system denied because the DENYAR option is in effect.

ARDLAY A register that counts the times processing delayed because the called line is busy when the user dials the AR feature activation code. This register is not supported on the DMS-100G switch.

ARDSBLID A register that increases when an AR subscriber presses operation code “9” to disable the latest incoming calling identification (LCID). area Local calling area, rate center home number plan area.

AREQST AutomaticDirectory Assistance Call Completion (ADACC) Requests. AREQST is incremented when the directory assistance system requests the DMS switch to determine whether automatic call completion can be offered to a DA call. The DMS switch checks for datafill, billing, carrier, or translation restrictions that prevent automatic call completion for a call. AREQST - ADENY = AOFFER

ARFDEN A register that increases when a user cannot activate AR because the feature is not available on the line or in the office or other features prevent the use of AR.

2001-8.0-RFM03-0302 Glossary 22

argument A variable to which either a logical or a numerical value may be assigned.

ARIEL Automatic Retrieval of Information Electronically.

ARIMED A register that increases when a subscriber dials the AR feature activation code and AR occurs immediately.

arithmetic-logic unit The portion of a CPU where arithmetic and logical operations are performed.

ARLTDA A register that increases when a call receives a long-term denial announcement following an attempt to activate AR.

ARNIMED A register that increases when the system processes an internodal AR request. This register is not supported on the DMS-100G switch.

AROPTO A register that increases when a subscriber hangs up before two-level activation of AR is complete.

AROSCN A register that increases one time for each AR request that results in originating scanning. This register is not supported on the DMS-100G switch.

AROVFL A register that increases when a call receives short-term denial tone and there are no software resources available to activate AR. When AROVFL increases, the system routes the call to one of the following treatments: no software resource (NOSR), no service circuit (NOSC), or network blockage, heavy traffic (NBLH).

ARPM Average Revenue Per Message.

ARPRCD A register that increases when a subscriber dials the AR activation code or when a subscriber dials 1 to proceed with two-level activation of an AR request.

ARPVTALW A register that counts the number of AR-activated calls to a private number that CASOP allows. The CASOP allows calls through to a private number when: the carrier is the Local Exchange Carrier (LEC), the carrier is the Operating Telephone Company (OTC), which can be the LEC, or the carrier is an approved Equal Access (EA) carrier, specified in table OCCINFO.

ARPVTBLK A register that increases when the system blocks an AR activation code and termi- nates the AR activation code to treatment. This register is not supported on the DMS- 100G switch.

ARRACT A register that increases when a user dials the AR activation code for a call that has an AR or automatic call back (ACB) request. This register is not supported on the DMS-100G switch.

array Orderly arrangement of data in a list. An array is arranged so that each item can be located when needed. It is made up of a group of elements, which may be either character strings or numbers.

array processor A processor that performs matrix arithmetic much faster than standard computers. It is capable of performing operations on all the elements in large matrices at one time.

arrival rate The number of characters or messages arriving over a data communications medium per unit of time.

arrow keys Many computer keyboards have arrow keys that move the cursor up, down, or to the

2001-8.0-RFM03-0302 Glossary 23

left or right. The effect of these keys depends on the software being used; some pieces of software ignore them or handle them incorrectly. You should be especially cautious about using the arrow keys when communicating with another computer; even if the cursor moves correctly, the other computer may not understand what you are doing.

ARRSCN A register that increases when scanning resumes for AR. Scanning resumes for the originating office receives an indication that the called line is idle and then busy. This register is not supported on the DMS-100G switch.

ARS See Automatic Route Selection.

ARSCR A register that increases when the system uses AR against a line with the selective call rejection (SCR) option or when the system receives SCR indication in response to the initial AR query. This register is not supported on the DMS-100G switch.

ARSTDA A register that increases when a caller receives a short-term denial announcement following an attempt to activate AR. The condition occurs if Call Forwarding is active on the line that is called. This register is not supported on the DMS-100G switch.

ARSTDT A register that increases when a caller attempts to activate AR and receives short- term denial tone.

ARSTR A register that increases when a subscriber deactivates an AR request.

ART Auxiliary Ring and Tone. artificial intelligence The branch of computer science that deals with using computers to simulate human thinking. Artificial intelligence is concerned with building computer programs that can solve problems creatively, rather than simply working through the steps of a solution designed by the programmer.

ARTIME A register that counts AR requests that timeout during delayed processing. Timeout occurs when T10 or T6 expires, or when the maximum number of unanswered ringbacks occur.

ARTSCN A register that increases each time an AR request receives confirmation of terminating scanning.

ARUNIV A register that counts each time a universal user dials the AR access code.

ASA American Standards Association.

ASAG See Access Settlement Advisory Group.

ASAP As Soon As Possible.

ASBHCC Average Season Busy Hour Call Completions.

ASCII Code American Standard Code for Information Interchange. A seven-bit code widely used in data communications. Refers to computer industry standardization of computer binary representation of letters, numbers, symbols and certain control characters, so that information can easily be transferred from one computer or peripheral device to another. assembly language A programming language that uses symbols and abbreviations rather than numeric instructions to represent the functions to be performed. It closely resembles ma-

2001-8.0-RFM03-0302 Glossary 24

chine code language.

assign Reserve part of a system for a specific purpose.

assigner A person who receives requests for service (service orders) and assigns the outside and inside plant facilities which will be used.

Association for Computing Machinery World’s largest educational and scientific society committed to the development of technical skills and professional competence of computer specialists.

asst Assistant.

assy Assembly.

asynchronous Data transmission in which the amount of time between each bit sent may vary in a non-uniform manner. To compensate for this, each character is individually synchro- nized, usually through the use of start and stop bits.

AT 1. Automatically Ticketed. 2. Attempt (Stromberg-Carlson). 3. See Access Tandem.

ATA Automatic Trouble Analysis.

ATB See All Trunks Busy.

ATBS Attendant Busy.

AT command set A standardized set of commands used in most modems, so named because the command used to initiate modem operations is AT. Other commands include D for “dial,” T for “use tones when dialing,” and P for “use pulse dialing.”

ATOMCCSI A register that counts AABS calls that are routed to MCCS before connection to a VSN.

ATOMCCSS A register that counts AABS calls that are routed to MCCS to provide sequence calling capability after the DMS switch connects to a VSN.

ATQDFL (Attendant queue deflection) A register for OM group IBNSG that increases when a call deflects from the customer subgroup queue to a busy tone or announcement. The call deflects because the attendant queue size exceeds the threshold size. Deflections do not occur for do not answer recalls, camp-on recalls, or call waiting recalls.

ATR Answering Time Recorder.

AT&T American Telephone & Telegraph Company.

ATTCOM AT&T Communications.

attempt A call for service, which may or may not be met. If completed, the attempt be- comes a message.

attempted call A call originated by a subscriber or an operator that for one reason or another did not complete.

attempts per message 1. DDD The number of attempts on the toll network divided by the number of revenue producing messages. This is the inverse of the completion ratio. 2. OH The

2001-8.0-RFM03-0302 Glossary 25

total number of distinct operator attempts made on the TSPS toll network (or all messages attempted, regardless of disposition) divided by the number of attempts completed.

attenuation Loss in signal strength as the distance between a transmitter and receiver increases.

attenuation equalizer A device that adjusts the attenuation distortion on a circuit by introducing a variable gain at frequencies within the passband.

ATTI AT&T International.

ATTIS AT&T Information Systems.

ATTIX AT&T Interexchange Carrier.

ATTT AT&T Technologies.

AUD Software Audit.

AUTHCAL (Authorization call) A register for OM group IBNSG that increases when an attendant in a customer subgroup presses the authorization validation (AUTH) key. The register increases after the attendant enters an authorization code when the attendant originates or extends a call.

AUTHTERM A register for OM group counts the number of Authorize_Termination Messages received by the SSP. auto-answer Incoming calls can be answered automatically.

AUTOCARD The total number of fully automated credit card calls.

AUTOCOLL The total number of fully automated collect calls. auto-dial A modem capable of connecting to the telephone system and dialing a number. auto dialing modem A modem capable of automatically dialing a number and redialing a busy number until a connection is made.

AUTOEXEC In MS-DOS, AUTOEXEC.BAT is the name of the file that contains commands to be executed whenever the computer boots up. autologon A sign on process whereby a computer terminal’s software communicates with another computer system in a prearranged sign on sequence.

AUTOMATE 1. The number of calls successfully automated by TOPS VSN. This number is incremented for the relevant key under the following conditions: A) the call is successfully completed B) the call is floated C) the call is terminated because 1) the database query indicated that billing is denied for collect and third number calls, (If the caller accepts alternate billing, this call is logically completed and a new alternate billing call is initiated.) and for calling card calls, an invalid calling card number was entered more than once 2) the call is terminated as a result of an office parameter setting 3) the call ended with a busy signal, treatment, or an appropriate hang-up re- sponse 4) the retry count has been reached and the caller is instructed to hang up

2001-8.0-RFM03-0302 Glossary 26

5) there is no answer, that is, the No_Far_End_Cut_Off parameter in table User Interaction was reached. Collect third party calls handed off from the operator to the VSN for call completion will be counted under Automate if any of the above conditions apply. 2. COLLECT + THIRDNUM + CALLCARD - ABDAFTSS - PARTAUTO (Collect calls = COLLECT + SAMENUM in group THIRDNUM if parameter Collect_If_Same_Num=yes.)

automatic alternate routing A method of toll switching in which a call that encounters an “all trunks busy” (ATB) condition on the first route tested is automatically transferred to one or more alter- nate routes for completion.

automatic call distribution A PBX feature or special system arrangement which automatically allocates incom- ing calls without overloads or congestion throughout a group of attendants.

automatic calling unit A dialing device that allows a business machine to make dial calls on a telephone network.

automatic coin telephone service Placing a station-to-station call from a paystation.

automatic computer A computer that can process a specified volume of work without requiring human intervention except for program changes.

automatic error correction A method used to detect and correct errors that occur during data transmission or within the system itself.

automatic message accounting Automatically records all the data of a dialed long distance call needed for prepara- tion of an itemized bill for subscribers.

automatic number identification Equipment which automatically identifies the telephone number of the line initiating the call.

automatic route selection A device or software which automatically selects the lowest cost route available for long distance calls.

automation Refers to the use of machines to do work that was once done by people.

AUTOOP This register will be incremented for the relevant key when one of the following events occurs: a) the call is routed to an operator by a hook flash, only before DTMF has been detected b) when the no response retry count has been reached during service selection c) the call is routed to an operator by a hook flash during front-end language selection, only before service has been selected d) when the no response retry count has been reached during front-end language selection, only before service has been selected

autopolling A process whereby terminals in a computer network are scanned periodically to determine whether they are ready to send information.

auto-restart The capability of a computer software program to perform automatically the initial- ization functions necessary to resume operation after a power or equipment failure.

2001-8.0-RFM03-0302 Glossary 27

auto-start A standby power system that automatically starts when the public utility supply fails.

AUTOTHIR The total number of fully automated third-party billing calls.

AUTOVON Automatic Voice Network. The U.S. Department of Defense private line service.

auxiliary storage devices Devices, generally magnetic tape and magnetic disk, on which data can be stored for use by computer programs. Also known as secondary storage.

av Average.

available time The time that a computer system or network is available for use.

average business day (ABD) Any normal business day excluding Saturdays, Sundays, and Holidays.

average busy season (ABS)The two or three months annually, not necessarily consecutive, in which call volume or equipment usage is the highest.

average consistent busy hour (ACBH) A reference data collection interval for a trunk group. That time consistent hour, within the day, for a period of several days, in which the traffic load is the highest on the trunk group.

average group busy hour (AGBH) A reference data collection interval for a trunk group. It represents the busiest hour’s usage for a number of days, regardless of the hour within the day they occurred. Also called bouncing busy hour (BBH).

average holding time The sum of the durations of all call attempts made by users during the mean busy hour, divided by the total number of call attempts is the average holding time per call.

Table: Average Holding Time Conversions

for Avg. Raw Data in: HT in: Sseconds MSinuteCsCEsrlangDeci-Erlang

Sec.÷Peg(Min.*60)÷(CCS÷.01)÷(Erl.*3600)÷(D-Erl.*36,000)÷ Seconds CountPegCountPegCountPegCountPegCount

(Sec.÷60)÷Min.÷Peg(CCS÷.6)÷(Erl.*60)÷(D-Erl.*600)÷ Minutes PegCountCountPegCountPegCountPegCount

average network busy hour (ANBH) A reference data collection interval for a trunking network. It is that time consistent hour, within the day, for a period of several days, in which the traffic loads on all high usage groups and the alternate route final trunk groups in the network are the highest. Also called average cluster busy hour.

AWT Actual Work Time. Reported for system, traffic office, system queues, traffic office queues, system services, traffic office services, system call services, and traffic office call classes. AWT=CBWV ÷ (PS (IPS + TPS + RPS))

B See Baud rate.

2001-8.0-RFM03-0302 Glossary 28

Babbage, Charles Nineteenth century inventor who designed several devices, such as the “analytical engine,” that included concepts which were later used in computers.

babble Crosstalk from several interfering channels.

backslash The backslash character is “\”, as opposed to the forward slash “/”.

backup Duplicating data from a fixed disk drive or diskette to tape or disk to insure availabil- ity of the data in the event of loss or damage to the original data.

backup file A copy of a program or file that is kept for reference in case the original file is destroyed. When working with a microcomputer, you should make backup copies of important files and store them away from the working copies.

BADGAP A register for OM group CAINLNP that pegs when the DMS switch receives a release message with a release cause of 28 indicating that an incorrectly encoded LNP GAP parameter was detected when this OM register is pegged. This is only true when LNP is active at this switch. The active status indicates an incoming LNP GAP received or one sent by the SCP. In either case, the LNP GAP was sent in the outgoing initial Address Message (IAM).

bal Balancing.

bandwidth Range of frequencies that can be transmitted by a communications channel with defined maximum loss or distortion.

bank switching The ability to use more then one set of memory chips at different times, while giving them the same addresses. This makes it possible to equip a computer with more memory than it was originally designed for ... simply store some data in one set of chips, then switch over and use the other set of chips.

base rate area (BRA) Physical boundary within an exchange, that according to a filed tariff, will allow each customer to be charged the same monthly rate according to their class of service.

bat Battery.

batch processing Processing method in which programs or data are collected together and handled in groups or batches.

battery Term used to refer to the DC power source of a telephone system. Supplies emer- gency power for a limited time in the event of commercial power failure.

battery reserve The number of hours batteries can furnish operating power for dependent central office apparatus for a demand equal to that on the central office during its busy hour. A busy hour reserve of eight hours is typical for a telephone office battery plant.

baud A unit of signaling speed. The reciprocal of the length in seconds of the shortest element of the code; for example, a system whose shortest elements are 1/300 second is operating at 300 baud.

baud rate Serial data communication speed measured in bits per second. One byte, with start and stop bits, equals 10 bits or 10 baud.

BCD Binary Coded Decimal.

Bd Baud.

2001-8.0-RFM03-0302 Glossary 29

BDH Board Hours or the total number of hours that operators are logged on. BDH = CBWV + NCWV + IDLT 3600

BDN Bell Data Network.

BDOS Basic Disk Operating System. bead Small program module.

Bel A unit of measurement, which results from taking the logarithm to the base 10 of the ratio of power received to power transmitted.

BELL 103A The standard format for transmitting data by telephone at speeds of 300 baud or less.

BELL 202 The standard format for transmitting data by telephone at a speed of 1200 baud in half duplex.

BELL 212A The standard format for transmitting data by telephone at a speed of 1200 baud.

BELLCORE Bell Communications Research, Inc. The central service organization providing technical and management services for the seven Regional Bell Operating Companies, and owned jointly by them.

BER Bit Error Rate.

BERT Bit Error Rate Test.

BET Between.

BH See Busy Hour.

BHC Busy Hour Calls.

BHCA Busy Hour Call Attempts.

BH CCS Busy Hour Centum Call Second.

BHL Busy Hour Load.

B-I Bell-Independent. bidirectional printer Printer capable of printing from left to right as well as from right to left. It is faster than a single-direction printer because it does not need to return to the left margin each time it starts a new line.

BI EAS Bell Independent Extended Area Service.

BI EAS DEM Bell Independent Extended Area Service Dial Equipment Minutes.

BI EAS MOU Bell Independent Extended Area Service Minutes Of Use.

BI INT Bell Independent Interstate.

BI INT DEM Bell Independent Interstate Dial Equipment Minutes.

2001-8.0-RFM03-0302 Glossary 30

billing equipment Equipment associated with the automatic billing of customer dialed toll calls.

BIN Business Information Network.

binary file A file containing bits or bytes in an arbitrary arrangement. The term binary file usually denotes any file that is not a text file.

binary synchronous communication A uniform procedure, using a standardized set of control characters and control character sequences for synchronous transmission of binary-coded data between stations.

BI ST Bell Independent State.

BI ST DEM Bell Independent State Dial Equipment Minutes.

bisynchronous Telecommunications in which two computers send and receive data at the same time.

bit A binary digit. There are only two possible binary digits: 0 and 1. In data transmis- sion, this takes the form of either the presence (1) or absence (0) of data.

bit rate See bits per second.

bit rate error The number of bits received in error divided by the number of bits transmitted.

bits per second (BPS) The rate at which binary encoded information is transmitted over a communication channel.

blank An empty space.

BLKBYSTS A register for OM group CAINLNP that pegs when the OFFCCODE LNP query is not allowed to take place. Otherwise, the LNP query takes place as normal without pegging this OM.

BLDN Blank Directory Number.

BLERT Block Error Rate Test.

blip Erratic signal on a screen.

blk See Blockage.

BLKCTRK (Blocked calls on trunk) A register for OM group TRK that counts the number of times the following events occur: - an associated trunk group for a call is a dedicated access line or primary rate access - the trunk is the last available route in the route list - the call receives general no-circuit (GNCT) treatment or busy (BUSY) treatment Register BLKCTRK only appears in DMS-250 switches and OFFCOMBLWW offices.

block 1. A group of terminals mounted into plastic, hard rubber, or wood so that these terminals can then be mounted on a frame. 2. When data records are stored on magnetic tape, they are collected together in groups known as blocks. Each block is treated as a unit. Blocks are separated by blank areas called interblock gaps.

blockage A count of the number of times call completion is unsuccessful due to the unavail- ability of some office resource.

2001-8.0-RFM03-0302 Glossary 31

BLOCKED A register for OM group CAINTRIG that counts the number of times a call has BLOCK datafilled as the trigger action in the trigger table. blocking The traffic condition when a call or attempt cannot be completed because no circuits are available. blocking tables Traffic capacity tables which state the level of blocking that is likely to occur when n traffic load is offered to a group of n circuits.

BMC Billing Media Converter.

BNR Bell-Northern Research.

BO Business Office.

BOAM Bell Owned And Maintained. board A printed circuit board is sometimes called a board or a card.

BOC Build Out Capacitor.

BOCs Bell Operating Companies. boot 1. To start or restart a computer system. 2. Protective housing.

BOTHONE The number of 1s entered during an attempt at billing acceptance with the parameter Billing_Acceptance_Validation set to BOTH.

BOTHOP The number of requests for operator that were entered during an attempt at billing acceptance with the parameter Billing_Acceptance_Validation set to BOTH.

BOTTS Busy Tone Trunks. bouncing busy hour The busiest hour on a trunk during the day.

BPS See Bits Per Second.

BRA See Base Rate Area. break Interrupt. brownout An extended period of insufficient power line voltage. It can damage computer equipment.

BRSAUXCP (BRISC auxiliary call processing class) A register for OM group BRSTAT that records a value that compares the percentage of AUXCP scheduler class utiliztion on the BRISC core to the value in parameter AUXCP_CPU_SHARE. The system updates this register every minute. After updating, this register reflects the average usage of the AUXCP scheduler class form the last OM transfer period.

BRSBKG (BRISC background class) A register for OM group BRSTAT that records a value that compares the percentage of background scheduler class utilization on the BRISC core to its given usage allocation. This register is updated every minute and the updated BRXBKG reflects the average use of the background scheduler class from the last OM transfer period.

2001-8.0-RFM03-0302 Glossary 32

BRSCAP (BRISC call capacity) A register in the OM group BRSTAT that indicates the percentage of call processing capacity. This percentage is used within the engineering recom- mendation for which grade-of service specifications are guaranteed. This register is updated every minute and reflects the average call processing capacity observed since the last OM transfer.

BRSCMPLX (BRISC call complexity ratio) A register in the OM group BRSTAT that is updated every minute and reflects the observed complexity ratio of the current call mix on the switch for the last minute. The values in this register represent the call complexity from the last OM period.

BRSDNC (BRISC network operating system file transfer class) A register in the OM group BRSTAT that records a value that compares the percentage of Network Operating System File Transfer (NOSFT) scheduler class utilization on the BRISC core to its usage allocation. The system updates register BRSDNC every minute and the updated register reflects the average use of the NOSFT scheduler class from the last OM transfer period.

BRSFORE (BRISC foreground usage) A register in the OM group BRSTAT that records a value which compares the percentage of operating system overhead on the BRISC core to a given specification for operating system overhead from the last OM transfer period.

BRSGTERM (BRISC gauranteed terminal class) A register for OM group BRSTAT that records a value which compares the percentage of gauranteed terminal (GTERM) scheduler class utilization the BRISC core to the value in parameter GUARANTEED_TERMINAL_CPU_SHARE. This register is updated every minute and reflects the average use of the GTERM scheduler class from the last OM transfer period.

BRSIDLE (BRISC idle periods) A register for OM group BRSTAT that increases when the switch is idle and the IDLE scheduler class runs during the OM transfer period. This register is updated every minute. If an IDLE scheduler class runs during the last minute, the register increases by one. This update shows idle time during the last minute. This update does not compute the amount of capacity this idle time represents.

BRSMAINT (BRISC maintenance class) A register for OM group BRSTAT that records a value which compares the percentage of maintenance scheduler class utilization on the BRISC core to its given allocation for usage. The register is updated every minute and reflects the average use of the maintenance scheduler class from the last OM transfer period.

BRSNETM A register for OM group BRSTAT that records a value which compares the percentage of network maintenance (NETM) scheduler class utilization on the BRISC core to its usage allocation. The register is updated every minute and reflects the average use of the NETM scheduler class from the last OM transfer period.

BRSNIP (BRISC CPU status of SuperNode internet protocol (SNIP) class) A register for OM group BRSTAT that records a value which compares the percentage of SNIP scheduler class utilization on the BRISC core to its usage allocation. The register is updated every minute and reflects the average use of the SNIP scheduler class from the last OM transfer period.

BRSOM (BRISC operational measurements class) A register for OM group BRSTAT that records a value which compares the percentage of scheduling overhead on the BRISC core to its usage allocation. The register is updated every minute and reflects the average use of the OM scheduler class form the last OM transfer period.

2001-8.0-RFM03-0302 Glossary 33

BRSSCHED (BRISC operational measurements class) A register for OM group BRSTAT that records a value which compares the percentage of scheduling overhead on the BRISC core to a given specification for scheduling overhead at capacity. The register is updated every minute and reflects the average scheduling overhead form the last OM transfer period.

BS 1. Busy Season. 2. Back Space.

BSC See Binary Synchronous Communications.

BSN Backward Sequence Numbers

BSP Bell System Practice.

BTAM Basic Telecommunications Access Method (IBM).

BTE Business Terminal Equipment.

BTL Bell Telephone Laboratories.

BTN Billing Telephone Number. buffer A buffer is a holding area for data. Several different things are called buffers: 1) A RAM buffer is a section of a computer’s random access memory (RAM) reserved by terminal software to temporarily store incoming data for display and/or later capture. 2) An edit buffer is an area in memory that holds data being edited. Some editors allow you to edit more than one file at once, and each file occupies its own buffer. 3) A disk buffer is an area in memory that holds data being sent to, or received from, a disk. Some operating systems allow you to adjust the size or number of disk buffers to fit the speed of your disk drive. 4.) A keyboard buffer holds signals from keys that have been pressed but have not yet been accepted by the computer. The IBM PC keyboard buffer holds 16 key- strokes. 5) A printer buffer holds data waiting to print. This frees the CPU for other tasks since it processes data at a faster rate than the printer can print. buffer utilization The percentage of buffer storage in use. bug Computer hardware or software error. Bugs can be either syntax errors, meaning that the rules of the programming language were not followed, or logic errors, meaning that the program does not do what it is supposed to do. bursting The process of separating continuous forms into individual sheets. bus Channel or path for transmitting data and electrical signals. busy 1. In use. 2. Not idle. 3. Not available for use. 4. In an “off-hook” condition.

BUSY0 (Call Processing Busy - termination attempt failed) A register for OM group TRA640M1 that counts calls that cannot terminate to a line because the line is in a CPB state. For lines that are part of a hunt group, register BUSY0 measures only the last member of the hunt group.

BUSY1 (Call Processing Busy - termination attempt failed) A register for OM group TRA250M1 that counts calls that cannot terminate to a line because the line is in a CPB state. For lines that are part of a hunt group, register BUSY1 measures only the

2001-8.0-RFM03-0302 Glossary 34

last member of the hunt group.

BUSY2 (Call Processing Busy - termination attempt failed) A register for OM group TRA125M1 that counts calls that cannot terminate to a line because the line is in a CPB state. For lines that are part of a hunt group, register BUSY2 measures only the last member of the hunt group.

BUSY3 (Call Processing Busy - termination attempt failed) A register for OM group TRA125M2 that counts calls that cannot terminate to a line because the line is in a CPB state. For lines that are part of a hunt group, register BUSY3 measures only the last member of the hunt group.

busy count The number of times a trunk group busy condition occurs.

busy hour The 60 minute period in a day when a specified item of traffic reaches its greatest volume, excluding holidays, weekends, and special event days.

busy hour, peak The busy hour of each day; it usually is not the same over a number of days.

busy key A lever switch on a unit of dial central office equipment which can be used to make the unit “busy” in preparation for testing or working on the equipment.

busy lamp A lamp on a switchboard that, when lit, indicates a trunk is being used.

busy-out To ground the “C” lead of a line or trunk, or to take any other action which causes the line or trunk to test “busy” on incoming calls.

busy season The three months with the highest busy hour traffic which recurs annually.

busy signal 60 IPM normal station busy tone that pulses at 60 interruptions per minute. 120 IPM equipment busy signal.

busy time The total time in seconds a circuit is busy.

BV Busy Verification.

BWD Backward.

By See Busy. byte The amount of memory space needed to store one character, which is normally eight bits. Generally, eight bits form a byte. A computer with eight-bit bytes can distin- guish 256 character combinations.

C7ABATEV (CCS7 abatement overflow) A register for OM group C7LINK2 which collects data in the CC and increases when the ST transmission buffer congestion falls below the ST transmission buffer overflow threshold. Messages of all priorities are transmitted.

C7ABNRFB (CCS7 abnormal forward indicator bit Rx or backward sequence number Rx) A register for OM group C7LINK1 that counts CCS7 link synchronization failures and increases in the central control (CC). Abnormal forward indicator bits (FIB) or backward sequence numbers (BSN) that the signaling terminal (ST) receives cause the failure. When the link synchronization fails, an alarm occurs.

C7ALIGNF (CCS7 alignment failure) A register for OM group C7LINK1 that counts CCS7 link synchronization failures that occur during the alignment or proving period when the system checks links for synchronization. The signaling link cannot synchronize

2001-8.0-RFM03-0302 Glossary 35

because of this failure. An alarm continues. This register increases in the central control (CC).

C7AUTOCO (CCS7 automatic changeovers) A register for OM group C7LINK1 that counts CCS7 automatic changeovers (traffic reroutes) away from the link. An automatic changeover is a changeover that operating company personnel does not initiate.

C7BFOVFL (CCS7 buffer overflow) A register in OM group C7LINK3 that counts the times the system discards a message because message buffers are not available in the CCS7 link interface unit (LIU7). This register is always set to zero (0).

C7BSYOFF (CCS7 busy off) A register for OM group C7LINK1that increases in the signaling terminal (ST). The system transfers the register to the central control (CC) during the OM transfer process. This register counts the busy signal transmission stops at the ST. A busy signal transmission stop indicated that the link recovered from congestion.

C7BSYON (CCS7 busy on) A register for OM group C7LINK1 that counts the busy signal transmission starts at the ST. A busy signal transmission start indicates congestion on the link that can cause a link failure. This register increases in the ST and the system transfers the register to the central control (CC) during the OM transfer process.

C7BYTRT (CCS7 bytes retransmitted) A register for the OM group C7LINK2 that counts bytes that the ST transmits again. These bytes include the data service information (SIO) and signaling information field (SIF) data. These bytes do not include the sequence number, length, and priority checking data. This is referred to as level 2 overhead data.

C7BYTRT2 An extension register of C7BYTRT in OM group C7LINK2.

C7BYTRX (CCS7 bytes received) A register for the OM group C7LINK2 that the ST receives. These bytes include the SIO and SIF data. These bytes do not include the sequence number, length, and priority checking overhead data. This data is referred to as level 2 overhead data.

C7BYTRX2 An extension register of C7BYTRX in OM group C7LINK2.

C7BYTTX (CCS7 bytes transmitted) A register for OM group C7LINK2 that counts bytes that the ST transmits. These bytes include the SIO and SIF data. These bytes do no include the sequence number, length, and priority checking data. This data is referred to as level 2 overhead data.

C7BYTTX2 An extension register of C7BYTTX in OM group C7LINK2.

C7CBK (CCS7 changeback) A register for OM group C7LINK 1that counts changebacks on the link. A changeback is traffic that the system reroutes and returns to the link. Changebacks indicated an improvement in common channel signaling conditions. This register increases in the central control (CC).

C7CCR2 An extension register of C7CCRX in OM group C7SCCPCO.

C7CCRX A register in OM group C7SCCPCO that counts the number of times the switch receives a connection confirm (CC) message from the application.

C7CCT2 An extension register of C7CCTX in OM group C7SCCPCO.

C7CCTX A register in OM group C7SCCPCO that counts the number of times the switch sends a connection confirm (CC) message to the application.

2001-8.0-RFM03-0302 Glossary 36

C7CLB (CCS7 controlled link blocking) A register in OM group C7LINK1 that counts the number of times that controlled link blocking (CLB) was applied to the link during an OM period.

C7CLBU A register in OM group C7LINK3 that stores the time that the system applies con- trolled link blocking to the link during an OM period.

C7CLS0R2 An extension register of C7CLS0RX from OM group C7SCCP.

C7CLS0RX A register in OM group C7SCCP that counts unitdata (UDT) and extended unitdata (XUDT) connectionless class 0 SCCP messages. The SCCP routing control (SCRC) receives these messages from the CCS7 network. The CCS7 network sends the messages through the message transfer part (MTP). Connectionless class 0 messages are specified data units that do not have sequencing.

C7CLS1R2 An extension register of C7CLS1RX from OM group C7SCCP.

C7CLS1RX A register in OM group C7SCCP that counts unitdata (UDT) and the extended unitdata (XUDT) connectionless class 1 SCCP messages. The SCCP routing control (SCRC) receives these messages from the CCS7 network. The CCS7 network sends messages through the message transfer part (MTP). Connectionless class 1 messages are specified data units that have in-sequence delivery.

C7CLS0T2 An extension register of C7SOTX from OM group C7SCCP.

C7CLS0TX A register in OM group C7SCCP that counts unitdata (UDT) and extended unitdata (XUDT) connectionless class 0 SCCP messages. The system routes these messages to the CCS7 network through the message transfer part (MTP). Connectionless class 0 messages are specified data units that do not have sequencing.

C7CLS1T2 An extension register of C7CLS1TX from OM group C7SCCP.

C7CLS1TX A register in OM group C7SCCP that counts unitdata (UDT) and the extended unitdata (XUDT) connectionless class 1 SCCP messages. The system routes these messages to the CCS7 network through the message transfer part (MTP). Connectionless class 1 messages are specified data units that have in-sequence delivery.

C7CLS2R2 An extension register of C7CLS2RX from OM group C7SCCPCO.

C7CLS2RX A register in OM group C7SCCPCO that counts the number of times the switch receives a correct class 2 message from the application. This register contains the total number of incoming correct class 2 messages transmitted across the CCS7 link.

C7CLS2T2 An extension register of C7CLS2TX from OM group C7SCCPCO.

C7CLS2TX A register in OM group C7SCCPCO that counts the number of times the switch sends a valid class 2 message to the application. The value in this register indicates the total number of valid outgoing messages transmitted across the CCS7 link.

C7CNTRER (CCS7 controlled rerouting) A register in OM group C7ROUTE that counts controlled rerouting procedures for a route in the CC. Controlled rerouting indicates that a route from which the system diverts traffic has traffic restored The system diverted messages to this route.

C7COFAIL A register in OM group C7SCCPCO that counts the number of connections that fail

2001-8.0-RFM03-0302 Glossary 37

because of software errors such as the following: the IT message contains a correct class that is not correct, an ERR message is received, or a CC message contains data that is not correct. When this register increases, the system dismantles the connec- tion.

C7COMREJ A register in OM group C7SCCPCO that counts the number of times the system discards a connection oriented message because it contains a message type that is not supported. The following message types are not supported: DT2 (Data Form 2), AK (Data acknowledge), ED (Expedited data), EA (Expedited data acknowledge), RSR (Reset request), and RSC (Reset confirm).

C7COV (CCS7 changeover) A register for OM group C7LINK1 that counts changeovers (traffic reroutes) away from the link. A changeover indicates that the system diverted traffic away from a common channel signaling link. An alarm occurs.

C7CREFRX A register in OM group C7SCCPCO that counts the number of times the switch receives a connection refused (CREF) message from the application.

C7CREFTX A register in OM group C7SCCPCO that counts the number of times the switch sends a connection refused (CREF) message to the application. This event occurs, for example, when the local subsystem is not in service or if the maximum number of connections (2048) are already established.

C7CRR2 An extended register of C7CCRX in OM group C7SCCPCO.

C7CRRX A register in OM group C7SCCPCO that counts the number of times the switch receives a connection request (CR) message from the application.

C7CRT2 An extended register of C7CCTX in OM group C7SCCPCO.

C7CRTX A register in OM group C7SCCPCO that counts the number of times the switch receives a Data Form 1 (DT1) message from the application.

C7DT1R2 An extended register of C7DT1RX in OM group C7SCCPCO.

C7DT1RX A register in OM group C7SCCPCO that counts the number of times the switch receives a Data Form 1 (DT1) message from the application.

C7DT1T2 An extended register of C7DT1TX in OM group C7SCCPCO.

C7DT1TX A register in OM group C7SCCPCO that counts the number of times the switch sends a Data Form 1 (DT) message to the application.

C7ERRSEC (CCS7 link errored seconds) A register for OM group C7LINK1 that reports the length of time the system detects a minimum of one in-service error on a signaling link.

C7EXCONG (CCS7 excessive congestion) A register for OM group C7LINK1 that counts CCS7 link synchronizations that fail because of prolonged congestion on the link. Link synchro- nization failure causes an alarm to occur. This register increases in the central control (CC).

C7EXDLAY (CCS7 excessive delay) A register for OM group C7LINK1 that counts CCS7 link synchronizations that fail because the far-end ST delays the acknowledgement of messages that were sent. This register increases in the central control (CC) and link synchronization failure raises an alarm.

2001-8.0-RFM03-0302 Glossary 38

C7EXERR (CCS7 excessive error rate) A register for OM group C7LINK1 that counts CCS7 link synchronizations that fail because the ST detects excessive signal unit errors. This register increases in the central control (CC) and link synchronization failure raises an alarm.

C7FRCRER (CCS7 forced rerouting) A register for OM group C7ROUTE that counts (in the CC) forced rerouting procedures undertaken for a route. When a route to a destination fails, the system reroutes messages to available alternate routes. A transfer prohibited status (TFP) message arrives to indicate a failed route. The route is not available to transmit messages. An alarm occurs at the routeset level.

C7GTT95 A register for OM group C7MTP that counts the number of MSUs sampled that have processing handling delays. These delays are above the 95th-percentile requirement for MSUs that have GTT.

C7HWILLP (CCS7 high-water mark for ILLP interface) A register for OM group C7LINK3 counts the highest number of messages or MSUs that are received in 1 second from the ILLP interface.

C7HWMTS (CCS7 high-water mark for MTS interface) A register for OM group C7LINK3 counts the highest number of messages or MSUs received in 1 second from the MTS interface. This register is set to zero (0).

C7HWST (CCS7 high-water mark for ST interface) A register for OM group C7LINK3 that counts the highest number of messages or MSUs received in 1 second from the signaling terminal (ST) interface. This register is set to zero (0).

C7HWTOT (CCS7 high-water mark total interfaces) A register for OM group C7LINK3 that counts the highest number of messages or MSUs received in 1 second from all interfaces (ILLP, MTS, and ST). This register is set to zero (0).

C7ITRX A register in OM group C7SCCPCO that counts the number of times the switch receives an inactivity test (IT) message from the application. This event occurs when a timeout of the inactivity send timer occurs at the far end.

C7ITTX A register in OM group C7SCCPCO that counts the number of times the switch sends an inactivity test (IT) message to the application. This event occurs when a timeout of the inactivity send timer occurs at the local end. This timer tracks the time between consecutive messages sent on an active connection in table SCCPTMR contains the value of this timer.

C7LOCSS A register in OM group C7SCCP that counts UDT/UDTS and XUDT/XUDTS messages for a local subsystem. The SCCP routing control (SCRC) receives these messages from the CCS7 network through the message transfer part (MTP).

C7LOCSS2 An extension register of C7LOCSS from OM group C7SCCP.

C7LPOU (CCS7 local processor outage) A usage register for OM group C7LINK3 that records each local processor outage (LPO) that the signaling terminal (ST) detects. It has a scan rate of 10 seconds.

C7LV1CGU (CCS7 level 1 link congestion) A usage register for OM group C7LINK3 that records level 1 link congestion on a CCS7 link. It has a scan rate of 10 seconds.

C7LV2CGU (CCS7 level 2 link congestion) A usage register for OM group C7LINK3 that records level 2 link congestion on a CCS7 link. It has a scan rate of 10 seconds.

2001-8.0-RFM03-0302 Glossary 39

C7LV3CGU (CCS7 level 3 link congestion) A usage register for OM group C7LINK3 that records level 3 link congestion on a CCS7 link. It has a scan rate of 10 seconds.

C7LINH (CCS7 local inhibit) A register for OM group C7LINK1 that increases in the central control (CC) when local inhibit is applied to the link. Local inhibit means that operating company personnel divert traffic away from the link with the use of the inhibit procedure. Application of local inhibit raises an alarm.

C7LKFAIL (CCS7 link failure) A register for OM group C7LINK1 that counts CCS7 link synchroni- zation failures and increases in the central control (CC). This register counts in-service link failures and does not count link activation failure (link not in-service failures).

C7LKSYNU (CCS7 link synchronization) A usage register for OM group C7LINK that records if a CCS7 link is synchronized and able to carry signaling units to the far-end ST. It has a scan rate of 10 s. If this register doesn’t increase every 10 s, the link failed and an alarm will occur. This doesn’t indicate that the links is for traffic.

C7LKUNAU (CCS7 link unavailable) A usage register for OM group C7LINK1 that records if a link is not available for traffic. It has a scan rate of 10 s.

C7LPO (CCS7 local processor outage) A usage register for OM group C7LINK1 that records local processor outages (LPO) that the ST detects. This register controls: the message switch and buffer (MSB7) outages; Events during which the local processors manual busy (the link is taken out of service manually); events during which inhibit proce- dures control a link. If an MSB7 outage caused the LPO, a serious problem occurred. If manual busy or inhibit procedures caused the LPO, an alarm will occur. This register increases in the ST and transfers to the central control (CC) during the OM transfer process.

C7LUNINH (CCS7 loca uninhibit) A register for OM group C7LINK1 that increases in the central control (CC) when local inhibiting status is removed from the link. The link can serve traffic if all other controls and problems can be serviced.

C7MANB (CCS7 manual busy) A register for OM group C7LINK1 that increases in the central control (CC) when the link is manual busy (an alarm can occur). Manual busy indicates that operating company personnel control a link.

C7MSIDPC A register for OM group C7MPT that counts MSUs that the system discards at an STP because the destination point code (DPC) is not in the datafill of the routing tables for the node.

C7MSBRET (CCS7 message switch buffer retrieval) A register for OM group C7LINK2 that increases when information is transferred to a holding register in the CC. Registers that reside in the link-handling peripheral module (PM), which is an MSB, LIU7, or HLIU, collect this information.

C7MSGGT A register in OM group C7SCCP that counts UDT/UDTS and XUDT/XUDTS messages that SCCP routing control (SCRC) receives. These messages require global title translation (GTT).

C7MSGGT2 An extension register of C7MSGGT from OM group C7SCCP.

C7MSGHD2 An extension register of C7MSGHDL from OM group C7SCCP.

C7MSGHDL A register in OM group C7SCCP that counts the following: UDT/UDTS and XUDT/ XUDTS messages that SCCP routing control (SCRC) handles, messages that local users send through SCCP connectionless control (SCLC).

2001-8.0-RFM03-0302 Glossary 40

C7MSGLOS (CCS7 messages lost) A register for OM group C7LINK2 counts messages that are lost on paths from an incoming LIU7 or HLIU link to all outgoing LIU7 or HLIU links in the STP (signal transfer point).

C7MSGMSQ (CCS7 messages mis-sequenced) A register for OM group C7LINK2 counts messages that are received out of their correct order on paths from all incoming LIU7 or HLIU links. The messages are sent to a given destination LIU7 or HLIU in the STP. The data is collected in the destination LIU7 or HLIU. This register counts the cumulative of all messages that are not sequenced correctly on all paths to the destination.

C7MSISIO A register for OM group C7MPT that counts MSUs that the system discards at an STP because the service information octet (SIO) cannot determine the type of message.

C7MSOR (CCS7 message signal unit octets originated) A register for OM group C7LINK3 that counts MSU octets that originate on a CCS7 link in an office. Register C7MSOR includes management MSUs and global title translations that generate new mes- sages.

C7MSOR2 (CCS7 message signal unit octets originated) A register for OM group C7LINK3 that is an extension register of C7MSOR.

C7MSTE (CCS7 message signal unit octets terminated) A register for OM group C7LINK3 that counts MSU octets that terminate on a CCS7 link in an office. Register C7MSTE includes management MSUs and global title translations that generate new mes- sages.

C7MSTE2 (CCS7 message signal unit octets terminated extension) A register for OM group C7LINK3 that is an extension of C7MSTE.

C7MSTS (CCS7 message signal unit octets through-switched) A register for OM group C7LINK3 that counts MSU octets that switch through an office. This register does not include global title translations. This register and C7MSTS2 apply to LPP-based CCS7 nodes. These registers are not valid on MSB7-based nodes.

C7MSTS2 (CCS7 message signal unit octets through-switched extension) A register for OM group C7LINK3 that is an extension of register C7MSTS.

C7MSUBOV (CCS7 message signal unit buffer overflow) A register for OM group C7LINK3 that counts MSUs that the system loses because buffers are not available to store mes- sages.

C7MSUDC (CCS7 messages discarded) A register for OM group C7LINK2 that counts message signal units that the ST discards because of congestion overflow in the transmission buffer beyond congestion level 3. If this persists, take action to improve link trans- mission or reduce the traffic load on the link. Data is collected in the ST and during the OM transfer process is transferred to the CC.

C7MSUDC2 An extension register for C7MSUDC.

C7MSUOR (CCS7 messages originated) A register for OM group C7LINK2 that counts messages that originate at the ST. Messages that originate at the ST include global title transla- tions (GTT) and management messages. This register is activated only for LIU7 or HLIU.

C7MSUOR2 An extension register for C7MSUOR.

2001-8.0-RFM03-0302 Glossary 41

C7MSURX (CCS7 messages received) A register for OM group C7LINK2 that counts messages the ST received. The data is collected in the ST and transferred to the CC during the OM transfer process.

C7MSURX2 An extension register for C7MSURX.

C7MSUTE (CCS7 messages terminated) A register for OM group C7LINK2 that counts messages terminating at the node. It is activated for products based on the LIU7 or HLIU.

C7MSUTE2 An extension register for C7MSUTE.

C7MSUTS (CCS7 messages through-switched) A register for OM group C7LINK2 counts mes- sages that an STP or integrated node (INode) relays to other signaling points.

C7MSUTS2 An extension register for C7MSUTS.

C7MSUTX (CCS7 messages transmitted) A register for OM group C7LINK2 that counts messages that the ST transmits. The data is collected in the ST and transferred during the OM transfer process to the CC.

C7MSUTX2 An extension register for C7MSUTX.

C7NACKRX (CCS7 negative acknowledgements) A register for OM group C7LINK1 that counts negative acknowledgements received from the far-end signaling terminal (ST) and transfers to the central control (CC) during the OM transfer process. Negative acknowledgement indicates that messages are not correctly received and then the messages are transmitted again.

C7NETCON (CCS7 network connection) A register for OM group C7LINK1 that increases in the central control (CC) when link synchronization fails because of failure to connect with the network. An alarm occurs.

C7NGTT95 A register for OM group C7MPT that counts the number of MSUs sampled that have processing handling delays. These delays are above the 95th-percentile requirement for MSUs that do not have GTT.

C7NUCFL (CCS7 nail-up connection failure) A register for OM group C7LINK1 that increases in the central control (CC) when link activation cannot establish a permanent network connection. A synchronized link that does not have a permanent network connection cannot survive a central control (CC) restart. The link continues to operate and service is not affected.

C7ONSETV (CCS7 onset overflow) A register for OM group C7LINK1 that increases when messages overflow the ST transmission buffer. When this happens, the system discards all calls. Collects data in the CC.

C7PHDYNT A register for OM group C7MPT that records the average processing handling delay for MSUs that do not require global title translation (GTT). The MSU sampling rate is once every 10 seconds. The register reports the average processing handling delay in milliseconds.

C7PHDYWT A register for OM group C7MPT that records the average processing handling delay for MSUs that require GTT. The MSU sampling rate is one time every 10 s. The register reports the average processing handling delay in milliseconds.

C7RINH (CCS7 remote inhibit) A register for OM group C7LINK1 that increases in the central control (CC) when operating company personnel apply remote inhibit to the link in

2001-8.0-RFM03-0302 Glossary 42

order to divert traffic away from the link. An alarm occurs in the CCS7 system.

C7RLCR2 An extension register of C7RLCRX for OM group C7SCCPCO.

C7RLCRX A register for OM group C7SCCPCO that counts the number of times the switch receives a release complete (RLC) message from the application. The far end sends this message in response to a RLSD message from the local end.

C7RLCT2 An extension register of C7RLCTX for OM group C7SCCPCO.

C7RLCTX A register for OM group C7SCCPCO that counts the number of times the switch sends a release complete (RLC) message to the application. The switch sends this message in response to an RLSD message if a valid connection was present or not.

C7RLSDR2 An extension register of C7RLSDRX for OM group C7SCCPCO.

C7RLSDRX A register for OM group C7SCCPCO that counts the number of times the switch receives a released (RLSD) message from the application. This message indicates that the far end wants to release the established connection.

C7RLSDT2 An extension register of C7RLSDTX for OM group C7SCCPCO.

C7RLSDTX A register for OM group C7SCCPCO that counts the number of times the switch sends a released (RLSD) message to the application.

C7RPO (CCS7 remote processor outages) A register for OM group C7LINK1 that counts remote processor outages ST reports. It increases in the central control (CC). Remote processor outages indicated that the link is not able to deliver traffic. An alarm occurs. The local office must wait for the far-end signaling point to recover.

C7RPOU (CCS7 remote processor outages) A usage register for OM group C7LINK3 that records (in the CC) remote processor outages reported by the signaling terminal (ST). Remote processor outages indicate that the link is not able to deliver traffic and the system raises an alarm. The local office must wait for the far-end signaling point to recover.

C7RTBKSS A register for OM group C7SCCP that counts UDT/UDTS and XUDT/XUDTS messages that the system routes to a backup subsystem when the primary subsystem is not available.

C7RTFALL A register for OM group C7SCCP that counts UDT/UDTS and XUDT/XUDTS messages that SCCP routing control (SCRC) receives that the system cannot route. Messages that the system cannot route include the following: messages from the link through the message transfer part (MTP), messages from local subsystems routed through SCCP connectionless control (SCLC), messages with the incorrect encoding or with unknown fields, or messages with the internal priority code lower than the internal congestion level.

C7RTFNTA A register for OM group C7SCCP that counts messages that SCCP routing control (SCRC) receives that the system cannot route because the invalid field values No Translation for Such Address appear in the called party address (CDPA). This field value indicates that a translation in the global title translation table in the CDPA of the message is not present.

C7RTFNTN A register for OM group C7SCCP that counts messages that SCCP routing control (SCRC) receives. These messages are routed because the invalid field values No Translation for an Address of Such Nature appear in the called party address (CDPA)

2001-8.0-RFM03-0302 Glossary 43

of the message.

C7RTFNWC A register for OM group C7SCCP that counts messages that SCCP routing control (SCRC) receives. These messages cannot be routed because of network congestion.

C7RTFNWF A register for OM group C7SCCP that counts messages that SCCP routing control (SCRC) receives. These messages cannot be routed because of network failure.

C7RTFSSC A register for OM group C7SCCP that counts messages that SCCP routing control (SCRC) receives. These messages cannot be routed because of subsystem congestion.

C7RTFSSF A register for OM group C7SCCP that counts messages that SCCP routing control (SCRC) receives. These messages cannot be routed because of subsystem failure.

C7RTFUEQ A register for OM group C7SCCP that counts messages that SCCP routing control (SCRC) receives. The system cannot route these messages because of a destination local subsystem that is not known.

C7RTOVLD (CCS7 real time overload) A register for OM group C7LINK3 that counts the number of messages or MSUs that the system discards because an overload occurs in the LIU7. This register is set to zero (0).

C7RTUNAU (CCS7 route unavailable) A usage register for OM group C7ROUTE that scans the route every 10 seconds, counts in the CC and records if the route transmits mes- sages. If one of the routes of the routeset is not able to deliver messages, an alarm occurs.

C7RUNINH (CCS7 remote uninhibit) A register fro OM group C7LINK1 that increases when remote inhibiting is removed from a link. If other controls or problems are not present on the link, the link can be used.

C7SCCP CCS7 Signaling Connection Control Part.

C7SCCPCO CCS7 Signaling Connection Control Part Connection Orientated.

C7SLTFL (CCS7 signaling link test failure) A register in OM group C7LINK1 that increases in the central control (CC) when signaling cannot take place because of a signaling link test (SLT) failure. An SLT failure indicates that the system cannot synchronize a link. An alarm occurs in the CCS7 system.

C7SMPTN1 A register for OM group C7MPT that records the number of MSUs sampled for cross-STP and processor handling delay measurements. These sampled MSUs do not have GTT.

C7SMPTN2 An extension register for OM group C7MPT of C7SMPTN1.

C7SMPWT1 A register for OM group C7MPT that records the number of MSUs sampled for average cross-STP and processor handling delay measurements. These sampled MSUs have GTT.

C7SMPWT2 An extension register for OM group C7MPT of C7SMPWT1.

C7STRET (CCS7 signal terminal retrieval) A register in OM group C7LINK2 that increases when the information that registers collect tranfers to a holding register in the CC. These registers are in the ST of the link.

C7STALFL (CCS7 signaling terminal allocation failure) A register in OM group C7LINK1 that

2001-8.0-RFM03-0302 Glossary 44

increases in the central control (CC) when signaling cannot take place because the ST cannot be allocated.

C7SUERR (CCS7 signal units error) A register in OM group C7LINK1 that counts signal units on a link received in error. The count in this register is the number of messages that are not received correctly from the far-end signaling point. The messages are transmitted. This register increases in the signaling terminal and transferred to the central control (CC) during the OM transfer period.

C7SYNERR A register in OM group C7SCCP counts UDT/UDTS and XUDT/XUDTS messages that SCCP routing control (SCRC) receives. These messages cannot be routed because syntax errors occur in the called party address (CDPA).

C7TFA (CCS7 transfer allowed) A register in OM group C7ROUTE that counts (in the CC) transfer allowed (TFA) status messages received for a route. A TFA message indicates that the CCS7 network has a good grade of service for the specified route. One destination point code (DPC) in the routing label specifies this route.

C7TFP (CCS7 transfer prohibited) A register in OM group C7ROUTE that counts (in the CC) transfer prohibited (TFP) status messages received for a route. This message indicates that the CCS7 network cannot deliver messages on this route to the destination point code (DPC). The routing label specifies the DPC. A routeset alarm occurs.

C7TFR (CCS7 transfer restricted) A register in OM group C7ROUTE counts (in the CC) transfer restricted status messages received for a route. This message indicates that the CCS7 network offers degraded service for the route. The system delivers message, but not as quickly as normal. A major alarm occurs.

C7TLALFL (CCS7 transmission link allocation failure) A register in OM group C7LINK1 that increases in the central control (CC) when signaling cannot take place because a transmission link cannot be allocated. The system cannot synchronize a link. An error occurs.

C7TUDTRX A register for OM group C7SCCP that counts unitdata (UDT) connectionless SCCP messages. The SCCP routing control (SCRC) receives these messages from the CCS7 network through the message transfer part (MTP).

C7TUDTRX2 An extension register of register C7TUDTRX of OM group C7SCCP.

C7TUDTSRX A register for OM group C7SCCP that counts unitdata service (UDTS) connectionless SCCP messages. The SCCP routing control (SCRC) receives these messages from the CCS7 network through the message transfer part (MTP). UDTS messages consist of a message that failed. This message has the return option and a routing failure reason.

C7TUDTSTX A register for OM group C7SCCP that counts unitdata service (UDTS) connectionless SCCP messages that the system routes to the network through the message transfer part (MTP). The UDTS message contains a message that failed. This message contains the return option and the routing failure reason.

C7TUDTTX A register for OM group C7SCCP that counts unitdata (UDT) connectionless SCCP messages. The system routes these messages to the network through the message transfer part (MTP).

C7TUDTTX2 An extension register of register C7TUDTTX of OM group C7SCCP.

C7XSDYNT A register for OM group C7MPT that records the average cross-STP delay for MSUs that do not have GTT.

2001-8.0-RFM03-0302 Glossary 45

C7XSDYWT A register for OM group C7MPT that records the average cross-STP delay for MSUs that have GTT. The MSU sampling rate is one time every 10 s. The register reports average cross-STP delay in milliseconds.

C7XTFA (CCS7 exception-list transfer allowed) A register in OM group C7ROUTE that counts (in the CC) the number of transfer-allowed (TFA) messages received for partial-point- code routes. This register increases if enhanced cluster routing (ECR) is active.

C7XTFP (CCS7 exception-list transfer prohibited) A register in OM group C7ROUTE that counts (in the CC) the number of transfer-prohibited (TFP) messages received for partial-point-code routes. A TFP message indicates that the CCS7 network cannot deliver messages on this route to the destination point code (DPC). The routing label specifies the DPC.

C7XTFR (CCS7 exception-list transfer restricted) A register in OM group C7ROUTE that counts (in the CC) the number of transfer-restricted messages received for partial-point-code routes. This message indicates that the CCS7 network offers degraded service for the route. The system delivers messages but not as quickly as normal. A major alarm occurs.

CA A trunk group which carries customer dialed 7 or 10 digit intertoll calls to central- ized automatic message accounting equipment where recording and timing of a connection are done automatically in addition to the switching function. Either CAMA operators or ANI may be used for number identification.

CABANDON Call Abandoned. Incremented each time a subscriber hangs up while the call is in queue for an operator position. cable A group of wires woven together in a sheath. Used to connect two parts of the system together, it carries electrical power or signals. cache A place where data can be stored to avoid having to read the data from a slower device such as a disk.

CAD/CAM Computer-Aided Design/Computer-Aided Manufacture.

CAE Computer-Aided Engineering.

CAI Computer-Assisted Instruction.

CAINAGOM Carrier Advanced Intelligent Network Per-Agency Operational Measurements.

CAINCRS Carrier AIN0.2 non-call related messages.

CAINIP Carrier Advanced Intelligent Network Per-Agency 1129-style IP Interactions.

CAINOM Carrier Advanced Intelligent Network Operational Measurements.

CAINTRIG Carrier Advanced Intelligent Network Trigger.

CAL Computer-Augmented Learning.

CALATMPT 1.The total number of calls attempted by TOPS VSN. This number is incremented for the relevant key each time the TOPS VSN processes a call from the DMS or performs alternate billing. 2. COLLECT + THIRDNUM + CALLCARD + OVERSEAC + NOTAUTO + (ABANDON

2001-8.0-RFM03-0302 Glossary 46

- ABDAFTSS) + NOVCERES 3. AUTOMATE + PARTAUTO + NOTAUTO + ABANDON + NOVCERES + OVERSEAC

CALC Customer Access Line Charge.

call A customer attempt for which the complete address code (e.g., O-, 911, or 10 digits) is provided to the serving dial tone office.

CALLARIV Call Arrivals. CALLARIV is incremented each time an application presents a call to the CAM. CALLARIV = IMEDQAG + IMEDTAG + IMEDPAG + CALLQD + CALLDEFL + OVLMAX +OVLNOCQE

CALLARIV2 Extension register of CALLARIV.

call back An attempt by a telephone user to talk to another user.

call busy hour Also known as the equipment busy hour. The 60 minute period in a day in which the calls processed by the switching equipment are the highest.

CALLCARD The number of calling card calls received by the TOPS VSN. This number is incremented for the relevant key each time a four-digit PIN or a 14-digit calling card number is entered during service selection.

CALLDEFL Call Deflected. CALLDEFL is incremented each time an application presents a call to the CAM and the call is deflected because no agents are immediately available to serve the call, and the projected wait time exceeds the value of the field MAXSIZE for the application’s queue in table QMSCQDEF. CALLARIV = IMEDQAG + IMEDTAG + IMEDPAG + CALLQD + CALLDEFL + OVLMAX + OVLNOCQE

CALLDEFL2 Extension register of CALLDEFL.

call delay The delay suffered by a call which arrives at the switching equipment, such as a linefinder, and finds the equipment busy processing other calls. This delay is considered to be acceptable if not over 1½% of the calls are delayed by three seconds during the busy hour.

call hour The quantity represented by one or more calls that have an aggregate duration of one hour.

call seconds The product of the number of busy hour calls and the average holding time per call expressed in seconds.

called number The number to which a call is placed.

calling number The number from which a call originates.

calling rate The average number of originated calls per line during a given period.

calling, touch Multifrequency tone signaling by push buttons.

CALLOVER (Call Over) A register for wireless OM group OMMTXHO that is not in current use.

CALLQD Call Queued. CALLQD is incremented each time an application presents a call to the CAM and the call is placed in queue because no agent is immediately available to serve the call. CALLQD = GOTAVAG + GOTSPLCL + AGREQCAN

2001-8.0-RFM03-0302 Glossary 47

CALLARIV = IMEDQAG + IMEDTAG + IMEDPAG + CALLQD + CALLDEFL + OVLMAX +OVLNOCQE

CALLQD2 Extension register of CALLQD.

CALLWAIT See OM group CALLWAIT.

CAMA Centralized Automatic Message Accounting. cancel character A control character which indicates that an error has been made and the data concerned should be disregarded.

CANCRSRC A register for OM group CAINMSGR that counts the number of Cancel_Resource_Event messages the switch receives from the SCP.

Cap Capacitor. capacitor A device for storing an electric charge, and when properly stimulated, releases this charge. This is the way bits are read from, and written to, computer storage. capacity The average load of traffic usage a circuit group can carry or the number of attempts a circuit group can handle in the busy hour while still meeting service objectives as predicted by traffic blocking or delay models. capacity tables Based on mathematical traffic blocking or delay models, capacity tables state how much traffic can be carried on a group of n circuits at n probability of blocking or delay.

CAPS Call Attempts Per Second.

CARAT (Call Request Attempts) A register for OM group MWTCAR that counts the attempts to activate message waiting (MWT). The subscriber dials the call request access (CRA) code to activate message waiting. card Another term for a printed circuit board.

CARDOVFL (Call Request delete specific overflows) A register for OM group MWTCAR that counts the attempts to deactivate a call request that failed. To deactivate a call requst, the called party dials the call request delete specific access code. Parameter NO_OF_FTR_DATA_BLKS in table OFCENG specifies a lack of software resources which cause failures.

CARDTACT (Call Request Retrieval Delete All) A register for OM group MWTCAR that counts attempts that a caller removes from a station. To remove calls from a station, the caller dials the call request delete all (CRDA) access code.

CARDWTHL This OM is pegged when the user enters in a language preference followed by an attempt to bill the call as a credit card call.

CARFAIL (Call Request Failures) A register for OM group MWTCAR that counts attempts to activate the call request feature that fail because of feature restrictions. This count includes attempts to activate call request against a situation that has the call request (CRX) option.

CARODACT (Call Request delete activation) A register for OM group MWTCAR that increases when a called party dials the call request delete specifc (CRDS) access code. The called party dials the code in an attempt to remove a call request.

2001-8.0-RFM03-0302 Glossary 48

CAROT See Centralized Automatic Reporting On Trunks.

CAROVFL (Call Request overflow) A register for OM group MWTCAR that counts call request attempts (code CRA) that fail because of a lack of feature data blocks. Parameter NO_OF_FTR_DATA_BLKS in table OFCENG specifies feature data blocks.

CARRETRV (Call Request Retrieval) A register for OM group MWTCAR that counts attempts to retrieve call requests.

CARRFAIL (Call Request Retrieval Failure) A register for OM group MWTCAR that counts attempts to retrieve a call request that failed because of feature restrictions.

CARROVFL (Call Request Retrieval Overflow) A register for OM group MWTCAR that counts attempts to retrieve a call request that failed because of a lack of feature data blocks. Paramter NO_OF_FTR_DATA_BLKS in table OFCENG specifies feature data blocks.

carriage return (CR) Moves the cursor from one point to another on the screen.

carried traffic Traffic that actually occupies a set of circuits or switches.

carrier, common A commercial telecommunications carrier.

carrier frequency The frequency at which a signal used to convey information operates.

carrier line A transmission line used to carry a carrier circuit.

CAT 1. Computer-Aided Testing. 2. Computer-Assisted Training.

catalog A list of the contents of a disk.

catena Series of items in a chained list.

CATT Centralized Automatic Toll Ticketing.

CATV Community Antenna Television.

CAUCNICV (CNI on CDMA during conversation) A register for OM group CAUCPSYS that counts when the CPN relays the CLID during conversation.

CAUCNITR (CNI on CDMA during termination) A register for OM group CAUCPSYS that counts when CPN relays the CLID during call setup.

CAUCPSCT See OM group CAUCPSCT.

CAUCPSY1 (CDMA call processing system spare register) A register for OM group CAUCPSYS that is not currently (as of March 2002) in use.

CAUCPSYS See OM group CAUCPSYS.

CAUDROPR (CPN dropped poor RF link) A register for OM group CAUCPSCT that counts when a call is dropped due to poor RF link.

CAUDROPN (CPN dropped failure in network) A register for OM group CAUCPSCT that counts when a call is dropped due to a failure in the network.

CAUDUPPG (CDMA duplicate page response) A register for OM group CAUCPSYS that counts when

2001-8.0-RFM03-0302 Glossary 49

a duplicate page response is received before the call has been set up. The duplicate page response message is discarded because either there is a faulty mobile, or there are two mobiles on the system with the same MN and serial number. Log CDMA 100 duplicate page response is also printed.

CAUEDLOT (CPN error drop loss of traffic) A register for OM group CAUCPSCT that counts when an access failure occurs due to the loss of the traffic channel.

CAUERLFL (CPN error radio link failure) A register for OM group CAUCPSCT that counts when a CDMA RF link cannot be established with the mobile for origination or termination.

CAUERSFL (CPN error radio setup failure) A register for OM group CAUCPSCT that counts when the call cannot be completed due to a failure or shortage of radio link resources (at the BTS).

CAUESWFL (CPN error software failure) A register for OM group CAUCPSCT that counts when a software error occurs.

CAUFLASH (CDMA message received) A register for OM group CAUCPSYS that counts when the SBS sends a flash message to the CPN to be forwarded to the CM.

CAUFWCAP (BTS forward capacity) A register for OM group CAUCPSCT that counts when the BTS reports (through NOIS messages) that forward capacity is full; pegs on a sector basis.

CAUHATTS (CPN handoff attempts) A register for OM group CAUCPSCT that counts when the CM requests the peripheral to prepare a cell for hard handoff.

CAUHBLKS (CPN handoffs blocked) A register for OM group CAUCPSCT that counts when a CPN fails to allocate resources for a hard handoff on the target CPN.

CAUHOSRC (CDMA handoff source) A register for OM group CAUCPSYS that counts when the mobile requests a hard handoff or an intersystem handoff.

CAUHOTRG (CDMA handoff target) A register for OM group CAUCPSYS that counts when the CM requests the CPN to prepare a cell for handoff.

CAUHSOFT (CDMA handoff soft) A register for OM group CAUCPSYS that counts when a mobile indicates that it has completed a soft/softer handoff and the existing primary serving cell no longer supports that mobile. This register is pegged whenever a CPN receives a zone change indicator from teh SBS.

CAUHRLFL (CPN handoff radio link failure) A register for OM group CAUCPSCT that counts when the mobile fails to move from the old channel to the new target channel during a hard handoff.

CAUHRLS (CPN handoff success) A register for OM group CAUCPSCT that counts when the user hangs up while the mobile is handing off via hard handoff.

CAUHSUCC (CPN handoff release) A register for OM group CAUCPSCT that counts after the target SBS detects that the mobile is on the new channel following hard handoff.

CAULRLS (CDMA call release) A register for OM group CAUCPSYS that counts when a CM- originated call release is received.

CAUMRLS (CDMA mobile-initiated release) A register for OM group CAUCPSYS that counts when a mobile-initiated call release occurs (includes call drops if the handling is similar to user-initiated release.

2001-8.0-RFM03-0302 Glossary 50

CAUNOTCE (BTS no traffic channel element) A register for OM group CAUCPSCT that counts when the BTS reports (through NOIS messages) that there is no traffic channel element; pegs on a sector basis.

CAUNOWCD (BTS no Walsh code) A register for OM group CAUCPSCT that counts when the BTS reports (through NOIS messages) that no Walsh code is available; pegs on a per- sector basis.

CAURECAP (BTS reverse capacity) A register for OM group CAUCPSCT that counts when the BTS reports (through NOIS messages) that the reverse capacity is full; pegs on a sector basis.

CAUOATTS (CPN origination attempts) A register for OM group CAUCPSCT that counts when the CPN receives an origination message from a mobile from the current sector. The register is pegged on different CAUs and combined on the CM to show the number or origination received in a sector.

CAUOBLKS (CPN originations blocked) A register for OM group CAUCPSCT that counts when an origination is blocked due to resource shortages or messaging timeouts. The resource includes CPN resources, voice trunks, and radio links.

CAUORLS (CPN origination release) A register for OM group CAUCPSCT that counts on a sector basis when the mobile releases or the CM CP sends a call release message to CAU CP during call setup.

CAUORIGS (CDMA originations) A register for OM group CAUCPSYS that counts when an origina- tion message is received by the CPN.

CAUORODR (CPN origination reorder) A register for OM group CAUCPSCT that counts when a CM call processing sends a mobile reorder or mobile intercept message to indicate an invalid mobile to CPN on mobile origination.

CAUOSUCC (CPN origination successful) A register for OM group CAUCPSCT that counts when the SBS starts receiving data on the reverse traffic channel from the terminating mobile.

CAUPGREQ (CPN page request) A register for OM group CAUCPSYS that counts when a CPN receives a page request from CM CP.

CAUPGRES (CPN page response) A register for OM group CAUCPSCT that counts when the CPN receives a page response for the first page request from the current call.

CAUPGRTY (CPN page retry) A register for OM group CAUCPSYS that counts after no response is received by the CPN within CDMACONF.CAUPGTO seconds and after the second page request has been sent.

CAUPGRRS (CPN page retry response) A register for OM group CAUCPSCT that counts when a mobile response to the second page (repage) within the page timeout value.

CAUPGTO (CPN page timeout) A register for OM group CAUCPSYS that counts after the CPN has timed out both times without receiving a page response.

CAUPMWNA (message waiting notification attempt on paging channel) A register for OM group CAUCPSYS that counts when the CPN attempts (on the paging channel) to send the MWN to the mobile.

2001-8.0-RFM03-0302 Glossary 51

CAUPMWNC (message waiting notification completion on retry on paging channel) A register for OM group CAUCPSYS that counts when the CPN receives acknowledgment from the mobile, on the access channel, in its first attempt to send the MWN to the mobile.

CAUPMWNR (message waiting notification attempt on retry on paging channel) A register for OM group CAUCPSYS that counts when CPN recieves acknowledgment from the mobile, on the access channel, after a retry to send the MWN to the mobile.

CAUREGNS (CDMA registrations) A register for OM group CAUCPSYS that counts when a registra- tion message is received.

CAUTBLKS (CPN terminations blocked) A register for OM group CAUCPSCT that counts when a mobile-terminated call is blockeddue to the resource shortage. It represents all of the blocked terminations in a sector, regardless of the resource.

CAUTRLS (CPN termination release) A register for OM group that counts when a mobile- terminated call is release before the mobile arrives on the traffic channel. This OM is only pegged when the originating party disconnects between the time that the terminating mobile’s page response has been received by the CM and before the mobile actually arrives on the traffic channel.

CAUTMWNA (message waiting notification attempt on traffic channel) A register for OM group CAUCPSYS that counts when the CPN attempts (on the traffic channel) to send the MWN to the mobile.

CAUTMWNC (message waiting notification completion on first attempt on traffic channel) A register for OM group CAUCPSYS that counts when the CPN receives acknowledgment from the mobile, on the traffic channel, in its first attempt to send the MWN to the mobile.

CAUTMWNR (message waiting notification completion on retry on traffic channel) A register for OM group CAUCPSYS that counts when CPN recieves acknowledgment from the mobile, on the traffic channel, after a retry to send the MWN to the mobile.

CAUTSUCC (CPN termination successful) A register for OM group CAUCPSCT that counts after the SBS receives an answer from the terminating mobile.

CAUUNXPG (CDMA unexpected page response) A register for OM group CAUCPSYS that counts when a page response is received bye the CPN and the CPN is not expecting the message.

CAW Common Aerial Working.

CAVATTS A register for the wireless OM group AUTHCAV that counts in the CM when a request to execute CAVE (received from either the AC or MSC-S) or Diffie-Hellman (received from the AC) has been sent to the CAVU.

CAVE Cellular Authentication and Voice Encryption algorithm.

CAUVDSCD (CAU software versioning discarded) A register for OM group CAUCPSYS that counts when a version mismatch occurs on an incoming message to the CAU. (Version mismatch happens only during software upgrades)

CAVFRC A register for the wireless OM group AUTHCAV that counts in the CM when CAVE/ Diffie-Hellman execution has failed with a bad return code.

CAVFRS A register for the wireless OM group AUTHCAV that counts in the CM when CAVE/ Diffie-Hellman execution has failed due to a resource problem.

2001-8.0-RFM03-0302 Glossary 52

CAVFTIME A register for the wireless OM group AUTHCAV that counts in the CM when CAVE/ Diffie-Hellman execution has failed due to a timeout error.

CAVREQUC A register for the wireless OM group AUTHCAV that counts in the CM when a request to execute CAVE is received from AC or MSC-S for unique challenge process- ing.

CAUVRJCT (CAU rejected message) A register for OM group CAUCPSYS that counts when a version mismatch occurs and an incoming message and a reject message is sent. (Version mismatch happens only during software upgrades)

CAVRQBSC A register for the wireless OM group AUTHCAV that counts in the CM when a request to execute CAVE is received from AC or MSC-S for base station change processing.

CAVRQSSD A register for the wireless OM group AUTHCAV that counts in when the AC receives a request to execute CAVE for SSD update processing. This OM is always set to zero in MTX08 since SSD update process executes CAVE in CM.

CAVSUCC A register for the wireless OM group AUTHCAV that counts in the CM when CAVE/ Diffie-Hellman is executed successfully without any reported errors or timeouts.

CAVU Cellular Authentication and Voice privacy Unit.

CB Conference Bridge.

CBH See Call Busy Hour.

CBK See OM group CBK..

CBKCNT (Code block group count) A register for OM group CBK that counts calls that are blocked by the NWM CBK control.

CBKPASS (Code block group pass) A register for OM group CBK that counts calls that are passed by the NWM CBK control.

CBWV Call Busy Work Volume. The total time logged by operators in a specific team handling calls. It is measured in tenths of seconds and reported in seconds. CBWV is measured at position release and is associated with the queue for the defined period and reported in the ending period.

C & C Computers & Communications.

CC 1. Collect Call 2. Computer Center. 3. Common Control. 4. Central Control

CCBOVFL (call condense block overflow) A register for OM group CP that counts originating messages that are lost because no idle call condense blocks (CCB) are available to which they can be assigned.

CCBSZ (Call Condense Block Seizures) A register for OM group CP that is incremented when a call condense block is allocated to an originating call.

CCH 1. Connections per Circuit per Hour. 2. Control Channel.

CCHMSG (Control Channel Messages) A register for wireless OM group ICPCP that pegs when

2001-8.0-RFM03-0302 Glossary 53

a message is received by the control channel (CCH).

CCHMWOA (Control Channel Message Waiting Order Attempts) A register for wireless OM group ICPCP that pegs when the switch attempts to send an IS-54 Rev. B message waiting order to a subscriber unit over the CCH.

CCHMWOC1 (Control Channel Message Waiting Order Completions First Attempt) A register for wireless OM group ICPCP that pegs when a subscriber unit responds on a CCH to the first attempt by the switch to send an IS-54 Rev. B message-waiting order.

CCHMWOCR (Voice Channel Message Waiting Order Completions First Attempt) A register for wireless OM group ICPCP that pegs when a subscriber unit rseponds on a CCH to the first attempt by the switch to send an IS-54 Rev. B message-waiting order.

CCIS Common Channel Interoffice Signaling.

CCITT Consultative Committee on International Telegraph and Telephone.

CCLRCONV A register for OM group CAINTRIG that counts the number of CTR_Clear conversa- tional messages sent by the SSP.

CCPAVAIL (CPU call processing available occupancy) A register for OM group CPUSTAT that accumulates the CPU call processing available occupancies and displays this amount as an integer. Each of these occupancies is the percentage of CPU time that available for call processing in a given time sample. This occupancy is the difference between maximum CPU time available for call processing and the percentage of CPU time in use in a given time sample.

CCR Continuity Check Request.

CCS See Centum Call Seconds.

CCSA Common Control Switching Arrangement.

CCSU Centum Call Seconds of Use or Centum Call Seconds Usage.

CCT See Circuit.

CCVATT (Call covering activation attempts) A register for OM group MWTCAR that counts attempts to activate call covering. The subscriber presses the CCV key to activate call covering. If call covering activates, the following occur. the answering party receives a confirmation tone, the EMW lamp on the set of the called party turns on, or the system saves the directory number of the calling party in a message against the line of the called party.

CCVFAIL (Call covering activation failures) A register for OM group MWTCAR that counts attempts to activate call covering that failed because of feature restrictions. This count includes attempts to activate call covering when the following occurs: the answering party presses the CCV key when the incoming call is not a direct call; the primary part of the MADN group does not have EMW assigned; the calling party and the MADN group are not in the same customer group family; the answering party is not a secondary member of the MADN group.

CCVOVFL (Call covering activation failures) A register for OM group MWTCAR that counts attempts to activate call covering that failed because of feature restrictions. This count includes attempts to activate call covering when the following occurs: the answering party presses the CCV key when the incoming call is not a direct call; the

2001-8.0-RFM03-0302 Glossary 54

primary part of the MADN group does not have EMW assigned; the calling party and the MADN group are not in the same customer group family; the answering party is not a secondary member of the MADN group.

CCWGRANT A register for OM group CALLWAIT that counts successful attempts by members of a given customer group to inhibit call waiting. CCWGRANT counts the attempts to inhibit call waiting for the duration of a call.

CD Circuit Description.

CDACTS See OM group CDACTS.

CDEFLECT Call Deflected. Incremented each time the QMS CAM deflects a call because no agent is immediately available to serve the call and the projected wait time exceeds the maximum limit. This wait time (CDTIME) is datafilled for the particular queue in table QMSCQDEF. POSRQSTD = CQUEUED + GOTPOSIM + CDEFLECT + COVFLMAX + COVFLNCQ + CQDENIED

CDF Combined Distribution Frame.

CDO See Community Dial Office.

CDS Call Dial Seconds.

CED Common Equipment Diagnostic.

CEMF Counter Electromotive Force.

centers, toll switching The hierarchy of centers which make up the control switching points of the North American long distance dialing network. They are (in order of importance): Class 1 Regional Centers; Class 2 Sectional Centers; and Class 3 Primary Centers. They receive calls from, and switch calls to, the lower class offices in the hierarchy. These are: Class 4C Toll Center; Class 4P Toll Point; and Class 5 End Office.

central office A switching unit in a telephone system which provides service to customers in a geographical territory, having the necessary equipment and operations arrangements for terminating and interconnecting subscriber lines and trunks or trunks only. There may be more than one central office in a building.

central processing unit (CPU) Electronic components which cause processing on a computer to occur by interpreting instructions, performing calculations, moving data in main computer storage, and controlling input/output operations. It consists of the arithmetic-logic unit and the control unit.

centralized automatic reporting on trunks (CAROT) A system for automatically reporting faults identified on toll trunk circuits.

Centralized Message Data System (CMDS) A mechanized (computer) system designed to provide message characteristics and point-to- point detail of the public switched network usage.

CENTREX (Central Telecommunications Exchange) Centralized PBX for large users. Permits incoming calls to reach the called party without the involvement of the PBX attendant.

centronics interface A standard format for parallel data transmission to and from microcomputer equip-

2001-8.0-RFM03-0302 Glossary 55

ment, especially printers (originally used on Centronics printers).

Centum Call Seconds A measurement of traffic usage, CCS means 100 call seconds. A load measurement of 20 CCS may represent one event lasting 2000 seconds, 20 consecutive events on the same facility averaging 100 seconds in length, or one event on each of a group of 20 facilities averaging 100 seconds each, or any other possible combination.

CEO Conforming End Office.

CF Call Forwarding.

CF6MBU (CF6P manual busy usage) A usage register for OM group CF6P that records the number of conference circuits in any of the following states during the last OM transfer period: manual busy, seized, busy because of network management proce- dures.

CF6OVFL (CF6P overflow) A register for OM group CF6P that counts calls that cannot locate enough conference bridges.

CF6P See OM group CF6P.

CF6QABAN (CF6P queue abandons) A usage register for OM group CF6P counts calls abandoned while waiting in queue for the system to connect the calls to a conference circuit.

CF6QOCC (CF6P queue occupancy) A usage register for OM group CF6P that records (every 10 seconds) if requests are in queue for the system to assign a conference circuit. The queue consists of waiting service analysis and trunk test position requests only.

CF6QOVFL (CF6P queue overflow) A register for OM group CF6P that counts requests for a conferecne circuit that encounter a circuit queue full condition.

CF6SBU (CF6P system busy usage) A usage register for OM group CF6P that records if conference circuits are in one of the following states: remote busy, peripheral module busy, system busy, carrier fail, unloaded.

CF6SZRS (CF6P seizures) A register for OM group CF6P that counts calls that seize a confer- ence circuit.

CF6TRU (CF6P traffic busy usage) A usage register for OM group CF6P that records if the conference circuits are in the following states: call processing busy, call processing busy unload, lockout.

CFMT Confirmation Tone.

CFRA See OM group CFRA.

CFRAATT (Call Forward Remote Access Attempts) A register for OM group CFRA that counts the number of times a subscriber attempts to use the CFRA feature. To use the CFRA feature, the subscriber can dial a direct inward system access (DISA) directory number with the CFRA option. The subscriber can dial the CFRA activation code to use the CFRA feature.

CFRADENY (Call Forward Remote Access Denied) A register for OM group CFRA that counts the number of times the following conditions prevent the use of the (CFRA) feature: personal identification number (PIN) is not correct, feature code is not correct, or forward to number is not correct; like 911, 0, or a number that does not translate.

2001-8.0-RFM03-0302 Glossary 56

CFRAFAIL (Call Forward Remote Access Failures) A register for OM group CFRA that counts the number of times the following events prevent access to the call forward remote access to the (CFRA) feature. The number of retries of directory number (DN), personal identification number (PIN), feature access code, or ‘forward’ to numbers exceeds the maximum. Register CFRAFAIL also counts errors that the system cannot recover like missing entries for CUSTSTN or AUTHPART. The caller receives NACK treatment.

CFRAHWOV (Call Forward Remote Access hardware resources overflow) A register for OM group CFRA that counts the number of times not enough hardware resources prevents the use of the CFRA feature. The caller receives NOSR treatment.

CFRALIMT (Call Forward Remote Access Limit) A register for OM group CFRA that counts the number of times the CFRA feature cannot operate when the maximum number of subscribers use the CFRA feature. The caller receives NOSR treatment. The system defines the number of concurrent users by office parameter MAX_PROGRAMMERS in table OFCENG.

CFRASWOV (Call Forward Remote Access software resources overflow) A register for OM group CFRA that counts the number of times not enough software resources prevents the use of the CFRA. The caller receives NOSR treatment.

CFWA Call Forwarding Activation.

CFWD Calls Forwarded.

CH Call Hour.

channel A path through a carrier or microwave system that will provide for talking, pulsing and supervision.

channels, communication The lines or data links over which data is transmitted including standard telephone lines, coaxial cables, microwave transmission, satellite, and fiber optics.

character A letter, number, or special character.

check, parity Method of checking that a transmitted digital signal has been correctly received: an extra bit is added to the coded information bits to make the total number of 1’s odd (for an odd parity scheme). If the received total is incorrect, an automatic request is made for retransmission.

chip Tiny piece of silicon embedded with many electronic circuits. Chips are the building blocks of a computer and perform various functions, such as doing arith- metic, serving as the computer’s memory, or controlling other chips.

CICS Customer Information Control System (IBM).

CIDF Combined Intermediate and Distributing Frame.

CIF Controlled Interflow calls.

CIFR A register for OM group CAINTRIG that counts the number of Conversational Connect_To_Resource messages received from the SCP.

CIFRSC A register for OM group CAINMSGS that counts the number of Call_Info_From_Resource messages sent (on a per switch basis) to the SCP.

2001-8.0-RFM03-0302 Glossary 57

CINITC (Calls lost cold restart) A register for OM group CP that counts call condense blocks that were in use at the time of a cold restart. This count is equal to the number of calls that were in progress and lost because of the cold restart. circuit The complete electrical path between terminals over which telecommunications are provided. A circuit must contain a power source, such as a battery or a generator. Electrons will flow from the negative power supply terminal through a conducting medium (such as copper wire) to the positive power supply terminal. A useful circuit must also contain some sort of switch to determine whether or not it will be on, and some device that has resistance, known as the load. circuit, duplex A circuit which allows simultaneous independent communications in both directions. circuit grade The information-carrying capability of a circuit in terms of speed or signal type. circuit mileage or miles The route miles of revenue producing circuits in service, determined by measuring the length, in terms of miles, of the actual path followed by the transmission medium. circumflex The ASCII character “^” is sometimes called a circumflex.

CIS See Computer Information System.

CITR A register for OM group CAINTRIG that counts the number of Call_Info_To_Resource messages received by the SCP.

CITRSC A register for OM group CITRSC that counts the number of CTR_Clear conversational messages sent by the SSP.

CKO Checking Operator (for operator number identification ONI).

CKT MI Circuit Miles.

CLRARTRIG (conditional logging and reporting triggers) A register for OM group CAUCPSYS that counts when a conditional trigger message is sent from CPN to SBS SEC. class of office A rank assigned to switching offices in the telephone network, assigned according to its switching functions, its relationship to other switching offices and transmis- sions requirements. class-of-service code A single digit numeric code used to identify the type of service assigned to specific originating or terminating equipment groups, such as flat rate, coin, etc.

Class 1 office A regional toll center; the highest level toll office in the North American switching hierarchy. There are ten such offices in the U.S. and two in Canada; together they form the basic upper level network for long distance traffic in North America. The network, including lower level toll offices, is programmed to handle calls in a systematic and economical way, with alternate routes provided when the first choice is busy. Long distance calls entering the network will automatically climb the switching hierarchy in search of an idle circuit. If the most direct route is busy, the call speeds up the hierarchy to the next switching center and the next in a fraction of a second until it finds a path to complete the call. In this process the Class 1 office is the “court of last resort,” the highest level to which the search can be carried.

Class 2 office A sectional toll center; the second level toll office in North America, of which there are 55 in the U.S. and 10 in Canada.

2001-8.0-RFM03-0302 Glossary 58

Class 3 office A primary outlet in the North American long distance switching hierarchy.

Class 4C office A toll center in the North American long distance switching hierarchy.

Class 4P office A toll point in the North American long distance switching hierarchy.

Class 5 office An end office; a local central office or exchange in the North American hierarchy.

CLB Controlled Link Blocking

CLC See Connector Lost Call.

CLGF Calling Code Failures.

CLK Clock.

clockwise Moving from left to right.

CLOSES A register for OM group CAINMSGS that counts the number of Close messages sent to the SCP.

CLOSER A register for OM group CAINMSGR that counts the number of Close messages the switch receives from the SCP.

CLR Combined Line & Recording Trunk.

CM 1. Channel Termination. 2. Computing Module

CMATT (Call memory activation attempts) A register for OM group MWTCAR that counts attempts to activate call memory. To activate call memory, the subscriber presses the LVM key of the EMW key. If call memory activates, the called party receives a confirmation tone. The system connects the called party and the calling party. The EMW lamp on the set of the called party turns on. The system saves the directory number of the caller in a message against the line of the called party.

CMDS Centralized Message Data System.

CMFAIL (Call memory activation failures) A register for OM group MWTCAR that counts attempts to activate call memory that fail because of feature restrictions. This count includes attempts to activate call memory when: the called party presses the LWM key or the EMW key when the incoming call is not a direct call; the base station does not have EMW assigned; or the calling party and the base station are not in the same customer group family.

CMM Circuit Minute Miles.

CMOS RAM A special kind of low-power memory that stores information about the configuration of an IBM PC AT or PS/2. It is operated by a battery so that it does not go blank when the machine is turned off.

CMOVFL (Call memory software resources overflow) A register for OM group MWTCAR that counts call memory attempts that fail because of a lack of FTRQ 8 word permanent (FTRQ8WPERMS) blocks. Parameter FTRQ8WPERMS in table OFCENG specifies the number of FTRQ 8 word permanent blocks.

CMRADSIR (CMR ADSI Requests) A register for OM group CNDXPM that records the maximum number of ADSI modem requests handled at the same time by the CMR during the

2001-8.0-RFM03-0302 Glossary 59

last OM reporting period. The maximum number of ASDI sessions allowed is ten.

CMRBCLDR (CMR BCLID Requests) A register for OM group CNDXPM that records the maximum number of BCLID modem requests handled at the same time by the CMR during the last OM reporting period. The maximum number of ASDI sessions allowed is ten.

CMRCNDRQ (CMR CND Requests) A register for OM group CNDXPM that records the maximum number of CND modem requests handled at the same time by the CMR during the last OM reporting period.

CMRFASTQ (CMR Fast Queue Elements) A register for OM group CNDXPM that records the maximum number of Fast Queue Elements used at the same time by the CMR. The CMR uses these elements during the last OM reporting period. The FAST queue is the CMR internal queue for all functions except the diagnostics.

CMRMODEM (CMR Modems) A register for OM group CNDXPM that records the maximum number of CMR modems used at the same tiem by the CMR during the last OM reporting period. Each CMR card contains 32 modems.

CMRRINGD (CMR Ring Detectors) A register for OM group CNDXPM that records the maximum number of CMR ring detectors used at the same time b y the CMR during the last OM reporting period. Each CMR card contains 32-ring detectors.

CMRSHRAM (CMR Share RAM Messages) A register for OM group CNDXPM that records the maximum number of messages in the shared RAM interface of the CMR at the same time during the last OM reporting period. The maximum number of messages from the SP to the CMR at the same time is 64.

CMRTIMRQ (CMR Timer Requests) A register for OM group CNDXPM that records the maximum number of CMR timer queue elements used at the same time by the CMR at the same time during the last OM reporting period. The maximum number of timer queues that the system can use at the same time is 64.

CMWIACT (Call memory software resources) A register for OM group MWTCAR that counts call memory attempts that fail because of a lack of FTRQ 8 word permanent (FTRQ8WPERMS) blocks. Parameter FTRQ8WPERMS in table OFCENG specifies the number of FTRQ 8 word permanent blocks.

CMWIDACT (CMWI deactivations) A register for OM group MWTCAR that counts attempts to deactivate CLASS message waiting indicator (CMWI) on the set.

CMWINACK (CMWI negative acknowledgements) A register for OM group MWTCAR that counts attempts CLASS message waiting indicator (CMWI) messages that the system cannot transmit correctly. The system cannot transmit the messages correctly because of a timeout of failure message from the peripheral module.

CMWISW (CMWI no software resources) A register for OM group MWTCAR that counts CLASS message waiting indicator (CMWI) requests that are discarded because there are not enough software resources in the central control (CC).

CMWITRMS (CMWI no retransmissions) A register for OM group MWTCAR that counts CLASS message waiting indicator (CMWI) the system discards because the number of retransmission reaches the maximum.

CMWIUNAV (CMWI unavailable) A register for OM group MWTCAR that counts CLASS message waiting indicator (CMWI) the system discards because the CLASS modem resource card is not available.

2001-8.0-RFM03-0302 Glossary 60

CMWRACT (CMWIRING activations) A register for OM group MWTCAR that counts attempts to ENABLE the ringing aspect of the CLASS message waiiting indicator (CMWI) feature. To activate the ringing aspect, the subscriber dials the CMWRING feature activation codes.

CMWRDACT (CMWIRING deactivations) A register for OM group MWTCAR that counts attempts to disable the ringing aspect of the CLASS message waiting indicator (CMWI) feature. To disable the ringing aspect, the subscriber dials the CMWRING feature deactivation codes.

CMWRDNAC (CMWIRING activation failures) A register for OM group MWTCAR that counts attempts that did not enable the ringing aspect of the CMWI feature. To enable the ringing aspect, the subscriber dials the CMWIRING feature activation code.

CMWRDNDA (CMWIRING deactivations failures) A register for OM group MWTCAR that counts attempts that did not disable the ringing aspect of the CMWI feature. To disable the ringing aspect, the subscriber dials the CMWIRING feature release code.

CN Called Number.

CNA Conceptual Network Architecture.

CNAB See OM group CNAB.

CNABATT (CNAB attempts) A register for OM group CNAB that counts the number of times the CNAB or CNND feature access code is dialed. This count includes successful and unsuccessful attempts to activate the feature.

CNABDENY (CNAB denial) A register for OM group CNAB that counts the number of CNAB common attempts denied because the SO option DENYCNAB is in effect. The ISDN lines do not use this register.

CNABFDEN (CNAB feature access denied) A register for OM group CNAB that counts when the system denies CNAB or CNND feature activation for any of the following reasons: a.) the CNAB line option (or the CIDSDLV option for ISDN subscribers) is not assigned to the subscriber b.) the CNAB (or CNDB for ISDN) customer group option is not assigned to the subscriber c.) the system denies a universal access attempt because the corresponding SO option DENY is on the line. This line does not apply to ISDN d.) CNDB is not enabled for the office and the subscriber has the CIDSDLV line option e.) the CNAB line option is assigned but is not enabled for the office.

CNABSACT (CNAB successful activations) A register for OM group CNAB that increases when any of the following happen: a.) the system correctly activates the CNAB or CNND feature b.) when a subscriber with an unsuppressed default name status is successful in suppressing the name through CNAB activation c.) when a subscriber with a sup- pressed name status activates CNAB. The activation of CNAB unsuppresses the name for the call d.) when an ISDN subscriber activates CIDSDLV with an access code.

CNABUNIV (CNAB universal) A register for OM group CNAB that counts the number of common access attempts for the CNAB, CNND, and CIDSDLV features.

CNAMD See OM group CNAMD.

CNAMDEL (Calling name delivered) A register for OM group CNAMD that is increased every time the system delivers the calling name to a CNAMD subscriber.

2001-8.0-RFM03-0302 Glossary 61

CNAMODEL (Calling name out-of-area delivered) A register for OM group CNAMD that increases every time the calling name is unavailable. Also, the system has to send the Out-of- Area name indication (O) to the subscriber’s customer premises equipment.

CNAMPDEL (Calling name privacy indicator delivered) A register for OM group CNAMD that increases every time the system determines the calling name to be private. The system also has to determine whether to send the private name indication (P) to the subscriber’s customer premises equipment.

CNBDENY (Calling Number Blocking Denial) A register for OM group CNDB that counts the number of CNB common attempts denied because the SO option DENYCNB is active. Register CNBDENY does not apply to ISDN sets.

CND Calling Number Delivery. See also OM group CND.

CNDACT (CND SUSP activation) A register for OM group CND that counts when a subscriber dials the activation code for CLASS SUSP display features. A count in this register does not mean that the display feature was correctly activates.

CNDATTS (CND Attempts) A register for OM group CNDXPM that records the total number of CND attempts during the last OM reporting period.

CNDB Calling Number Delivery Blocking. See also OM group CNDB for extended definition and field names.

CNDBATT (CNDB attempts) A register for OM group CNDB that counts when a subscriber dials the access code for CNDB, CNB, or CNNB. Increases in register CNDBATT do not indicate successful CNDB activation. The system increases register CNDBATT when an ISDN subscriber activates CIDSSUP with the access code.

CNDBDENY (CNDB denial) A register for OM group CNDB that counts the number of CNDB common access attempts denied. The system denies the CNDB common access attempts when the SO option DENYCNDB is in active. This register does not apply to ISDN sets.

CNDBFDEN (CNDB feature access denied) A register for OM group CNDB that increases when the system cannot activate CNDB, CNB, or CNNB for any of the following reasons: a.) the CNDB or CIDSSUP ISDN option is not available on the line or customer group b.) CNDB in table RESOFC is not enabled for the office c.) the system makes a common access attempt and line has the associated DENY option. The system routes the call to FNAL treatment.

CNDBOVFL (CNDB overflow) A register for OM group CNDB that is incremented when CNDB or CIDSSUP cannot be activated because software resources such as feature data blocks required for CNDB are busy or unavailable. The call is routed to NOSR treatment. CNDBOVFL is not incremented on the DMS-100G switch.

CNDBSUP (CNDB suppression) A register for OM group CNDB that increases when the follow- ing two conditions occur. The system must correctly activate CNDB and suppress the number of the originating caller.

CNDBUNIV (CNDB universal access) A register for OM group CNDB that counts the number of CNDB, CNB, CNNB, and CIDSSUP universal access attempts.

CNDBUSUP (CNDB unsuppressed) A register for OM group CNDB that counts when the number of the originating caller can appear on a display. The display is on the equipment of the terminating party for a call on a line with CNDB. The system also increases this

2001-8.0-RFM03-0302 Glossary 62

register when the system suppresses the number of the originating caller. The system suppresses the number even though the originating subscriber attempts to allow the DN to appear on a display. The display is on the equipment of the terminating party for the call. This condition can occur if you set suppression at the office level in table NETNAMES. Register CNDBUSUP does not apply to ISDN lines because ISDN does not support the CNDB toggle feature is not supported with ISDN.

CNDCDEL (CND coin phone delivery) A register for OM group CND that counts when the DMS- 100 does not send the CND as a result of a call from a coin telephone. The DMS-100 sends the indicator ‘C’ to the subscriber.

CNDCDEL2 An extension register for CNDCDEL.

CNDCOMP (CND Completions) A register for OM group CNDXPM that records the total number of CND completions during the last OM reporting period.

CNDDACT (CND SUSP release) A register for OM group CND that counts when a subscriber dials the deactivation code for CLASS SUSP display features.

CNDDNDEL (CND DN delivery) A register for OM group CND that increases for CLASS lines when the system delivers a ten-digit DN as: a.) a calling number in a single data CND message b.) the CLID parameter in a multiple data message. This register does not include P (private) or O (not available) delivered as a calling number. This register increases once for each calling number that CND delivers to ISDN sets.

CNDDNDEL2 An extension register for CNDDNDEL.

CNDEANS (CND Early Answer) A register for OM group CNDXPM that increases when the system cannot deliver a calling number because the CND subscriber answered a call before the calling information. This failure of delivery occurs when the caller answers before the end of the first ring.

CNDFDNA (CND SUSP feature denial on activation) A register for OM group CND that increases when a subscriber dials the activation code for CND SUSP but the system denies access. The system denies access if the CLASS or ISDN display feature is not available on the line. The system also denies access if the CLASS display feature is not acti- vated for the office in table RESOFC. The system routes the call to feature not allowed (FNAL) treatment.

CNDFDND (CND SUSP feature denial on release) A register for OM group CND that increases when a subscriber dials the release code for CND SUSP but the system denies access. The system denies access if a.) the CLASS or ISDN display feature is not available on the line, or b.) if the CLASS display feature is not activated for the office in table RESOFC. The system routes the call to feature not allowed (FNAL) treatment. If CND SUSP is not accessed because the denied termination or MADN options are on the line, the call is routed to negative NACK treatment.

CNDMSG (CND XMS-based peripheral module OM message) A register for OM group CNDXPM that increases when the system transfers CNDXPM OM data to the CC.

CNDNOMDM (CND no modem resource available) A register for OM group CNDXPM that increases when the CND fails because modem resources are not available on the CLASS modem resource (CMR) card. The CMR card is in the XPM that supports the line in use. This register isn’t pegged if the CMR card is BSY, in that case the call is treated as a non-CND call.

CNDNOMON (CND no ringing monitor available) A register for OM group CNDXPM that increases

2001-8.0-RFM03-0302 Glossary 63

when CND fails because ringing monitors are not available on the CMR card. The CMR card is in the XPM that supports the line in use.

CNDOABND (CND originator abandon) A register for OM group CNDXPM that increases when the system does not deliver a calling number because the calling party abandoned the call before the first ring.

CNDODEL (CND outside area number delivery) A register for OM group CND that increases when the calling information delivered to a subscriber is O (for outside area) in a single data message. This register also increases when O appears in parameter REASON_FOR_ABSENCE_OF_DN in a multiple data message. If multiple data messaging is used, the called party is outside the area defined for CND. This register increases when the calling number is out-of-area for ISDN sets assigned the CND feature. The ISDN set displays outside call for both not known and private calls.

CNDODEL2 An extension register for CNDODEL.

CNDOVFL (CND SUSP overflow) A register for OM group CND that is incremented when a CLASS or ISDN CND SUSP display feature cannot be activated or deactivated because of insufficient software resources. The call is routed to no software resources (NOSR) treatment. CNDOVFL is not incremented on the DMS-100G switch.

CNDPDEL (CND private number delivery) A register for OM group CND that increases when a private (P) message delivers to a subscriber. The register also increases when P appears in parameter REASON_FOR_ABSENCE_OF_DN in a multiple data message. When the register increases, the called party has the Calling Number Delivery Blocking (CNDB) feature. This register increases when the calling number is private when the system assigns CND to an ISDN set. The system sends an out-of-area indication to the customer premises equipment (CPE).

CNDPDEL2 An extension register for CNDPDEL.

CNDSDEL (CND service interaction delivery) A register for OM group CND that increases when the DMS-100 does not send the CND as a result of a service interaction. The DMS- 100 sends the indicator ‘S’ to the subscriber.

CNDSDEL2 An extension register for CNDSDEL.

CNDUNAVL (CND unavailable) A register for OM group CND that increases when the system does not deliver calling information because a CLASS Modem Resource (CMR) card is not available. This register does not apply to ISDN sets because ISDN does not use the CMR.

CNDXPM CND info for XPMs. See also OM group CNDXPM for an extended description and field names.

CNF Conference Circuit Diagnostic.

CNFG Configuration Record DMO.

CNFMBU (CF3P Manual Busy Usage) A usage register for OM group CF3P that records the number of conference circuits that are in any of the following states during the last OM period: manual busy, seized, or network management procedures. This register scans the conference circuits every 10 seconds.

CNFMBUT (CF3P Manual Busy Usage in a TOPS environment) A usage register for OM group CF3P for TOPS that records the number of conference circuits that are in any of the

2001-8.0-RFM03-0302 Glossary 64

following states during the last OM period: manual busy, seized, or network managemnet procedures. This register scans the conference circuits every 10 sec- onds.

CNFOVFL (CF3P overflows) A register for OM group CF3P that increases when the system cannot satisfy a request for a three-port conference circuit immediately because conference circuits are busy. Three way calling attempts fail and the system routes the calls to treatment. Service analysis and trunk test position requests attempt to queue.

CNFOVFLT (CF3P overflows in the TOPS environment) A register for OM group CF3P that counts requests for three-port conference circuits in a TOPS environment that the system can not satisfy immediately. The system can not satisfy the requests because conference circuits are busy. Three way calling attempts fail and the system routes the calls to a treatment. Service analysis and trunk test position requests attempt to queue.

CNFQBAN (CF3P queue abandons) A register for OM group CF3P that counts circuit requests abandoned while the requests wait in the conference circuit queue.

CNFQBNT (CF3P queue abandons in a TOPS environment) A register for OM group CF3P for TOPS that counts circuit requests abandoned while the requests wait in the confer- ence circuit queue.

CNFQOCC (CF3P queue occupancy) A usage register for OM group CF3P that counts the calls in queue for conference circuits, which consist of waiting service analysis and trunk test position requests only. The system scans conference circuits every 10 seconds to check the queue occupancy.

CNFQOCCT (CF3P queue occupancy in a TOPS environment) A usage register for OM group CF3P for TOPS that counts the calls in queue for conference circuits, which consist of waiting service analysis and trunk test position requests only. The system scans conference circuits every 10 seconds to check the queue occupancy.

CNFQOVFL (CF3P queue overflows in a TOPS environment) A register for OM group CF3P that counts attempts to enter the wait queue when the queue is full. Only requests from trunk test or service analysis positions increase this register. Other requests do not attempt to wait.

CNFQOVFT (CF3P queue overflows in a TOPS environment) A register for OM group CF3P for TOPS that counts attempts to enter the wait queue when the queue is full. Only requests from trunk test or service analysis positions increase this register. Other requests do not attempt to wait.

CNFSBUT (CF3P system busy usage in a TOPS environment) A usage register for OM group CF3P for TOPS. Conference circuits are scanned every 10 seconds to record in CNFQSBU the number ofcircuits that are remote busy, peripheral module busy, system busy, carrier failed, or unloaded. A conference request originating in the system can place the conference circuits in these states.

CNFSZRS (CF3P seizures) A register for OM group CF3P that counts how many times the system assigns a circuit in response to a request. The system assigns the circuit before an attempt to set up network paths to the three ports.

CNFSZRST (CF3P seizures in a TOPS environment) A register for OM group CF3P that counts how many times the system assigns a circuit in response to a request. The system assigns the circuit before an attempt to set up network paths to the three ports.

2001-8.0-RFM03-0302 Glossary 65

CNFTRU (CF3P traffic busy usage) A usage register for OM group CF3P that records if the conference circuits are call processing busy, deloaded, or locked out.

CNFTRUT (CF3P traffic busy usage in a TOPS environment) A usage register for OM group CF3P for TOPS that records if the conference circuits are call processing busy, deloaded, or locked out.

CNMDEL (Calling name delivered) A register for OM group CND that is set to zero. This register is not supported on the DMS 100G switch. Register CNAMDEL in OM group CNAMD increases in its place.

CNMDEL2 An extension register of CNMDEL.

CNMDODEL (Calling name out-of-area indication delivered) A register for OM group CND that is zeroed. This register is not supported on the DMS 100G switch. Register CNAMODEL in OM group CNAMD increases in its place.

CNMDPDEL (Calling name private indication delivered) A register for OM group CND that is set to zero. Register CNAMPDEL in OM group CNAMD increases in its place.

CNMNDEL (Calling name and number delivered) A register for OM group CND that is set to zero. Register NANUMDEL in OM group CNAMD increases in its place.

CNMNDEL2 An extension register of CNMNDEL.

CNMUNAV2 An extension register of CNMUNAVL.

CNMUNAVL (Calling name unavailable) A register for OM group CND that is set to zero. Registers CNAMODEL and CNAMPDEL in OM group CNAMD increase in its place.

CNNBDENY (Calling name and number blocking denial) A register for OM group CNDB that counts the number of CNNB universal attempts denied because the SO option DENYCNNB is active. Register CNNBDENY does not apply to ISDN sets.

CNNBSUP (Calling name and number blocking suppression) A register for OM group CNDB that counts when CNNB suppresses the name and number of the originating caller. The system suppresses the DN of the originating caller that does not have an associated name. The system increases this register CNNBSUP for ISDN sets when CIDSSUP correctly suppresses a name and DN option.

CNNDDENY (CNAB denial) A register for OM group CNAB that counts the number of CNND common access attempts the system denies because the SO option DENYCNND is in effect. The ISDN lines do not use this register.

CNNDSDEL (CNAB successful delivery) A register for OM group CNAB that counts the times the name or number or both are delivered. The delivery occurs after the system activates CNND or CIDSDLV for an intranodal call to a terminator with CLASS number delivery. This register increases when an ISDN subscriber activates CIDSDLV under these conditions.

CNOT Coin Overtime.

CNTL Control Equipment.

CO 1. Central Office. 2. Channel Origination (Stromberg-Carlson). coaxial cable Consists of a single conductor surrounded by insulation and a conductive shield. The

2001-8.0-RFM03-0302 Glossary 66

shield prevents the cable from picking up or emitting electrical noise.

COCOTs Customer Owned Coin Operated Telephones.

code 1. Representation of data or instructions in symbolic form. 2. Any system of communication in which arbitrary groups of symbols represent units of plain text.

code, access Digits that must be dialed in order to gain access to a particular circuit or facility.

COE Centra Office Equipment.

coefficient The term applied to the constant number by which other numbers are multiplied.

COLLECT The number of collect calls received by the TOPS VSN. This number is incremented each time a collect call is received by the TOPS VSN for: collect only, prison, and 11 selection. This register does not peg overseas collect calls.

COLLINFO A register for OM group CAINMSGR that counts the number of Collect_Information messages received by the SSP.

COM Computer Output Microfilm.

command 1. Instruction to a computer. 2. In data transmission, an instruction sent by the primary station instructing the secondary station to perform some specific function.

common control Describes an automatic telephone system in which the dial pulses from the calling telephone are registered, analyzed, and resent in the form of a routing code to operate switches as required to establish the desired connection.

communications A process by which information is exchanged between individuals through the use of a commonly accepted set of symbols.

communications protocol A set of communication rules that provide for error checking between devices and ensure that transmitted data are not lost.

communications software Programs that allow computers to communicate through a modem. Some communi- cations programs are capable of automatic telecommunications, such as sending and receiving information.

Community Dial Office (CDO) A small automatic central office, located and sized to serve a small community. Usually unattended and often having trunks to only one other office.

community of interest The relationship of calling rates between two areas due to special interests.

compatible Two devices are compatible if they can work together. For example, two computers are said to be compatible if they can run the same program.

compile Translate symbolic language into machine language.

compiler A program that translates symbolic language into machine language.

completed call A call which has been switched through on an established path and conversation has begun. In telephone traffic usage, completed does not mean the end of the call.

completion ratio (CR) The number of revenue producing messages divided by the number of attempts required to produce those messages.

2001-8.0-RFM03-0302 Glossary 67

compression efficiency Total bits received divided by total bits compressed. computer Electronic device capable of accepting data, performing operations on the data, solving problems, and supplying the results of these operations. The distinguishing feature of a computer is its ability to store its own instructions. This ability makes it possible for a computer to perform many operations without the need for a person to type in new instructions each time. Modern computers contain high-speed elec- tronic components that enable them to perform thousands of operations each second. computer information system A coordinated collection of hardware, software, data, people, and support resources to perform an integrated series of functions that can include processing, storage, input, and output. computer network A complex consisting of two or more interconnected computer systems, terminals, and communication facilities. computer operator An individual skilled in the operation of the computer and associated peripheral devices. computer phobia The fear of computers, especially an inordinate amount of fear. computer program A series of instructions which direct the computer to perform a sequence of tasks that produce a desired output. computer security The preservation of computing resources against abuse or unauthorized use, espe- cially the protection of data from accidental or deliberate damage, disclosure, or modification. computer system The actual computer hardware, which consists of the processor unit, operator console, input devices, output devices, and auxiliary storage devices. concatenation The operation of joining two (or more) character strings together, end to end. concentrating unit (TWX) An arrangement of central office equipment wherein traffic over a number of TWX circuits is automatically concentrated onto a lesser number of circuits between the concentrating unit and its associated TWX switching office. concentrator 1. A device or circuit used to combine various operations into a smaller number of circuits or operations. 2. Allows a number of slow-speed devices to utilize a single high-speed communications line.

Conf Conference.

CON2RSRC A register for OM group CON2RSRC that counts the number of Connect_To_Resource messages received by the SSP.

CONFIG In MS-DOS, the file CONFIG.SYS contains information about the machine configura- tion, including the type of keyboard (if not the standard U.S. model) and the amount of memory to be set aside for disk buffers. CONFIG.SYS is read only when the machine boots up. configuration 1. An assembly of machines and programs that operate as a system. 2. The design or layout of the elements in a hardware or information processing system.

2001-8.0-RFM03-0302 Glossary 68

conforming end office An office that has all the necessary capabilities to support equal access.

CONGEST (Congestion signals) A register for OM group TRK that counts congestion signals received on the outgoing number 5 or number 6 trunk group. This register generates only in office types OFF300 and OFF200300.

CONGENTR (Number of times entering congestion) A register for OM group ISGOVLD that counts the times an ISG enters a congested state.

CONGEXIT (Number of times leaving congestion) A register for OM group ISGOVLD that counts the number of times that an ISG leaves a congested state.

CONGTIE (Congestion Time) A register for OM group ISGOVLD that counts the seconds an ISG remains in a congested state.

CONNECT (Successful connections) A register for OM group TRK that counts outgoing seizure attempts on the trunk group that appear to result in successful connection. Register CONNECT increases before the system knows if the seizure is successful. The count reduces by 1 (decreases) if an indication of glare or seize failure is received. This register generates for all correct office types. For office type OFF300, this register decreases on number 5 trunks, number 6 trunks and number 7 trunks.

connection time 1. The time required by switching equipment to connect the calling line to the called line, measured in seconds from the time the last digit is dialed until the first ring of the called number. 2. In time sharing, the length of time you are “on” the com- puter.

connector 1. The last switch in a step-by-step switch train which connects the calling party to the called party’s station. 2. In CCITT specification description language, a connector is either an in-connector or an out-connector. Flow is always assumed to be from the out-connector to its associated in-connector.

connector lost call The condition of an attempt being made to reach a connector switch when all the connectors in the group are busy.

connector number The number given to each type of statistics calculated for information.

connector peg count Where calls end.

connector switch, combination Those connectors that have access from both the local and incoming special toll trains. (These switches are no longer required due to elimination of flash busy.)

connector switch, local Those connectors that are only accessible through the local switch train.

connector terminal Connector bank terminal affiliated with a subscriber’s station.

console The part of a computer system that enables individual attendants to communicate with the system.

constant Item of data which does not vary in value.

constellation pattern The set of all possible signal points generated by a modem.

contiguous Adjacent or adjoining.

CONTINUE A register for OM group CAINMSGR that counts the number of Continue messages

2001-8.0-RFM03-0302 Glossary 69

the switch receives from the SCP. continuity The flow of a signal from one cable end to the other. control, line load Selective denial of call origination capability to specified subscribers’ lines when excessive demands for service are offered to a switching center. Normally, a central office is divided into three groups of lines and control is rotated, with one or two groups being denied outward service at a time. control break A point during program processing at which some special processing event takes place. control character A character whose occurrence in a particular context initiates, modifies, or stops an action that affects the recording, processing, or interpretation of data.

Control (Ctrl) key A special key on the left-hand side of many computer keyboards. When it is pressed in conjunction with another key, it gives the other key a new meaning that depends on the program in use. control unit That part of the central processing unit that directs and coordinates the entire computer system. convergence The bringing together of previously separate technologies, such as telephone and computer technology. conversation time Normally equal to call duration in fully automatic service. conversational operation The transmission of data between a video display terminal (VDT) and a computer in which data travels one character at a time. coprocessor A separate circuit inside a computer that adds additional functions to the CPU (central processing unit) or handles extra work while the CPU is doing something else. copy Reproduce data from one storage device onto another, leaving the source data unchanged. cord One or more conductors used to patch, connect, or access a circuit temporarily or for a period of time. core Core storage is the main memory of a computer. The term comes from the dough- nut-shaped magnetic cores used as memory devices during the late 1950’s and early 1960’s

CORECALL (Camp-on recall) A register for OM group IBNSG that counts camp-on recalls that an attendant answers. corridor traffic An exemption from the MFJ Rules governing the provision of interstate inter-LATA service that continues a portion of the privileged business serving arrangements between (a) New Jersey and New York, and (b) New Jersey and Pennsylvania.

COT Customer Originated Trace. See OM group COT for extended description and field names.

COTATT (COT access attempts) A register for OM group COT that counts the number of times subscriber dials the access code for the COT feature. Increases in register COTATT do not indicate that COT activated successfully.

2001-8.0-RFM03-0302 Glossary 70

COTBDIN (COT bad digit input for two-level activation) A register for OM group COT that counts when a subscriber enters a wrong digit for COT two-level activation. Register COTBDIN also increases when digit collection time out occurs too many times. The LN_PERM_SIG_TIME in table OFCENG defines the Digit collection time out value. In either condition, the subscriber receives NACK treatment.

COTCMPL (COT complete traces) A register for OM group COT that counts the number of completed traces.

COTDENY 1. (COT universal access denial) A register for OM group COT that increases when the system denies the subscriber universal access to the COT feature. This is because the DENYCOT option is active. 2. (COT requests denied) A register for OM group DSPRMAN.

COTFAIL (COT failed for the CCS7 trunk) A register for OM group DSPRMAN that counts the CCS7 COT failures seen for trunks on each SPM node. These events are reported by the DSP application running on the RM. They are pegged on the active CEM of each SPM.

COTFDEN (COT feature denied) A register for OM group COT that counts each time a subscriber cannot activate the COT feature.

COTHI (High-water-mark for COT allocations from the COT pool) A register for OM group DSPRMAN that counts the highest number of COT resources allocated from the node-level pool during a collection/transfer period. Its value starts at zero at the beginning of each collection/transfer period for the node. An update occurs when there is a new high-water-mark in the collection period. This occurs when the total number of resources allocated from the COT pool exceeds the previous high-water- mark for the pool.

COTINCM (COT incomplete traces) A register for OM group COT that counts the number of times the system generates a partial trace.

COTLOW (COT low-water-mark threshold violations on the mode-level COT pool) A register for OM group DSPRMAN that counts the low-water-mark threshold violations on the SPM node-level pool of COT resources since the last collection period. Crossing the threshold once indicates a potential for resource exhaustion on the node. Crossing the threshold more than once in a collection period indicates the user (call process- ing) is operating around the threshold for extended periods.

COTLOST (COT resources lost) A register for OM group DSPRMAN that counts the COT re- sources taken away from or lost by resource management users (such as call process- ing).

COTOPTO (COT opt out of two-level activation) A register for OM group COT that counts the number of times a subscriber terminates a phone call. The termination avoids activation of two-level COT.

COTOVFL (COT software resource overflow) A register for OM group COT that counts the number of times a subscriber cannot activate the COT feature. The subscriber cannot activate COT feature because not enough feature data blocks (FDB) or an incoming memory block (ICMB) is on the line. The caller receives NOSR treatment.

COTPFLR (COT prompt failure in two-level activation) A register for OM group COT that counts the number of times two-level activation of COT fails. Two-level activation of COT fails because of a failure of the utilities that collect digits during interruptible an-

2001-8.0-RFM03-0302 Glossary 71

nouncements. A failure can occur because universal tone receivers (UTR), receiver service circuits (RCVR), or ports are not available. If the failure occurs for one of these reasons, the system routes the call to NOSC treatment. If COT fails because feature data blocks (FDB) are not available, the call receives NOSR treatment. If COT fails because connections are not available, the system routes the call to NBLH treatment.

COTPRCD (COT proceed with two-level activation) A register for OM group COT that increases when a subscriber dials 1 to continue two-level activation of COT.

COTUNIV (COT universal access attempts) A register for OM group COT that counts the number of times a universal subscriber attempts to access COT.

COTUTIL (Percent utilization of COT resources) A register for OM group DSPRMAN that calculates the percentage of the total COT resources in the node-level pool allocated to users of resource management (such as call processing). COTUTIL is the average percentage utilization for all scan periods during a collection/transfer period. COTUTIL does not indicate the total number in use at the end of a scan or transfer period. count, usage 1. A count of the number of times a circuit tests busy. If tested every 100 seconds, the count will approximate the CCS figure for the route. 2. Total number of times an instruction is performed. counter Device used to represent the number of occurrences of an event.

COVFLMAX Call Overflowed. Incremented each time the QMS CAM deflects a call because no agent is immediately available to serve the call and the number of calls in that particular queue exceeds the maximum limit. This limit (MAXSIZE) is datafilled for the particular queue in table QMSCQDEF. POSRQSTD = CQUEUED + GOTPOSIM + CDEFLECT + COVFLMAX + COVFLNCQ + CQDENIED

COVFLNCQ Call Overflowed; No Call Queue Elements. Incremented each time the QMS CAM deflects a call because no agent is immediately available to serve the call and the call queuing elements are exhausted for the entire application. This value (CQELEMS) is datafilled for the particular TOPS application in table QAPLNDEF. POSRQSTD = CQUEUED + GOTPOSIM + CDEFLECT + COVFLMAX + COVFLNCQ + CQDENIED

CP Call processing software resources. See also OM group CP for expanded definition and list of fields.

CPE Customer Premises Equipment.

CPLBOOVF (long origination denials) A register for OM group CP that counts long originations that were denied to reserve long buffers for long progress messages.

CPLOOVFL (call processing letters overflow originating calls) A register for OM group CP that counts originating messages that could not be passed to call processing using a CP letter because the number of letters available did not exceed the number reserved for calls in progress. If this register is pegged, the CPU is overloaded. The calling capacity has temporarily been exceeded because of a very high busy hour.

CPLOSZ (Call Processing Letters Originating Seizure calls) A register for OM group CP that counts origination messages that are successfully attached to a call condense block.

CPLPOVFL (Call Processing Letters Overflow existing calls) A register for OM group CP tthat counts attempts to send a progress message to an existing call that fail because no CP letters are available. If this register is pegged, the CPU is overloaded and the

2001-8.0-RFM03-0302 Glossary 72

calling capacity had been temporarily exceeded because of a very high busy hour.

CPLSZ (Call Process Letters Seizures existing calls) A register for OM group CP that counts calls that fail during call processing because unexpected results were detected during call processing. CPR Continuing Property Record.

CPS Characters Per Second.

CPSAUXCP (CPU status auxiliary call processing occupancy) A register for OM group CPUSTAT that accumulates the CPU auxiliary call processing occupancies and displays this amount as an integer. Each of these occupancies is the percentage of CPU time spent on the simplified-message desk interface (SMDI) incoming message handler pro- cesses. The system measures these occupancies in a given time sample. These processes are the processes in the auxiliary call processing scheduler class.

CPSBKG (CPU status background occupancy) A register for OM group CPUSTAT that accumu- lates the CPU background occupancies and displays this amount as an integer. Each of these occupancies is the percentage of CPU time spent on processes related to: the log system, audits, non-critical system maintenance, non-guaranteed MAP, and operational measurements.

CPSCPOCC (CPU status call processing occupancy) A register for OM group CPUSTAT that accumulates the CPU call processing occupancies and displays this amount as an integer. Each of these occupancies is the percentage of CPU time spent on call processing-related processes in a given time sample. These processes are processes in the following scheduler classes: high-priority call processing, normal call processing, or deferrable call processing.

CPSDNC (CPU status dynamic network controller occupancy) A register for OM group CPUSTAT that accumulates the CPU dynamic network controller (DNC) occupancies and displays this amount as an integer. Each of these occupancies is percentage of CPU time spent on Network Operations System (NOS) processes that communicate with a DNC. The system measures the occupancies in a given sample. These are the processes in the NOS file transfer scheduler classes.

CPSFORE (CPU status front occupancy) A register for OM group CPUSTAT that accumulates the CPU front occupancies displays this amount as an integer. Each of these occupancies is the percentage of CPU time spent on system operations-related processes in a given time sample. These processes are processes in the system and system tools scheduler classes. These scheduler classes were earlier known as system7 and system6, in the sequence given.

CPSGTERM (CPU status guaranteed terminal occupancy) A register for OM group CPUSTAT that accumulates the CPU guaranteed terminal occupancies and displays this amount as an integer. Each of these occupancies is percentage of CPU time spent on guaranteed MAP terminals, guaranteed log devices, and the login process. The system measures those occupancies in a given time sample. These are processes in the guaranteed terminal scheduler class, earlier known as guaranteed background. Guaranteed terminal occupancy is at the cost of call processing.

CPSIDLE (CPU status idler occupancy) A register for OM group CPUSTAT that accumulates the CPU idler occupancies and displays this amount as an integer. Each of these occu- pancies is the percentage of CPU time spent on the idler process, memory checksums, and call processing audits. The system measures these occupancies in a given time sample. These are processes in the idler scheduler class, earlier known as system 0.

2001-8.0-RFM03-0302 Glossary 73

CPSMAINT (CPU status maintenance occupancy) A register for OM group CPUSTAT that accumu- lates the CPU maintenance occupancies and displays this amount as an integer. Each of these occupancies is the percentage of CPU time spent on critical system mainte- nance processes in a given one time sample. These are processes in the maintenance scheduler class.

CPSNETM (CPU status maintenance class) A register for OM group CPUSTAT that accumulates the CPU network maintenance occupancies and displays this amount as an integer. Each of these occupancies is the percentage of CPU time spent on network mainte- nance processes in a given time sample. These are processes in the network mainte- nance scheduler class.

CPSOM (CPU status operational measurements occupancy) A register for OM group CPUSTAT that accumulates the CPU operational measurements (OM) occupancies and amount as an integer. Each of these occupancies is the percentage of CPU time spent on OM processes in a given time sample. These are processes in the guaranteed and not guaranteed OM scheduler classes.

CPSSCHED (CPU status scheduler occupancy) A register for OM group CPUSTAT that accumu- lates the CPU scheduler occupancies and displays this amount as an integer. Each of these occupancies is the percentage of CPU time the scheduler spends in a given time sample.

CPSSNIP (CPU status of SuperNode internet protocol class) A register for OM group CPUSTAT that measures the CPU use of the SuperNode internet protocol (SNIP) scheduler class on SuperNode cores. This register does not apply to BRISC SuperNode cores.

CPSUIC (Call Process Suicide) A register for OM group CP that counts calls that fail during call processing because unexpected results were detected during call processing.

CPSZ (Call Process Seizures) A register for OM group CP that counts when a call process is activated. This can occur several times per call.

CPTRAP (Call Process Trap) A register for OM group CP that counts calls that fail during call processing because the call processing unit hardware detected illegal software conditions.

CPU Central Processing Unit.

CPUSTAT Call processing unit status. See also OM group CPUSTAT for expanded definition and list of fields.

CQAQATT Call Queue Profile Agent Queue Search Attempts. CQAQATT is incremented each time the application’s call queue profile agent queues are searched for an idle agent. CQAQSRCH / CQAQATT = average number of calls queue profile agent queues searched

CQAQATT2 Extension register of CQAQATT.

CQAQDEPT Call Queue Profile Agent Queue Search Depth. CQAQDEPT records the depth to which the call queue profile agent queue is searched before an idle agent is found. CQAQDEPT / CQAQSRCH = average depth to which an application’s call queue profile agent queue is searched

CQAQDEP2 Extension register of CQAQDEPT.

2001-8.0-RFM03-0302 Glossary 74

CQAQSRCH Call Queue Profile Agent Queue Searches. CQAQSRCH counts the number of call queue profile agent queues that are searched (not including any search of the priority agent queue), before an idle agent is found to serve the call. CCQAQDEPT / CQAQSRCH = average depth to which an application’s call queue profile agent queue is searched QAQSRCH / CQAQATT = average number of calls queue profile agent queues searched

CQAQSRC2 Extension register of CQAQSRCH.

CQDENIED Call Queuing Denied. Incremented each time the QMS CAM deflects a call because no agent is immediately available to serve the call and the QMS CAM is unable to queue the call. POSRQSTD = CQUEUED + GOTPOSIM + CDEFLECT + COVFLMAX + COVFLNCQ + CQDENIED

CQELHIGH Call Queue Elements High-Water Mark. CQELHIGH records the maximum number of call queue elements (for the entire application) that are in simultaneous use during the preceding OM transfer period (15 or 30 min.). To predict peak usage accurately, high-water marks should be gathered for the busiest hours, of the busiest days of the year (following either the High-Day Busy Hour or the Extreme Value Engineering provisioning concept). This data should then be used to calculate and adjust the provisioning of call queue elements, so that they are never more than approximately 80% utilized during the busiest times.

At the beginning of each transfer period, the active register is initialized to the number of call queue elements that are currently in use. The active register is up- dated continuously throughout the transfer period whenever the number of call queue elements, currently in use, exceeds the previously recorded value.

At the end of the transfer period (15 or 30 min.), the active register value is trans- ferred to the holding register (CQELHIGH) where it is retained without change until it is over-written at the end of the next transfer period. True peak utilization can be predicted by taking the maximum value of all the high- water marks observed, during individual transfer periods, during the busiest days of the year. An additional amount should be added to this value to ensure that the target 80% peak utilization of software resources is not exceeded, even during the busiest times. The calculated value is datafilled in the application’s entry for field CQELEMS in table QAPLNDEF.

CQOV CAMA Queue Overflow.

CQSCONS Call Queues Considered. CQSCONS counts the number of call queues that are considered when an application’s call queue profile agent becomes available, before either a call is selected, or the agent is idled due to the list of call queues in the profile becoming exhausted. CQSCONS / CQSRCATT = average number of callqueues searched when a call queue profile agent became available

CQSCONS2 Extension register of CQSCONS.

CQSRCATT Call Queue Search Attempts. CQSRCATT is incremented each time an application’s call queue profile agent becomes available to handle a call, and the call queues in the agent’s call queue profile are searched for a call that the agent can serve. CQSCONS / CQSRCATT = average number of callqueues searched when a call queue profile agent became available

CQSRCAT2 Extension register of CQSRCATT.

2001-8.0-RFM03-0302 Glossary 75

CQUELHIGH (Call queue elements high-water mark) A register for OM group QMSDATA that counts the maximum number of call queue elements for the complete application that are in one in use. At one time, the call queue elements are in use during the preceding OM transfer period, which lasts 15 to 30 mins. To predict use, gather high-water marks for the busiest hours, of the busiest days of the year. These time periods must follow the High-Day Busy Hour or the Extreme Value Engineering supply. Use this data to calculate and adjust the supply of call queue elements. The elements cannot be more than 80% used during the busiest times. At the beginning of each transfer period, the system initializes the active register to the number of call queue elements in use. The system continuously updates the active register in the transfer period. The updates occur when the number of call queue elements in use exceeds the recorded value before. At the end of the 15 or 30 min transfer period, the system transfers the active register value to the holding register (CQELHIGH). The system retains the active register value without change until the system overwrites the active register when the next transfer period ends. The system takes the maximum value of all the high-water marks observed. The system observes these high-water marks during each transfer period on the most busiest days of the year. Add an additional amount to this value to make sure the application of software resources does not exceed the objective 80% peak. Entries for the calculated value appear in the entry of the application for field CQELEMS in table QAPLNDEF.

CQUEUED Call Queued. Incremented each time the QMS CAM queues a call for an operator position because no agent is immediately available to serve the call. POSRQSTD = CQUEUED + GOTPOSIM + CDEFLECT + COVFLMAX + COVFLNCQ + CQDENIED

CQUEUED2 Extension register of CQUEUED

CR 1. See Completion Ratio. 2. Custom Route Treatment (Stromberg-Carlson). 3. See Carriage Return. crash Hardware or software malfunction causing a computer system to become inoper- able. A well-designed operating system contains protection against inappropriate input, so that a user’s program will not be able to cause a system crash.

CRC Cyclic Redundancy Checking.

CREQUEUE Call Requeued.Incremented each time the QMS CAM places a call in queue for an operator position after the call was previously deflected. crossbar switch A switch having a plurality of vertical and horizontal paths, and electro-magnetically- operated mechanical means of interconnecting any one of the vertical paths with any of the horizontal paths.

CRT Cathode Ray Tube. A computer video display terminal (not suitable for ordinary TV reception).

CR-TKT Credit Refund Ticket.

CSCWDACT (Cancel spontaneous call waiting identification (CSCWID) activation attempt) A register for OM group CND that increases when a subscriber dials the code that activates CSCWID for the current call. This register does not apply to ISDN sets. This register is not supported on the DMS 100G switch.

CSLCAA (C-side link allocation attempts) A register for OM group XPMLINK that increases when the network attempts to allocate a channel to the XPM.

2001-8.0-RFM03-0302 Glossary 76

CSLBLK (C-side link blockage) A register for OM group XPMLINK that increases for each failed attempt to allocate a channel between the network and the XPM.

CSLCBU (C-side link call busy usage) A register for OM group XPMLINK that records the time that C-side links are busy because of call processing. It records the time in CSS.

CSLMU (C-side link maintenance busy use) A register for OM group XPMLINK that records the time in CCS that the C-side links are not available for call processing.

CSMA-CD(CA) Carrier Sense Multiple Access local area network with Collision Detection/Collision Avoidance.

CSR Composite Station Rate.

CSR INT Composite Station Rate Interstate.

CSR ST Composite Station Rate State.

CST Carrier power Supply, Transistorized.

CSU Channel Service Unit.

CTAQATT Controlled Traffic Agent Queue Search Attempts. CTAQATT is incremented each time an application’s controlled traffic agent queue is searched for an idle agent. CTAQDEPT / CTAQATT = average depth to which the application’s controlled traffic agent queue is searched.

CTAQATT2 Extension register of CTAQATT.

CTAQDEPT Controlled Traffic Agent Queue Search Depth. CTAQDEPT records the depth to which the controlled traffic agent queue is searched before an idle agent is found. CTAQDEPT / CTAQATT = average depth to which the application’s controlled traffic agent queue is searched.

CTAQDEP2 Extension register of CTAQDEPT.

CTCATTS (CDMA test call attempts) A register for OM group CAUCPSYS that counts when a test call is attempted (by either BSM or a mobile); pegged on a system-wide basis.

CTCOMPS (CDMA test call completions) A register for OM group CAUCPSYS that counts when a test call is successfully set up; pegged on a system-wide basis.

CTCPGTO (CDMA test page timeouts) A register for OM group CAUCPSYS that counts when the second page request for a test call times out; pegged on a system-wide basis.

CTCOTHFL (CDMA test other failures) A register for OM group CAUCPSYS that counts any of the following occur: a.) CPN times out waiting for setup conversation or setup and wait for answer from TCA during call setup for a test call b.) CPN receives a release message from TCA during call setup for a test call c.) CPN receives a release message from mobile during call setup for a test call d.) CPN receives a duplicate page re- sponse for a test call e.) CPN receives an unexpected page response for a test call.

CTI Centralized Ticket Investigation.

CTO Conversation Time Only.

CTRCLR (CTR_Clear Messages) A register for OM group CAINMSGS that counts the number

2001-8.0-RFM03-0302 Glossary 77

of CTR_Clear messages sent by the SSP.

CTRCONV A register for OM group CAINTRIG that counts the number of Conversational Connect_To_Resource Messages sent from the SCP.

Ctrl Control.

CTS Clear To Send signal (RS-232).

CTSP Continental Telephone System Practice. cursor 1. The flashing block on the screen showing where the pointer is. 2. In computer graphics, a movable marker that is used to indicate a position on a display. 3. A movable spot of light on the screen of a display device, usually indicating where the next character is to be entered, replaced, or deleted. cursor control Ability to move a video display prompt character to any position on the screen, under either keyboard or software command. cursor movement Moving the cursor up, down, right or left on the screen. Many computers have cursor movement (arrow) keys that allow you to move the cursor vertically or horizontally around the screen. This ability is essential for text-editing purposes such as word processing. customer(s) Any individual, partnership, association, joint- stock company, trust, corporation, governmental entity, or other entity that subscribes to the services offered under the ECA Tariff FCC No. 1, including both interexchange carriers (ICs) and end users (EUs). cut straight Permanent association between line and connector terminal.

C & W Cable & Wireless.

CW 1. Call Waiting. 2. Time calls waited in queue to reach an operator. Measured in tenths of seconds and reported in seconds (rounded to the nearest whole second.) Reported for each call queue.

CWAA Call Waiting Attempts Answered.

CWAT Call Waiting Attempts.

CWDABDN A register for OM group CALLWAIT that counts when the calling party abandons a call after the called party has heard the call waiting indicator tone.

CWDATT A register for OM group CALLWAIT that counts attempts by the calling party to use call wait. The calling party dials the call waiting access code to use call wait.

CWDEXMPT A register for OM group CALLWAIT that counts attempts by the calling party to use call waiting. The calling party dials the access code to use call waiting. The attempt fails because the called party activated the call waiting exempt option.

CWDFAIL A register for OM group CALLWAIT that counts failed attempts by the calling party to use call waiting. The calling party dials the access code to use call waiting. The attempts fail because of feature interactions.

CWINQU (Calls waiting in queue) A usage register (10 s scan rate) for OM group IBNSG that counts the number of calls in the customer subgroup that wait in the attendant

2001-8.0-RFM03-0302 Glossary 78

queue for a free attendant console. The register also records calls that are abandoned while the call waits in the queue.

CWOABDN A register for OM group CALLWAIT that counts when the calling party goes on-hook after the called party has heard the call waiting indicator tone.

CWOATT A register for OM group CALLWAIT that counts attempts by the calling party to use call waiting.

CWOEXMPT A register for OM group CALLWAIT that counts failed attempts by the calling party to use call waiting. Attempts by the calling party fail because the called party has the call waiting exempt (CWX) option.

CWOFAIL A register for OM group CALLWAIT that counts attempts by the calling party to use call waiting that fail because of feature interactions.

CWOOVFL A register for OM group CALLWAIT that counts failed attempts by the calling party to use call waiting. These attempts fail as a result of a lack of insufficient software resources. The calling party use the call wait originator feature, or by dials the call wait access code to use call waiting.

CWRECALL (Call waiting recall) A register for OM group IBNSG that counts attendant-answered recalls from attendant-extended calls to busy stations with the call waiting feature. The register increases when the attendant does not answer the calls within a specified time.

CWRCL A register for OM group CALLWAIT that increases when a called party goes on-hook while a call is waiting, and the calling party is recalled.

CWT Call Waiting Tone.

CWTABDN A register for OM group CALLWAIT that counts when the calling party goes on-hook after notification that a call is waiting. The called party has the call waiting option.

CWTCATT A register for OM group CALLWAIT that increases when an attempt is made to activate the CWTC feature. The register increases when the end user presses 3 within the digit detection time period.

CWTCCONF A register for OM group CALLWAIT that counts when a CWTC request results in a three-way conference.

CWTCINV A register for OM group CALLWAIT that counts invalid attempts to activate the CWTC feature. The register increases if the end user presses a digit different from 3.

CWTCPPU A register for OM group CALLWAIT that counts pay-per-use successful attempts of the CWTC feature.

CWTFAIL A register for OM group CALLWAIT that counts attempts to have calls wait that fail because of feature interactions. The called party has the call waiting option.

CWTTATT A register for OM group CALLWAIT that counts the attempts of a called party to use call waiting. This register also applies to electronic business sets with the call waiting feature.

CWTTOVFL A register for OM group CALLWAIT that counts failed attempts by the called party to use call waiting. These attempts fail because of a lack of software resources.

2001-8.0-RFM03-0302 Glossary 79

CVAKEYCK A register for the wireless OM group AUTHCAV that counts when a request to execute CAVE is received from the AC for generating check digits for a given A-key. This OM is always set to zero in MTX08 since the CAVE is executed in CM.

CVRQORIG A register for the wireless OM group AUTHCAV that counts when a request to execute CAVE is received from AC or MSC-S for mobile origination.

CVRQREQ A register for the wireless OM group AUTHCAV that counts when a request to execute CAVE is received from AC or MSC-S for mobile registration.

CVRQTERM A register for the wireless OM group AUTHCAV that counts in the CM when a request to execute CAVE is received from AC or MSC-S for the case of a mobile termination. This OM was defined in MTX06, but is now pegged by this feature.

CX Channel Bi-directional.

CXR Carrier. cybernetics The study of the theory of control systems. It includes the comparative study of the operations of computers and of the human nervous system.

DA Doesn’t Answer.

DAC 1. Different Area Code. 2. Digital to Analog Converter.

DACS Digital Access and Cross-connect System. daemon In some computer systems, a program that runs continuously, or is activated by a particular event, is called a daemon because it is like a magical servant. The word daemon is Greek for “spirit” or “soul.”

DAHOFF (digital to analog handoff) An analog register for wireless OM group OMMTXHO that counts when a digital-to-analog handoff has been completed for the target subcell. daisy wheel printer An impact printer that uses a plastic or metal disk with printed characters along its edge. The disk rotates until the required character is brought before a hammer that strikes it against a ribbon. daly Daily.

DARECALL (Attendant answered recalls) A register for OM group IBNSG that counts calls that an attendant directs to a station and receives no answer. The system redirects unan- swered calls back to the attendant, and the attendant answers the call. data A representation of facts, concepts, or instructions in a formalized manner suitable for communication, interpretation, and processing by humans or machines. Data is a plural noun, datum is singular—a distinction now generally ignored in data processing terminology. data base file A collection of logically related information or records. data base management The task of storing data in a data base and retrieving information from those data. There are three aspects of data base management: entering data, modifying or updating data, and presenting output reports. In a well-designed data base system, the user needs to know only the nature of the information that is available and the type of questions that must be asked, without having to know about the physical arrangement of the data on a storage medium.

2001-8.0-RFM03-0302 Glossary 80

data base manager A program that allows the individual user to enter, organize, sort, and retrieve information.

data communications 1. The transmission of data from one location to another using communication channels such as telephone lines, coaxial cables, microwaves, or other means. 2. The entire process and science of enabling digital devices, such as computers, to communicate with each other.

data communications equipment The equipment (such as a modems and communications processors) used to establish and transfer data from one device to another.

data entry The process of preparing data in some machine- processing form or entering data directly into a computer system.

data file A collection of related data records that have been organized in a specific manner and held in a data base.

data manipulation The process of using language commands to add, delete, modify, or retrieve data in a file or data base.

data mode The state of data circuit-terminating equipment when connected to a communication channel but not in a talk or dial mode.

data movement time The time taken to transfer data to or from a disk once the read/write head is properly positioned on a disk track.

data packet A means of transmitting serial data in an efficient package that includes an error checking sequence. data processing Operations performed on data to provide useful information to users.

data rate The rate at which a channel carries data, measured in bauds (bits per second).

data record 1. A collection of data fields pertaining to a particular subject. 2. Part of a data file.

data set A device that converts the signals of business machines to signals that are suitable for transmission over telecommunication circuits and vice versa. A modem is sometimes called a data set.

data stream The serial data that is transmitted through a channel from a single input/output operation.

data structure The structure of relationships among files in a data base and among data items within each file.

data transfer operations Operations that move data, whether externally through data communication channels or within the main computer storage, by copying from one location to another.

data transfer rate The rate of transfer of data from one place to another, such as from computer main memory to disk or from one computer’s memory to another computer’s memory.

data validation Measures taken to ensure that data fields conform to desired specifications. Fields may be checked for inappropriate characters or for deviation from specified lengths or values.

2001-8.0-RFM03-0302 Glossary 81 day to busy hour ratio The ratio of the 24-hour day traffic volume to the busy hour traffic volume. day to day variation The amount of variance in traffic load that occurs from one day to another during a period of time, usually a week. dB Abbreviation for decibel. The standard unit for expressing transmission gain or loss and relative power ratios.

DC Direct Current.

DCCHMWOA (DCCH message waiting order attempts) A register for OM group DCCICPCP that pegs when the DMS-MTX system attempts to send a message waiting order to a mobile over the DCCH.

DCCPGRES (DCCH page responses) A register for OM group DCCICPCP that pegs the number of page responses received bye the ICP. It is useful for verifying the reverse paging rate.

DCCMBORG (DCCH mobile origination) A register for OM group DCCICPCP that pegs the number of times mobile stations request services accessing the DMS-MTX system over a DCCH.

DCCMSG (DCCH Messages) A register for OM group DCCICPCP that pegs the total number of registrations, page responses, and originations transmitted over the DCCH.

DCCMWOC1 (DCCH Message Waiting Order Completions First Attempt) A register for OM group DCCICPCP that pegs when a mobile responds on a DCCH to the first attempt by the serving DMS-MSTX system to send it a MWI message.

DCCMWOCR (DCCH Message Waiting Order Completions Retry) A register for OM group DCCICPCP that pegs when a mobile responds on a DCCH to a retry attempt by the DMS-MTX system to send it a MWI message.

DCCRMHOF (DCCH Redundancy Maintenance Handoff Failed) A register for OM group DCCICPCP that pegs the number of the mobile maintenance hard handoffs that fail when a DCCH redundancy activation process takes place.

DCD Data Carrier Detector.

DCE See Data Communications Equipment.

DCIWFREL (Data call IWF release) A register for OM group MTXDCALL that counts when a data call fault is caused by inter-working function (IWF) release.

DCM Digital Carrier Module.

DCMOATT (Data call mobile origination attempts) A register for OM group MTXDCALL that counts when an attempt is made by the mobile to originate a data call. This register relates to mobile-to-PSTN and mobile-to-mobile calls.

DCMOCOM (Data call mobile originations completed) A register for OM group MTXDCALL that counts when a data call originated by a mobile is successfully set up. This register relates to mobile-to-PSTN and mobile-to-mobile calls.

DCMTATT (Data call mobile termination attempts) A register for OM group MTXDCALL that counts when the mobile attempts termination of a data call. The register relates to mobile-to-mobile and PSTN-to-mobile calls.

2001-8.0-RFM03-0302 Glossary 82

DCMTCOM (Data call mobile terminations completed) A register for OM group MTXDCALL that counts when the mobile completes termination of a data call.

DCO Digital Central Office.

DCPU10 (DCH CPU occupancy <= 10%) A register for OM group ISGCPU that counts the seconds that the DCH CPU is occupied for less than or equal to 10%. Register DCPU10 divided by DCPUTOT gives the percentage of time an ISG has an average CPU occupancy of 0% to 10%.

DCPU20 (DCH CPU occupancy <= 20%) A register for OM group ISGCPU that counts the seconds that DCH CPU is occupied for more than 10% but less than or equal to 20%. Register DCPU20 divided by DCPUTOT gives the percentage of time an ISG has an average CPU occupancy of 10% to 20%.

DCPU30 (DCH CPU occupancy <= 30%) A register for OM group ISGCPU that counts the seconds that the DCH CPU is occupied for more than 20% but less than or equal to 30%. Register DCPU30 divided by DCPUTOT count gives the percentage of time an ISG has an average CPU occupancy of 20% to 30%.

DCPU40 (DCH CPU occupancy <= 40%) A register for OM group ISGCPU that counts the seconds that the DCH CPU is occupied more than 30% but less than or equal to 40%. Register DCPU40 divided by the DCPUTOT gives the percentage of time an ISG has an average CPU occupancy of 30% to 40%.

DCPU50 (DCH CPU occupancy <= 50%) A register for OM group ISGCPU that counts the seconds that the DCH CPU is occupied for more than 40% but less than or equal to 50%. Register DCPU50 divided by DCPUTOT gives the percentage of time an ISG has an average CPU occupancy of 40% to 50%.

DCPU60 (DCH CPU occupancy <= 60%) A register for OM group ISGCPU that counts the seconds that the DCH CPU is occupied for more than 50% but less than or equal to 60%. Register DCPU60 divided by DCPUTOT gives the percentage of time an ISG has an average CPU occupancy of 50% to 60%.

DCPU70 (DCH CPU occupancy <= 70%) A register for OM group ISGCPU that counts the seconds that the DCH CPU is occupied for more than 60% but less than or equal to 70%. Register DCPU70 divided by DCPUTOT gives the percentage of time an ISG has an average CPU occupancy of 60% to 70%.

DCPU80 (DCH CPU occupancy <= 80%) A register for OM group ISGCPU that counts the seconds that the DCH CPU is occupied for more than 70% but less than or equal to 80%. Register DCPU80 divided by DCPUTOT gives the percentage of time an ISG has an average CPU occupancy of 70% to 80%.

DCPU90 (DCH CPU occupancy <= 90%) A register for OM group ISGCPU that counts the seconds that the DCH CPU is occupied for more than 80% but less than or equal to 90%. Register DCPU90 divided by DCPUTOT gives the percentage of time an ISG has an average CPU occupancy of 80% to 90%.

DCPU100 (DCH CPU occupancy <= 100%) A register for OM group ISGCPU that counts the seconds that the DCH CPU is occupied for more than 90% but less than or equal to 100%. Register DCPU100 count divided by DCPUTOT gives the percentage of time an ISG has an average CPU occupancy of 90% to 100%.

DCPURTR (DCH CPU real time remaining) A register for OM group ISGCPU that counts the seconds that the DCH CPU is available to process additional calls. Register DCPURTR

2001-8.0-RFM03-0302 Glossary 83

divided by DCPUTOT gives the percentage of time an ISG CPU is available to process additional calls.

DCPUTOT (DCH CPU total count) A register for OM group ISGCPU that counts the seconds in the period during which the system counts DCH CPU occupancy.

DD 1. DDD Access: A trunk group which carries customer dialed 7 or 10 digit intertoll calls from a Class 5 end office to a higher class office in the DDD network. Local automatic message accounting equipment (LAMA, SATT, ZR, etc.) is used for recording and timing the call. 2. Dial Tone Delay (Stromberg- Carlson).

DDD See Direct Distance Dialing.

DDHOFF (digital to digital handoff) A digital register for wireless OM group OMMTXHO that counts when a digital-to-digital handoff has been completed for the target subcell.

DDNDEL (DDN delivery) A register for OM group CND that increases when the system delivers calling information in a dialable format. This register does not apply to ISDN sets.

DDNDEL2 An extension register for DDNDEL.

DDNNUNIQ (DDN non-unique) A register for OM group CND that increases when the calling number the system delivers to a DDN subscriber is not different. An example of a non-unique calling number is a line with teen service, also known as secondary directory number. The system delivers the ten-digit DN in the CLID parameter to the DDN subscriber (instead of the DDN parameter). This register does not apply to ISDN sets. This register is not supported on the DMS 100G switch.

DDNTRUNC (DDN truncated) A register for OM group CND that increases when the reverse translations for a calling number delivered to a DDN subscriber are: more than 24 digits long or less than 1 digit long. The system delivers the 10-digit DN in the CLID parameter to the DDN subscriber instead of the DDN parameter. Reverse translations for DDN are entered in tables DNREGION, DNREVXLA, and CUSTNTWK. This register does not apply to ISDN sets.

DDNUNAVL (DDN unavailable) A register for OM group CND that increases when a reverse translator is not entered in table CUSTNTWK for a unique number calling a DDN subscriber. The system delivers the ten-digit DN in the CLID parameter to the DDN subscriber instead of the DDN parameter. Reverse translations for DDN are entered in tables DNREGION, DNREVXLA, and CUSTNTWK. This register does not apply to ISDN sets.

DDS Dataphone Digital Service (Lucent) or Digital Data Service.

DDROPHO (Digital drop handoff) A digital mode register for wireless OM group OMMTX that pegs when a digital verification color code (DVCC) timeout occurs during a handoff. This pegs only during digital-to-digital (not digital-to-analog) handoffs.

DDRPCALS (Dropped calls due to digital SAT fade) A digital mode register for wireless OM group OMMTX that pegs when a call is dropped due to digital supervisory audio tone (SAT) fade. debug To locate, eliminate, and remove all mistakes in a computer program or the malfunc- tions in the computer system itself. decade Group of ten items.

2001-8.0-RFM03-0302 Glossary 84

decatenate To separate into two or more parts.

decibel See dB.

decimal number A number expressed in ordinary base-10 notation, using the digits 0, 1, 2, 3, 4, 5, 6, 7, 8, and 9.

decoder Device used to translate data from one coded format to another.

decoding The capability of a monitor or protocol analyzer to display control characters in character-oriented protocol and bit-oriented protocol data.

decrement Decrease a variable by a specified amount.

decryption Translating information from an unreadable or secret format into a form in which it can be used.

dedicated A piece of hardware is said to be dedicated if it performs only one function.

default A setting, instruction, or data used by a program if no value is entered by the user.

default directory The directory in which the operating system looks for files if no directory is specified.

default drive When a microcomputer is operated under MS-DOS, one of the disk drives is desig- nated as the default drive. Any time the computer executes a command that causes it to use a disk file, it will look for that file on the disk in the default drive unless an explicit drive designator was included with the file name.

default value A default value in a program is usually the most common or safest answer.

DEFLDCA (Network management (NWM) reroute) A register for OM group TRK that counts calls that the system prevents from accessing the trunk group. The system routes the calls to this trunk group. The system denies access by the calls because of the action of network management controls. Register DEFLDCA counts calls that the system denies for the activity of any of the following NWM controls: - SKIP control is in effect - the number of trunks qualified for incoming calls is at or below the directional reservation (DRE) level - the number of idle trunks is at or below the protective reservation (PRE) level for calls that have been alternate-routed to the group - time assignment speech interpolation (TASI) control is in effect - selective trunk reservation (STR) control is in effect - cancel to (CANT) control is in effect - bi-directional trunk group reservation control (BRC) is in effect If the control is SKIP, DRE, PRE, or TASI, the system routes the call. If cancel from (CANF) control is in effect, the system sends the call to treatment. If the control is STR or CANT the system sends the call to treatment. The system this register for all correct office types.

DELAY A register for OM group DTSR that counts the total number of calls with Delay. For LMDP and LMDT lines, register DELAY counts test calls that have one of the follow- ing conditions: Dial tone delay that exceeds 3 seconds. An abandoned call does not affect the count.

delete To erase data from a field or to eliminate a record from a file.

deletion record A new record that will replace or remove an existing record of a master file.

2001-8.0-RFM03-0302 Glossary 85

DEM Dial Equipment Minutes. demand Term used to describe the load created by users. demodulator A device that receives signals transmitted over a communications link and converts them into electrical pulses, or bits, that can serve as inputs to a data processing machine.

DEMT Dial Equipment Minutes Terminating. density The number of characters that can be stored in a given physical space.

DEO Digital End Office. descending order Order that ranges from highest to lowest in numeric value or alphabetically.

DESTFAIL A register for OM group CAINLNP that counts when the release cause Ported_Dest_Failed is received by the switch that performed the query. That release cause is received when the terminating switch could not find the subscriber whose address was in the LNP GAP parameter. development time The time used for debugging new programs or hardware. device or device number 1. A number assigned to a particular peripheral device so the computer can identify it. 2. The device number is determined by the order in which phone numbers are selected in an engineering or holding time study. device driver A program that extends the operating system in order to support a specific device, such as a disk or tape drive or a special graphics display. Device drivers are usually installed by referring to them in the CONFIG.SYS file (see CONFIG).

DFC Disk File Controller.

DGTC Digitone Calls.

DGTDLY A register for OM group DTSRPM that counts the total number of digitone calls with a 3 second dial tone delay. The time between incrementing depends on the office system and network management.

DGTR Digitone Receiver.

DGTS Digitone Dial Tone Speed.

DGTTOT A register for OM group DTSRPM that counts the total number of calls made on Digitone lines. The time between incrementing depends on the office system and network management.

DHCP Acronym for Dynamic Host Configuration Protocol, which offers dynamic configura- tion of IP addresses and related information. DHCP provides safe, reliable, and simple TCP/IP network configuration, prevents address conflicts, and helps conserve the use of IP addresses through centralized management of address allocation.

DHOATTS (Digital Handoff Attempts) A digital mode register for wireless OM group OMMTX that pegs when there is a handoff attempt to a target subcell. This register pegs against the serving subcell when a target subcell is selected and the current mode of the call is digital.

2001-8.0-RFM03-0302 Glossary 86

DHOCOMPS (Digital Handoff Completions) A digital mode register for wireless OM group OMMTX that pegs when a handoff to the target subcell successfully completes or fails. This pegs on all handoffs to a digital traffic channel.

diagnostics diskette Diskette with programs designed to detect and isolate software or hardware faults or the causes of system breakdown.

dial 1. Rotary device on the telephone instrument which makes and breaks the loop to the office to indicate the digit dialed. 2. See dial tone.

dial office An automatic central office or telephone exchange.

dial switching equipment Switching equipment actuated by electrical impulses generated by a dial or key pulsing arrangement.

dial tone A steady signal from a CO or PBX used to inform the caller to start dialing.

Dial Tone Delay (DTD) Time elapsed between the subscriber going off-hook and reception of dial tone.

Dial Tone Line (DTL) The subscriber local loop facilities connecting the end central office to the end user premises.

dial tone speed The average amount of time that it takes for subscribers to reach dial tone in any particular office expressed in seconds.

dialing, intertoll Dialing over trunks between toll centers.

dialing time Time elapsed between the reception of dial tone until the end of dialing by the calling subscriber.

dialog A question-and-answer session between a computer system and a human.

dial-up 1. The process of using a dial or push button telephone to initiate a station-to- station telephone call. 2. The process of calling one computer from another via telephone.

dial-up line The normal switched telephone line that can be used as a transmission medium for data communications.

dial-up modem A modem designed to operate within a bps range (0 to 9600) that is effective in transmitting data via voice- grade telephone lines, and that uses communications parameters compatible with other dial-up modems and packet switching networks.

DICCHMSG (Digial Control Channel Messages Received) A register for wireless OM group ICPDCP that pegs when an ICP receives a CCH message from a digital-capable subscriber unit.

dibit encoding The process whereby two bits are used to represent one signal change. The four possible combinations for a dibit are 00, 01, 10, and 11.

DID Direct Inward Dialing.

diddle To tamper with data.

digital Referring to or using the binary system.

2001-8.0-RFM03-0302 Glossary 87 digital data transmission The transmission of the original electronic signal produced by a computer device. digital exchange An exchange that switches information in digital form. digital switching A method of switching telephone traffic where the voice signal is encoded into digital form and the individual digital bits of the signal are switched and kept separate from other calls in process by time slot separation.

DIM Dual Integrated Modem.

DINCPGRE (DCCH incorrect page responses) A register for OM group DCCICPCP that pegs the number of incorrect page reponses transmitted over the DCCH. dip switch A DIP switch is a miniature switch or set of switches often used in computer equipment. dir Directory. direct access Pertaining to the process of storing data in, or getting data from, a storage device in such a manner that surrounding data need not be scanned to locate the desired data. Also, the time required to get desired data from the storage device is independent of the location of the data. This method is quicker than sequential access, where each record in the file is read and written in turn. direct access storage device An auxiliary storage device on which data can be stored and retrieved in any order, sequentially or randomly. direct circuit A high usage circuit connecting two toll centers. direct-connect modem A modem that plugs directly into a modular telephone jack for use in data transmis- sion. direct distance dialing (DDD) The facility used to make long distance telephone calls without the assistance of a telephone operator. direct final The last resort trunk group that will carry a call between two offices or tandem offices. direct memory access A method by which data can be transferred to and from memory at a high rate. direct route A direct trunk group between two exchanges with no intermediate switching. directory A partition by software into several distinct files; a directory of these files is main- tained on a device to locate the files. Using directories makes it easier to find programs and data files on a disk. directory assistance Information operator.

Directory Assistance (DA) (Interstate) Provision of telephone numbers by a telephone company operator when the operator location is accessed by dialing Numbering Plan Area (NPA) 555-1212.

DIRETRY (Directed Retry) A register for wireless OM group ICPCP that pegs when a directed retry message is sent by the serving subcell to the CCH in response to origination/ page response message from a subscriber unit when the serving subcell is above a

2001-8.0-RFM03-0302 Glossary 88

programmable threshold of occupancy.

DIS 1. Dial-It-Service. 2. Display.

disable Inhibit or remove a hardware or software feature.

disc Alternate spelling of disk.

DISCNGST (Facility messages discarded due to switch congestion) A register for OM group PRAFAC that counts facility messages that are discarded because of congestion in the DMS.

DISC NO’S Disconnected Numbers.

DISCON A register for OM group CIANMSGR that counts the number of Disconnect messages the switch receives from the SCP.

disconnect A command that causes the connection to be terminated.

discrete Pertaining to data organized in distinct parts.

disk A random access magnetic device used for secondary storage in a computer system. Data stored on a magnetic disk cannot be read as quickly as data stored in the main memory of the computer, but disk storage has larger capacity and is not erased when the computer is turned off.

disk access time The time required to locate a specific track on a disk.

disk controller card A peripheral circuit card that connects disk drives to a computer and controls their operation.

disk crash A condition of a disk unit that makes it unusable. It is usually caused by contact between the read/write head of the disk drive and the surface of the disk.

disk drive A device that enables a computer to read data from, and write data to, disks.

diskette Another name for a floppy disk.

DISNORTX (Facility messages discarded due to no routing translation) A register for OM group PRAFAC that counts facility messages that are discarded because no route list was found in table MSGRTE.

DIS-N-REPORT Dial-It-Service N Report.

DISOSS Distributed Office Support System (IBM).

display Visual presentation of information or data, as on a screen.

display menu An on-screen series of program options that allows the user to choose the next function or course of action to be executed, such as to print the contents of the visual display or to save a graphic display on a disk.

DISRTUNA (Discarded facility messages due to route unavailable) A register for OM group PRAFAC that counts facility messages that are discarded because the D channel route is not available.

DISTBREG (Distance-based registration) A register in wireless OM group OMMTX3 that counts

2001-8.0-RFM03-0302 Glossary 89

when the mobile registration type is distance-based registration. distribution The ability to select appropriate paths to terminating points.

DL Dialed.

DLMKS_D (Digital line module key driven set delay) A register for OM group SITE that counts calls for which dial-tone delays exceed 3 s for key-driven set lines on digital line modules.The system updates this register every 15 min before the OM transfer process.

DLMKS_D2 An extended register of DLMKS_D of OM group SITE.

DLMKS_T (Digital line Module Key Driven Set Total) A register for OM group SITE that counts test calls on key-driven set lines on digital line modules. The system updates this register every 15 min before the OM transfer process.

DLMKS_T2 An extended register of DLMKS_T of OM group SITE.

DMA Direct Memory Access.

DMBLORG (Digital Mobile Originations) A register for wireless OM group ICPDCP that pegs when the serving subcell receives an origination message from a digital-capable subscriber unit.

DMBLORGC (DCCH Mobile Origination Completion) A register for OM group DCCICPCP that pegs the number of calls that originate from a mobile over a DCCH and are successfully placed on VCH.

DMBLTERC (DCCH Mobile Termination Completion) A register for OM group DCCICPCP that pegs the number of calls that terminate to a mobile over a DCCH and are success- fully placed on a VCH.

DMBORACO (Digital Mobile Origination Analog Completions) A register for wireless OM group ICPDCP that pegs when the serving subcell receives from a digital-capable subscriber unit an origination request message that was completed on an analog channel.

DMBORDCO (Digital Mobile Origination Digital Completions) A register for wireless OM group ICPDCP that pegs when the serving subcell receives from a digital-capable subscriber unit an origination request message that was completed on a digital channel.

DMBORIGS (Digital Mobile Originations) A dual mode register for wireless OM group OMMTX that pegs when the switch receives an origination message from a digital-capable subscriber unit.

DMBTRACO (Digital Mobile Termination Analog Completions) A register for wireless OM group ICPDCP that pegs when the serving subcell receives from a digital-capable subscriber unit a page response message that was completed on an analog channel.

DMBTRDCO (Digital Mobile Termination Digital Completions) A register for wireless OM group ICPDCP that pegs when the serving subcell receives from a digital-capable subscriber unit a page response message that was completed on an digital channel.

DMO Data Modification.

DN Directory Number.

2001-8.0-RFM03-0302 Glossary 90

DNH Directory Number Hunt Groups.

DNYBYCCW A register for OM group CALLWAIT that counts denied attempts to use call waiting. The system denies these attempts because the CCW feature is active for the called party.

DOA Dial Office Administration.

DOC See Dynamic Overload Control.

documentation During systems analysis and subsequent programming, the preparation of docu- ments that describe such things as the system, the programs prepared, and the changes made at later dates.

DOD Direct Outward Dialing.

DOF Dial Office Factor.

DOF INST Nonsensitive Dial Office Factor Interstate Nonsensitive.

DOF INST Sensitive Dial Office Factor Interstate Sensitive.

DOF ST Nonsensitive Dial Office Factor State Nonsensitive.

DOF ST Sensitive Dial Office Factor State Sensitive.

DOR See Direct Only Route.

DOS See Disk Operating System.

dot-matrix printer A printer that creates text characters and graphs with a series of closely spaced dots. Some produce dot patterns fine enough to approach the print quality of daisy wheel printers.

double density A double density floppy disk is recorded in a format that puts twice as many bits into a given area as the earlier single density format.

double precision Double precision means that the computer will carry out arithmetic calculations keeping track of twice as many digits as it usually does.

double-sided disk A disk that has magnetic coating on both sides and therefore can have data stored on both sides.

DOWK Day of the Week.

down Not in operation. A condition that exists when the hardware circuits of a computer are inoperable or there is a failure in the software system.

download To download is to transmit a file or program from a central computer to a smaller computer or a computer at a remote site.

downstream In computerized systems, a term meaning the processing that is performed on a stream or file of data at some later time by another system or processor.

DP 1. Data Processing. 2. Dial Pulse.

DPABDN (Dial pulse (DP) abandon) A register for OM group ISDD that increases when an XPM

2001-8.0-RFM03-0302 Glossary 91

detects an on-hook condition on an incoming DP trunk. The XPM detects the condition before the XPM returns a start-to-dial signal. The system abandons the call. Register DPABDN does not count DP immediate call ABDNs.

DPAGRESP (Digital Page Responses) A register for wireless OM group ICPDCP that pegs when the serving subcell receives a page response message from a digital-capable subscriber unit.

DPAGEREQ (DCCH page request) A register for OM group DCCICPCP that pegs the number of page requests received from the CM by the ICP. It is useful for verifying the forward paging rate.

DPATMPT (Dial pulse (DP) attempt) A register for OM group ISDD that increases when the XPM accepts a SEIZ of the DP trunk of an XPM for further processing. Register DPATMPT does not call DP immediate call ATMPTs .

DPC 1. Dial Pulse Call. 2. Data Processing Center. 3. Destination Point Code

DPDELAY (Dial Pulse Delay) A register for OM group SITE that counts DTSR test calls on dial pulse lines that experience one of the following conditions: - dial tone delay that exceeds 3 s - previous DTSR test that is still in progress on the remote line module (RLM)

The system initiates a test on an RLM at each site every 4 s. A high count in this register indicates an extremely high switch use, RLM trouble, or channel blockage.

DPGREXPA (DCCH Page Responses on Expanded Area) A register for OM group DCCICPCP that pegs the number of page responses received on an expanded area page attempt.

DPGRADPA (DCCH Page Responses on ACCHs for Initially DCCHs Page Attempts) A register for OM group DCCICPCP that pegs the number of page responses received on the retry of ACCHs when the mobile had sent the original page request over the DCCH.

DPGRESPA (Digital Page Responses) A digital register for wireless OM group OMMTX that pegs when the switch receives a page response message from a digital-capable subscriber unit.

DPLDLY A register for OM group DTSRPM that counts the total number of dial pulse (DP) calls that are delayed more than 3 seconds.

DPLTOT A register for OM group DTSRPM that counts the total number of calls made on lines with DP signaling during a given period of time.

DPRADPA (DCCH Page Retry on ACCHs for Initially DCCHs Page Attempts) A register for OM group DCCICPCP that pegs the number of retries on ACCHs when the mobile has sent the original page attempt over the DCCH.

DP Register Dial Pulse Register.

DPREXA (DCCH Page Retry on Expanded Area) A register for OM group DCCICPCP that pegs the number of page retries on an expanded area due to no response received in the VMLA area of the IS 136 mobile.

DPS Dial Pulse Dial Tone Speed.

DPSEIZ (Dial pulse (DP) seizure) A register for OM group ISDD that counts when the system seizes a DP trunk of an XPM for an incoming call. The system detects a SEIZ when an

2001-8.0-RFM03-0302 Glossary 92

XPM detects an off-hook condition. The off-hook condition lasts 6 to 9 ms on an idle incoming trunk. Register DPSEIZ does not count DP immediate trunk SEIZs.

DPTDLY (Dial Pulse Trunk Delay) A register for OM group ISDD that increases when one of the following intervals exceeds a preset TDLY threshold: the interval between the SEIZ of an incoming DP call and the return of the start-to-dial signal, the interval between call SEIZ and call ABDN. The default TDLY threshold is 3 s. Register DPTDLY does not count DP immediate calls.

DPTESTC (Dial Pulse Test Calls) A register for OM group SITE that counts DTSR test calls that are on dial pulse lines. Register DPTESTC increases after the system determines the result of the test.

DR 1. Data Rate. 2. Division of Revenue.

drain One of the three connecting terminals of a field-effect transistor, the other two being the Source and the Gate.

DRCW Distinctive Ringing/Call Waiting. See also OM group DRCW for expanded definition and field list.

DRCWACT (DRCW activation) A register in OM group DRCW that counts activations of the DR/ CW feature.

DRCWAUNV (DRCW activation universal) A register in OM group DRCW that counts the number of times a common user activates the DR/CW feature.

DRCWDACT (DRCW deactivation) A register in OM group DRCW that counts releases of the DR/ CW feature.

DRCWDENY (DRCW universal access denials) A register in OM group DRCW that counts the number of times the system denies the DR/CW to a common user. The system denies the feature DR/CW to a common user because the DRCWDENY option is in effect.

DRCWDUNV (DRCW deactivation universal) A register in OM group DRCW that counts the number of times a common user deactivates the DR/CW feature.

DRCWEATT (DRCW editing attempts) A register in OM group DRCW that counts attempts to invoke a DR/CW screen list editing (SLE) session.

DRCWEDEN (DRCW editing denials) A register in OM group DRCW that counts calls that the system denies access to DR/CW screen list editing (SLE). The system denies access because the DR/CW feature is not assigned or is not available. The system routes the call when the feature is not assigned, or is not active in the office. The system routes the call to the feature not allowed (FNAL) treatment.

DRCWEOVF (DRCW editing overflow) A register in OM group DRCW that counts calls that the system denies access to DR/CW screen list editing (SLE). The system denies access because of system failure or not enough resources.

DRCWEUSG (DRCW editing usage) A usage register in OM group DRCW that records if a line uses DR/CW screen list editing (SLE). It has a scan rate is 10 s.

DRCWRING (DRCW ring provided) A usage register in OM group DRCW that counts calls for which the system applies distinctive ringing.

DRCWSAT (DRCW screening attempt) A usage register in OM group DRCW that counts calls

2001-8.0-RFM03-0302 Glossary 93

that the system screens because the DR/CW feature is active.

DRCWSAT2 An extension register of DRCWSAT.

DRCWBLK (DRCW screening blocked) A usage register in OM group DRCW that counts calls that the DR/CW screening list does not screen. The DR/CW screening list does not screen the calls because the screening list is not available.

DRCWSDEN (DRCW screening denials) A usage register in OM group DRCW that counts calls that the DR/CW screening list does not screen. The DR/CW screening list does not screen the calls because the incoming directory number is not available.

DRCWTATT (DRCW tone attempt) A usage register in OM group DRCW that counts attempts to provide distinctive call waiting tone.

DRCWTOVF (DRCW tone overflow) A usage register in OM group DRCW that counts attempts to provide DR/CW tone that fail. The attempts fail because not enough system resources are present. The system routes the call to busy (BUSY) treatment.

DRCWUNIV (DRCW universal access attempts) A usage register in OM group DRCW that counts attempts by a common user to access the DR/CW feature. drive A Disk drive available in a computer system, usually located on the right or top of the computer terminal. If only one disk drive is located in the computer, then it is considered drive A. drive B If the computer has two disk drives, drive B is usually located on the right or bottom of the computer terminal. drive C This is normally the computer’s first hard disk. driver A software driver is a series of instructions the computer follows to reformat data for transfer to and from a particular peripheral device. The electrical and mechanical requirements are different from one kind of device to another, and software drivers are used to standardize the format of data between them and the central processor.

DROPCALL (Dropped Handoff) A dual mode register for wireless OM group OMMTX that counts when an active call is dropped due to loss of supervisory audio tone (SAT) for an analog call or loss of DVCC for a digital call.

DROPHO (Dropped Handoff) A dual mode register for wireless OM group OMMTX that counts when a call is dropped during handoff because the target subcell fails to receive an SAT for an analog call from the digital subscriber unit. This action pegs on the target subcell. dropout A sudden loss in signal level, lasting more than a few milliseconds, and usually caused by noise or system malfunction.

DREU (Directional reservation (DRE) usage) A usage register (100 s scan rate) for OM group that records if DRE activates for a two-way trunk group. The system generates DREU for all correct office types.

DS Denied Service.

DS1CARR DS1 digital carrier maintenance summary. See also OM group DS1CARR for and extended description and field names.

2001-8.0-RFM03-0302 Glossary 94

DS1AIS (DS-1 alarm indication signals) A register for OM group DS1CARR that counts messages the system receives from the PM and indicates that the PM receives an alarm indication signal.

DS1BER (DS-1 bit error rate) A register for OM group DS1CARR that counts messages that the system receives from the PM. The messages indicate that the bit error rate exceeds maintenance or OOS thresholds.

DS1CBU (C-side busy usage) A usage register for OM group DS1CARR that records if the DS-1 carrier is C-side busy. The DS-1 carrier is C-side busy because the C-side PM of the carrier is OOS.

DS1ECF (DS-1 echo canceller failure) A register for OM group DS1CARR that counts the number of echo canceller failures in the DS-1 carrier during a 10 min audit cycle.

DS1ES (DS-1 error seconds) A register for OM group DS1CARR that counts DS-1 error seconds during XMS-based peripheral module (XPM) audits. Table CARRMTC identi- fies error second thresholds.

DS1LCG (DS-1 carrier group alarm) A register for OM group DS1CARR that counts when the system receives a local carrier group alarm message from the PM.

DS1LOF (Loss of Frame) A register for OM group DS1CARR that counts occurrences of frame loss on the incoming side of the associated digital carrier.

DS1MBU (Manual Busy Usage) A usage register for OM group DS1CARR that counts records if a DS-1 carrier is manual busy; has a 10 second scan rate.

DS1PBU (Peripheral side busy usage) A usage register for OM group DS1CARR that records if a DS-1 carrier is P-side busy. A carrier is P-side busy when the carrier remote (P-side) PM is OOS; has a 100 second scan rate.

DS1RCGA (Remote Carrier group alarm) A usage register for OM group DS1CARR that counts remote carrier group alarm messages that the system receives from the PM.

DS1SBU (System busy usage) A usage register for OM group DS1CARR (100 second scan rate) that records if a DS-1 carrier is system busy when: a.) a removal from service occurs at the CARRIER level at a MAP. The DS-1 carrier exceeds the bipolar violation, accu- mulated frame loss, accumulated slip count, or OOS threshold. b.) the carrier group alarm is active. c.) you remove a trunk card before you manually busy the carrier system d.) the supporting digital PM is busy e.) the system loses a carrier serving an RLM high data link controller that handles signaling traffic to and from the RLM.

DS1SES (DS-1 severe error seconds) A usage register for OM group DS1CARR that counts DS- 1 severe error seconds during XPM audits. Table CARRMTC identifies severe error second thresholds.

DS1SLP (Frame slip) A usage register for OM group DS1CARR that counts occurrences of frame slip on an associated digital carrier. Flame slip occurs as a result of over-run or under-run of the incoming bit stream.

DS1UAS (DS-1 unavailable seconds) A usage register for OM group DS1CARR that counts DS- 1 unavailable seconds during XPM audits. The unavailable seconds is the duration that the DS-1 is not available for use.

DSA Dial Service Assistance.

2001-8.0-RFM03-0302 Glossary 95

DSB Dial Switchboard.

DSBITMIS (DCCH serial number bit restriction mismatch) A register for OM group DCCICPCP pegs the number of times that page responses, originations, or registration messages from the mobile are rejected due to a serial number violation.

DSD Direct Service Dialing.

DSI Digital Satellite Interface.

DSND Digit Sender.

DSPRMAN Digital Signal Processor Resource Module (RM) Resource Management (RMAN). See OM group DSPRMAN for an extended description and field names.

DSR Data Set Ready.

DSU Digital Service Unit.

DSUR Digital Satellite Unit Remote.

DT Dial Tone.

DTA 1. Detailed Traffic Analysis. 2. Distributing Terminal Assembly.

DTABDN (Digitone abandon) A register for OM group ISDD that increases when an XPM detects an on-hook condition on an incoming DT trunk. The XPM detects the on- hook condition before the XPM returns a start-to-dial signal. The system abandons the call.

DTATMPT (Digitone attempt) A register for OM group ISDD that increases when the XPM accepts an SEIZ of an incoming DT trunk of an XPM for further processing.

DTD Dial Tone Delay.

DTDELAY (Digitone Delay) A register for OM group SITE that counts DTSR test calls on Digitone lines that experience one of the following conditions: - dial tone delays that exceeds 3 s - DTMF receiver queue overflow - previous DTSR test that is still in progress on the RLM

The system initiates a test on an RLM at each site every 4 s. A high count in this register indicates high switch use, RLM trouble, channel blockage, or not enough available DTMF receivers.

DTE/DCE Data Terminal Equipment/Data Circuit-terminating Equipment.

DTL Dial Tone Line. The communications path between the customer’s premises and the local exchange.

DTMF Dual Tone Multi-frequency. Push button dialing.

DTMFACC The number of calls during which a billed party entered a 1 in response to the prompt requesting a DTMF entry. This count is pegged only if Billing_Acceptance_Validation is set to DTMF.

DTMFDENY (DTMF resources denied) A register for OM group DSPRMAN. DTMFUTIL should be

2001-8.0-RFM03-0302 Glossary 96

100% before DTMFDENY increments the peg register.

DTMFHI (High-water-mark for DTMF allocations from the DTMF pool) A register for OM group DSPRMAN that counts the highest number of DTMF resources allocated from the node-level pool during a collection/transfer period. Its value starts at zero at the beginning of each collection/transfer period for the node. An update occurs when there is a new high-water-mark in the collection period. This occurs when the total number of resources allocated from the DTMF pool exceeds the previous high-water- mark for the pool.

DTMFLOST (DTMF resources lost by or taken away from resource management users) A register for OM group DSPRMAN that counts the DTMF resources taken away from users of SPM resource management (such as call processing) due to sparing actions.

DTMFLOW (DTMF low-water-mark threshold violations on the node-level DTMF pool) A register for OM group DSPRMAN that counts the low-water-mark threshold violations on the SPM node-level pool of DTMF resources since the last collection period. Crossing the threshold once indicates a potential for resource exhaustion on the node. Crossing the threshold more than once in a collection period indicates the user (call process- ing) is operating around the threshold for extended periods.

DTMFUTIL (Percent utilization of DTMF resources) A register for OM group DSPRMAN calculates the percentage of the total DTMF resources in the node-level pool allocated to users of resource management (such as call processing). DTMFUTIL is the average percent- age utilization for all scan periods during a collection/transfer period. It does not indicate the total number in use at the end of a scan or transfer period.

DTR Data Terminal Ready.

DTSEIZ (Digitone seizure) A register for OM group ISDD that increases when the system seizes a DT trunk of an XPM for an incoming call. The system detects a SEIZ when an XPM detects an off-hook condition. The off-hook condition that for 6 to 9 ms on an idle incoming trunk.

DTTDLY (Digitone trunk delay) A register for OM group ISDD that increases when one of the following intervals exceeds a preset TDLY threshold: the interval between the SEIZ of an incoming DT call and the return of a start-to-dial signal the interval between call SEIZ and call ABDN, exceeds a preset TDLY threshold. The default TDLY threshold is 3 s.

DTTESTC (Digitone Test Calls) A register for OM group SITE that counts DTSR test calls that are on Digitone lines. Register DTTESTC increases after the system determines the result of the test.

DTWX Dial Teletypewriter exchange service.

dual-sided disk drives Disk drives that use two read/write heads to store and retrieve data on both the top and bottom sides of a disk.

dump Clear memory and store data elsewhere. Large-scale copying of files from disk to tape, or vice versa, is sometimes referred to as dumping.

DUNEXPGR (DCCH unexpected page response) A register for OM group DCCICPCP that pegs the number of unexpected page responses received by the ICP from a mobile situated in a cell partition.

Dup Duplicate.

2001-8.0-RFM03-0302 Glossary 97

duplex 1. Communications mode. In terms of a communications mode, duplex describes the ability of a data communications channel to handle two simultaneous signals. 2. Communications parameter. A data parameter used to determine whether another computer echoes characters typed at your computer’s keyboard back to your com- puter for display. When your system is set to full duplex, it does not echo characters typed at its keyboard to its screen, but echoes received characters back to the screen of the system to which you are connected.

DVCC Digital Voice Color Code.

DVCCTO (Digital Voice Color Code Timeout) A digital register for wireless OM group OMMTX that pegs when a call is dropped due to digital SAT timeout.

DVCCTOS (Dropped Calls due to Digital SAT Timeout) A register for wireless OM group ICPDCP that pegs when an initial traffic channel designation (TCD) message is sent and no DVCC message is detected on the digital channel. This indicates a digital call setup failure. dyadic A dyadic operation requires two operands. For example, addition, multiplication, subtraction, and division are all dyadic operations because each of them operates on two numbers. Negation is not a dyadic operation because it operates on only one number. dynamic overload control A dynamic control, usually implemented at the switch level when the system recognizes congestion as a result of its interval measurement process. The switch forwards a control message to subtending units to restrict a percentage of traffic. dynamic RAM Storage that the computer must refresh at frequent intervals.

EAACKFL (Equal access acknowledgement failures) A register in wireless OM group EACARR that counts timeouts that occur before an acknowledgement wink from the carrier. Register EAACKFL increases only when the end office clears the forward connection. When the end office does not respond to the absence of the acknowledgement, the end office clears the forward connection.

EACARR Equal Access Carrier Measurements. See also OM group EACARR for an extended description and field names.

EADAS Engineering and Administration Data Acquisition System.

EADOMES (Equal access domestic calls) A US-only register in wireless OM group EACARR that counts incoming domestic equal access and LATA equal access system (LEAS) IC/INC calls. These carriers are both Primary InterLATA (PIC) and non-PIC carriers. This register counts incoming calls to the access tandem for a specified carrier. When the system attempts to complete a call, the register increases even if the call does not complete. This register also counts domestic calls that originate from the equal access end office (EAEO) to that carrier.

EADOMPIC (Equal access domestic PIC calls) A register in wireless OM group EACARR that counts originating equal access and LATA equal access system (LEAS) domestic PIC calls destined for a specified carrier.

EADOMXXX (Equal access domestic non-PIC calls) A register in wireless OM group EACARR that counts originating equal access and LEAS domestic non-PIC calls destined for a specified carrier.

2001-8.0-RFM03-0302 Glossary 98

EAINTL (Equal access international calls) A US-only register in wireless OM group EACARR that counts incoming international equal access and LEAS, both PIC and non-PIC calls. The EAINTL counts the calls to the access tandem that are for a specified carrier. When the system attempts to complete a call, the register increases even if the call does not complete.

EAINTPIC (Equal access international PIC calls) A register in wireless OM group EACARR that counts originating equal access and LEAS international PIC calls destined for a specified carrier.

EAINTRM (Equal access incoming interim calls) A register in wireless OM group EACARR that incoming interim (950-YXXX) calls to the access tandem that are for a specified carrier. Register EAINTRM also counts 950-YXXX calls that originate from the EAEO to the same carrier. When the system attempts to complete a call, the register increases even if the call cannot complete.

EAINTXXX (Equal access international non-PIC calls) A register in wireless OM group EACARR that counts originating equal access and LEAS international non-PIC calls destined for a specified carrier.

EAS Extended Area Service.

EASDEM Extended Area Service Dial Equipment Minutes.

EASHRTRK Equal Access Charged Trunk Group Traffic measurements. See also OM group EASHRTRK for an expanded definition and field list. This is a U.S. only OM group.

EAWNKFL (Equal access wink failures) A US-only register in wireless OM group EACARR that counts timeouts that occur before the first start pulsing wink from the InterLATA carrier (IC). Register EAWNKFL counts timeouts on domestic and international calls.

EBITMIS (Error-bit Mismatch) A register in wireless OM group ICPCP that pegs when the serving subcell rejects an origination/page response message from a subscriber unit. This occurs because the subscriber unit did not follow the error bit (E-bit) restrictions sent to it in the CCH over/head message.

EC Effective Call.

echo In data communications, the return of a transmitted signal to its source, with a delay that indicates the signal is a reflection rather than the original.

ECO End Central Office.

ECOM Electronic Computer Oriented Mail.

ECR Enhanced Cluster Routing

EDD Equipment Data Dump.

EDI Electronic Data Interchange.

edit 1. To add, change or delete data. 2. To check the correctness of data.

editor A computer program that enables the user to sit at a console or terminal, view the contents of a file, and add material or make other changes.

EDP Electronic Data Processing.

2001-8.0-RFM03-0302 Glossary 99

EDSAC The EDSAC (Electronic Delayed Storage Automatic Computer) was a stored program computer developed at Cambridge University in 1949.

EDPNOTIF A register for OM group CAINTRIG that counts the number of Event Detection Point Notifications the switch sends to the SCP.

EDPREQ A register for OM group CAINTRIG that counts the number of Event Detection Point Requests the switch sends to the SCP.

EDPSRCVD A register for OM group CAINTRIG that counts the number of times the switch receives a valid Request_Report_BCM_Event component.

EDVAC The EDVAC (Electronic Discrete Variable Automatic Computer) was a computer developed at the University of Pennsylvania in 1949. effective call A telephone call which has been set up and answered. effective traffic The traffic intensity corresponding to the call durations.

EFS Error Free Seconds.

EGA The IBM Enhanced Graphics Adapter (EGA) provides all of the graphics modes of the Color/Graphics Adapter (CGA), as well as additional high-resolution modes and sharper text.

EIA 1. Electronics Industries Association. 2. Excessive Ineffective Attempts.

Eight Hundred (800) Service Commonly referred to as inward WATS service. elapsed time The total time during which a circuit is occupied by a connected call. electronic switching system Lucent and Regional BOC terminology for a semi-electronic or electronic central office switching system. elite A size of type that fits 12 characters into each inch of type.

E & M Ear & Mouth, receive and transmit leads of a signaling system.

EM 1. Emergency calling “911”. 2. Equipment Number Termination (Stromberg- Carlson). emulation Using one system to imitate the capabilities of another. emulator A program or hardware device which duplicates the instruction set of one computer on a different computer. enable To prepare a system for operation or allow an item to function.

ENBKG (Background occupancy) A register for group ENETOCC that counts if the ENET CPU holds background-related processes. Examples of background-related processes are routine maintenance logs, service orders, OM accumulation and audits. At the beginning of the transfer period, ENBKG is set to zero. The occupancy value for the ENET CPU background transfers from the ENET node to the CM node every 60 s. The OM system samples the background occupancy value stored on the CM every 100 s.

2001-8.0-RFM03-0302 Glossary 100

The 100 s is the slow sample period. The OM system accumulates the samples over the transfer period.

ENCDERR (XPT card errors) A register for group ENETMAT that counts errors that the system detects in the operation of the in-service XPT cards of the network.

ENCDFLT (XPT card faults) A register for group ENETMAT that counts the number of times the system identifies a hard fault in network XPT cards. The system identifies hard faults as a result of self tests. A detected error triggers self tests. The XPT card is set to a system busy status. This status remains until a manual action occurs or until the system initiates a successful recovery.

ENCDISOU (XPT card isolation usage) A usage register (100s scan rate) for group ENETMAT that counts if the system isolates a PM because of out-of-service XPT cards.

ENCDPARU (XPT card partitioning usage) A usage register (100s scan rate) for group ENETMAT that records if a minimum of one out-of-service XPT card is present on plane 0. Register ENCDPARU also records if a minimum one out-of-service ENET component is present on plane 1.

encode To convert data into a code form acceptable to computer equipment.

ENCPOCC (Call processing occupancy) A register for OM group ENETOCC that records if the ENET CPU holds call processing-related processes. At the beginning of the transfer period, register ENCPOCC is set to zero. The CPU call processing occupancy value for the ENET transfers from the ENET node to the CM node every 60 seconds. The OM system samples the call processing occupancy value stored on the CM every 100 s. One hundred seconds is the slow sample period. The OM system accumulates the samples over the transfer period.

encryption To encrypt information is to covert it into a code or cipher so that people will be unable to read it. A secret key, or password, is required to decrypt (decode) the information.

end cell One or more cells in a central office in addition to the usual 23 cells that will increase the battery voltage when connected to the normal batteries.

end of block A set of characters which indicates that the block of information being transmitted has been completed.

end office switch A local telephone company switching system where telephone exchange service customer station loops are terminated for purposes of interconnection to trunks. Included are remote switching modules and remote switching systems served by a host office in a different wire center.

end of file (EOF) In data processing, the end of a particular set of records.

end of transmission character A transmission control character used to indicate the conclusion of a transmission that may have included one or more texts and any associated message headings.

end user (EU) Any customer of an interstate or foreign telecommunications service that is not a carrier, except that a carrier shall be deemed to be an “end user” to the extent that such carrier uses a telecommunications service for administrative purposes, without making such service available to others, directly or indirectly.

ENETMAT Enhanced Network Matrix Card. See also OM group ENETMAT for extended

2001-8.0-RFM03-0302 Glossary 101

description and field list.

ENETPLNK Enhanced Network Peripheral-side Links. See also OM group ENETPLNK for extended description and field list.

ENFORE (System occupancy) A register for OM group ENETOCC that records system-related processes occupy the ENET CPU. Examples of system-related processes are sanity checking, or system-critical work that requires immediate response. At the beginning of the transfer period, register ENFORE is set to zero. The system occupancy for the ENET CPU transfers from the ENET node to the CM node every 60 seconds. The OM system samples the system occupancy value stored on the CM every 100 seconds. The slow sample period is 100 s. The OM system accumulates the samples over the transfer period. engineered capacity The planned utilization figure of lines, terminals, or trunks per group. engineering criteria The standards of service that are used in determining required equipment quantities. The criteria are stated for each component in the switching equipment and for all types of trunk groups. They consist of two elements, e.g., the delay or blocking model to be used and the measurement interval. A criterion, for example, would be “P.01 blocking using the ten high day average usage value.” engineering period The established length of time that installed equipment will meet requirements. enhancements Hardware or software improvements, additions, or updates to a computer or soft- ware system.

ENIDLE (Idler occupancy) A register for group ENETOCC that records if the ENET CPU performs idler class processes. These processes run when other processes do not run. At the beginning of the transfer period, the system sets the ENIDLE to zero. The system transfers the ENET CPU idler occupancy value from the ENET node to the CM node every 60 s. The OM system samples idler occupancy value stored on the CM every 100 s The slow sample period is 100 s. The OM system accumulates the samples over the transfer period.

ENLKERR (P-side link errors) A register for group ENETPLNK that counts all errors that the system detect on in-service links between the network and PMs.

ENLKFLT (P-side link faults) A register for group ENETPLNK that counts the number of times the system cannot recover a P-side link between the ENET and a PM. The recovery attempt occurs following detection of an error. The link is system busy until manual action or a successful system-initiated recovery attempt.

ENLKISOU (P-side link isolation use) A usage register (100 s scan rate) for group ENETPLNK that records if the system isolated a PM because of an out-of-service link.

ENLKPARU (P-side link partitioning usage) A usage register (100 s scan rate) for group ENETPLNK that records when: a minimum of one out-of-service link is present on plane 0 and a minimum of one out-of-service ENET components is present on plane 1. This condition must persist for 100 s for the register to increase.

ENMAINT (Maintenance occupancy) A register for OM group ENETOCC that records if the ENET CPU performs maintenance-related processes. At the beginning of the transfer period, the system sets the ENMAINT to zero. The system transfers ENET CPU maintenance occupancy value from the ENET node to the CM node every 60 s. The OMsystem samples maintenance occupancy value stored on the CMevery 100 s. The slow sample period is 100 s. The OM system accumulates samples over the transfer

2001-8.0-RFM03-0302 Glossary 102

period.

ENMBCDU (XPT card manual busy usage) A usage register (100s scan rate) for group ENETMAT that records if an XPT card is manual busy.

ENMBLKU (P-side link system busy usage) A usage register (100s scan rate) for group ENETPLNK that records if a link is a system-busy link.

ENMBPBU (Link PB manual busy usage) A usage register (every 100 seconds scans ENET link PBs) for group ENETMAT that records if a PB is manual busy.

ENMCDISO (XPT card manual busy isolation) A register for group ENETMAT that records when in-service ENET XPT cards that become manual busy. The manual busy state causes the isolation of a minimum of one PM.

ENMCDPAR (The XPT card manual busy partitioning) A register for group ENETMAT that records counts in-service ENET XPT cards that become manual busy. These cards become manual busy while other ENET components on the opposite plane are out of service. The count can partition the network. A partitioned network results in blocked calls. This condition must be present for a minimum of 100 s before the register increases. This condition must be present as a result of the scanning interval.

ENMLKISO (P-side link manual busy isolation) A register for group ENETPLNK that counts in- service ENET P-side links that become manual busy and cause isolation of a mini- mum of one PM.

ENMLKPAR (P-side link manual busy partitioning) A register for group ENETPLNK that counts when in-service ENET P-side links become ManB while links on the opposite plane are out of service. This condition blocks calls between PMs. This condition must continue for 100 s before register ENMLKPAR increases.

ENMPBISO (Link PB manual busy isolation) A register for group ENETMAT that counts in-service ENET link PBs that become manual busy. The manual busy state causes the isolation of a minimum of one PM. An isolated PM cannot access the network. An ENET link PB card connects the PM to the rest of the network. If the last ENET link PB card goes out of service, PM isolation occurs. The PM becomes C-side busy.

ENMPBPAR (Link PB manual busy partitioning) A register for group ENETMAT that counts in- service ENET link PBs that become manual busy. These PBs become manual busy while other ENET components on the opposite plane are out of service. The manual busy state causes the blockage of calls from one PM to other PMs. As a result of the scanning interval, this condition must be present for a minimum of 100 s before the register increases.

ENOFCDU (XPT card offline usage) A usage register for group ENETMAT that records if a card is offline. Every 100 s the system scans the ENET XPT cards.

ENPBERR (Link PB errors) A register for group ENETMAT that counts all errors that the system detects in the operation of the in-service link PBs of the network.

ENPBFLT (Link PB faults) A register for group ENETMAT that counts the number of times the system identifies a hard fault in the network link PB. Detected errors trigger self tests that result in hard faults. The link PB is set to system busy until a manual action occurs or until the system initiates a successful recovery.

ENPBISOU (Link PB isolation usage) A usage register for group ENETMAT that records if a PM isolates as a result of out-of-service PBs. The system scans the link PBs every 100 s.

2001-8.0-RFM03-0302 Glossary 103

ENPBPARU (Link PB partitioning usage) A usage register (100 s scan rate) for group ENETMAT that records records if a minimum of one out-of-service link PB is present on plane 0. Register ENPBPARU also records if a minimum of one out-of-service ENET component is present on plane 1.

ENSBCDU (Crosspoint card system busy usage) A usage register (100 s scan rate) for group ENETMAT that records if an ENET XPT card is system busy.

ENSBLKU (P-side link system busy use) A usage register (100 s scan rate) for group ENETPLNK that records if a link is system busy.

ENSBPBU (Link paddle board (PB) system busy usage) A usage register (100 s scan rate) for group ENETMAT that records if an ENET link PB is system busy.

ENSCDISO (Crosspoint (XPT) card system busy isolation) A register for group ENETMAT that counts in-service ENET XPT cards that become system busy. The system busy state causes the isolation of a minimum of one PM.

ENSCDPAR (Crosspoint (XPT) card system busy partitioning) A register for group ENETMAT that counts in-service ENET XPT cards that become system busy. These cards become system busy when other ENET components on the opposite plane are out of service. This condition can partition the network. A partitioned network results in blocked calls. A 100 s interval must occur between these events for the register to increase.

ENSCHED (Scheduler occupancy) A register for OM group ENETOCC that records if the ENET CPU performs scheduler-related processes. At the beginning of the transfer period, the system sets ENSCHED to zero. The system transfers ENET CPU scheduler occu- pancy value from the ENET node to the CM node every 60 s. The OM system samples scheduler occupancy value stored on the CM every 100 s and accumulates the samples over the transfer period.

ENSLKISO (P-side link system busy isolation) A usage register (100 s scan rate) for group ENETPLNK that records if a link is system busy.

ENSLKPAR (P-side link system busy partitioning) A usage register (100 s scan rate) for group ENETPLNK that records if a link is system busy.

ENSPBISO (Link paddle board (PB) system busy isolation) A register for group ENETMAT that counts in-service ENET link PBs that become system busy. The system busy state causes the isolation a minimum of one PM.

ENSPBPAR (Link paddle board (PB) system busy partitioning) A register for group ENETMAT that counts in-service ENET link PBs that become system busy. The PBs become system busy when other ENET components on the opposite plane are out of service. The system busy state causes the blockage of calls from one PM to the other PMs. An interval of 100 s must occur between these events for the register to increase.

ENSPCHER (P-side links speech errors) A register for group ENETPLNK that counts all errors detected on speech connections through the network. The value in register ENSPCHER equals the number of integrity failure reports received from PM control- lers. The following failures can cause an integrity failure: a failure of the PM at the other end of the connection, or a failure on a link between a PM and the network. enter To type text in a field in response to a prompt, or to create a message or text file online.

2001-8.0-RFM03-0302 Glossary 104

Enter key The enter key on a computer terminal is the key you press at the end of each line in order to enter the contents of that line into the computer. On some terminals, this key is called the return key.

entry Item of data in a list.

entry switch See first point of switching.

envelope delay The delay time experienced by certain frequencies in a signal due to filters used on telephone circuits.

environment On a computer, an environment defines what you can do with the computer.

EO 1. End Office. 2. Equipment number Origination.

EOD End Of Dialing.

EOF See End Of File.

EOIT End Office Intertoll Trunk.

EOM End Of Message.

EPROM Erasable Programmable Read-Only Memory.

epsilon An arbitrarily small positive quantity in mathematical analysis.

EQQOVFL (Register Egress queuing queue overflow) A register for OM group HPCBASIC that counts the number of failed attempts to place HPC calls in egress trunk group queues because the queues were full.

EQQATT (Register Egress queuing queue attempts) A register for OM group HPCBASIC that counts the number of attempts made to place HPC calls in egress trunk group queues.

EQQTMREX (Register Egress queuing queue timeout) A register for OM group HPCBASIC that counts the number of calls removed from egress trunk group queues due to timeout treatment.

equipment pair miles The product of sheath miles and the number of equivalent gauge pairs of conductors in a cable.

erase In PC-DOS (MS-DOS), the erase command deletes a file from the disk.

ergonomics The science of designing machines and working environments to suit human needs. An ergonomically designed machine is one whose design is based on the scientific study of human requirements such as vision, posture, and the like. Frequently called human engineering.

erlang A unit of telephone traffic widely used in Europe which is numerically equal to percentage occupancy. It is obtained by multiplying the number of calls by the length of the average call in fractions of an hour. One erlang equals 36 CCS (one hour usage).

ERROR A register for OM group CAINTRIG that counts the number of times a CAIN fatal application error occurs during call processing.

2001-8.0-RFM03-0302 Glossary 105

error checking 1. Refers to various techniques used to test for valid data. 2. The process by which two telecommunicating computers can verify that the data received was error free. error correction A system that detects and inherently provides correction for errors caused by trans- mission equipment or facilities. error density NAKs (negative acknowledgements) received, divided by frames transmitted. error message A printed or displayed statement indicating the computer has detected a mistake or malfunction. error rate The ratio of the number of signal elements incorrectly received to the total number transmitted. escape character A predetermined character which indicates to the receiving station that the subse- quent characters are to be interpreted in a nonstandard way.

Escape key Abbreviated ESC, this key is usually used to take control of the computer away from a program, to escape from a specific program, or to stop a program. escape sequence A special series of character codes that cause a screen or printer to perform some action (such as changing type styles) rather than displaying the characters. Also called control sequence.

ESF Extended Superframe Format.

ESN Electronic Serial Number.

ESP Essential Service Protection. See also OM group ESP for an extended description and field names.

ESPDELAY (Essential service protection delay) A register for OM group ESP that increases when an essential line receives delayed origination because CCBs are not available. All CCBs are in use on essential line originations.

ESPORIG (Essential service protection originations) A register for OM group ESP that counts originations from essential lines.

ESPOVRD (Essential service protection override) A register for OM group ESP that increases when an essential line origination takes the CCB of an origination that is not essen- tial.

ESPPMBLK (Essential service protection peripheral module blocked calls) A register for OM group ESP that increases when an extended peripheral module (XPM) cannot give priority service to an essential line origination. This condition occurs because resources are not available.

ESPPMCCO (Essential services protection calls forwarded from peripheral module to central controller) A register for OM group ESP that counts essential line originations that the system forwards from an extended peripheral module (XPM) to the central controller (CC).

ESPPMORG (Essential service protection peripheral module originations) A register for OM group ESP that counts originations for an essential line that arrive at an extended peripheral module (XPM). The XPM attempts to give the line priority service.

2001-8.0-RFM03-0302 Glossary 106

ESPPMSTL (Essential service protection peripheral module steal) A register for OM group ESP that increases when an extended peripheral module (XPM) seizes a line that is not essential for an essential origination.

ESS Electronic Switching System.

Est Estimate.

ETB End of Transmission Block.

ETV Educational Television.

even parity A parity state in which the parity bit assumes the value necessary (1 or 0) to make the sum of the 1’s in each byte or character transmitted an even number. Used only with an even parity checking scheme.

event An occurrence of one or a number of types of events of interest in traffic engineer- ing and dial office administration. Event measurement involves counting the number of events which occur, while usage measurement involves counting the total holding time of a number of events. Commonly measured types of events include Peg Count, ATB, LTB, CLC, DTD.

EX Executed.

EXC See Execute.

exception reporting A technique for screening large amounts of computerized data in order to display or print reports containing only specific information.

Exch Exchange.

exchange A unit, generally smaller than a local access and transport area (LATA), established by the telephone company for the administration of communications service in a specified area that usually embraces a city, town, or village and its environs. It consists of one or more central offices together with the associated facilities used in furnishing communications services within that area. One or more designated exchanges comprise a given LATA.

exchange code A digit, or group of digits, which identifies the central office or exchange to which a subscriber belongs.

Exchange DEM Exchange Dial Equipment Minutes.

Exchange SLU Exchange Subscriber Line Usage/Single Line User.

exchange, telephone An area within which telephone service is provided without toll charges.

execute Run a program or carry out an instruction. A computer alternates between a fetch cycle, when it locates the next instruction, and an execute cycle, when it carries out the instruction.

exhaust In telephone terminology, the date when the switching equipment or a group of traffic sensitive network components is no longer sufficient in size to carry the offered traffic and provide objective service.

exit That point in an algorithm or program from which control is transferred elsewhere.

2001-8.0-RFM03-0302 Glossary 107

EXNMCTRL (Register Exemption from Network Management Control) A register for OM group HPCBASIC that counts the number of times an HPC call is exempted from an active network management control, on the first idle trunk scan. expandability The ability to increase the capability of a computer system by adding modules or devices. expanded memory The method of equipping an IBM PC with many megabytes of memory. Ordinarily, the 8088 processor in the PC can address only one megabyte (1024K) of memory. The upper 384K of this is reserved for special purposes, leaving only 640K available for ordinary use. Expanded memory uses bank switching to swap many different sets of memory chips into a single block of addresses within this 640K region.

EXPATTS (Expanded Spectrum Attempts) A dual mode register for wireless OM group OMMTX that pegs when there is an attempt to allocate an expanded spectrum channel, for example, the subscriber unit is expanded spectrum capable.

EXPSCOMPS (Expanded Spectrum Completions) A dual mode register for wireless OM group OMMTX that pegs when an expanded spectrum channel is allocated and the call is successfully completed.

EXT Extension Block OM. See also OM group EXT for an extended description and field names.

EXTDCALL (Extended calls) A register for OM group IBNSG that counts CALLS that attendants in a customer subgroup extend.

EXTDERR The number of calls aborted because of a data error received when a call is presented to TOPS VSN. This number is incremented each time a new call whose T1 channel or call identification is currently being used by another active call. The active call is terminated and the T1 channel is allocated to the new call. extended call A call outside of the home exchange for which there is no extra charge to make the call. extended memory Memory directly accessible at addresses higher than one megabyte on IBM PC AT and PS/2 computers.

EXTHI (Extension Block High Water) A register for OM group EXT that records the maximum number of extension blocks in use at the same time during an OM transfer period. The OM transfer period can be 15 min or 30 min. To predict peak use accurately, gather high water marks for the busiest hours of the busiest days of the year. Follow either the High Day Busy Hour or the Extreme Value Engineering material. Calculate and adjust the supply of extension blocks. Calls during the busiest times should take no more than 80% of extension blocks.

EXTSOVFL (Extension Block Overflow) A register for OM group EXT that increases when the type of extension block requested for a call is not available. If the call cannot wait for a second attempt or second attempt fails, the call receives no-service-circuit (NOSC) treatment.

EXTSEIZ (Extension Block Seizures) A register for OM group EXT that increases when a request for a type of extension block is successful. f Frequency.

FA See Full Access.

2001-8.0-RFM03-0302 Glossary 108

FAA Federal Aviation Administration.

fac Facilities.

FACMSGOR (Facility messages originated) A register for OM group PRAFAC that counts facility messages that are created and sent on a primary rate access (PRA) D channel.

FACMSGTM (Facility messages terminated) A register for OM group PRAFAC that counts received facility messages that terminate at the DMS.

FACMSGTR (Facility messages transmitted) A register for OM group PRAFAC that counts facility messages that are received at a tandem switch and are transmitted to another switch. Both incoming and outgoing trunk groups are incremented.

FAILREPR A register for OM group CAINMSGS that counts the number of Failure_Report messages the switch receives from the SCP.

FAILREPS A register for OM group CAINMSGS that counts the total number of Failure_Report messages sent to the SCP.

FAILURE The number of calls abandoned or rejected because of no resources or a failure. This number is incremented for the relevant key each time a) there is no VI,T1, or ACPE available to handle the call b) the same T1or call D is assigned to a new call without terminating the previous call c) an error is detected in the call information when a call is presented to the TOPS VSN d) an internal error is detected e) the TOPS VSN is unexpectedly instructed by the DMS to end the call

fatal error An unexpected failure or other problem that occurs while a program is executing. It prevents the computer from continuing to execute the program.

fault Failure of any part of a system.

FCC Federal Communications Commission. The federal agency responsible for regulating interstate and foreign communications systems originating in the U.S.

FCNL Frequently Called Number List.

FDDI Fiber Distributed Data Interface.

FDM See Frequency Division Multiplex.

FDX Full Duplex.

FEATADDR A register for OM group CAINTRIG that counts the number of times a CAIN call has FEAT datafilled as the trigger action in table OFTRREQ and is datafilled with ADDR feature processor.

FEATAUTH A register for OM group CAINTRIG that counts the number of times a CAIN call has FEAT datafilled as the trigger action in table OFTRREQ and is datafilled with AUTH feature processor.

FEATCARD A register for OM group CAINTRIG that counts the number of times a CAIN call has FEAT datafilled as the trigger action in table OFTRREQ and is datafilled with CARD

2001-8.0-RFM03-0302 Glossary 109

feature processor. feature Something special that is accomplished in a program or hardware device. feature group A (FGA) Offers access to the local exchange carrier’s network through a subscriber-type line connection rather than a trunk. feature group B (FGB) Similar to FGA, but provides a higher quality trunk line connection from the end central office to the IX carrier’s facilities, instead of the subscriber-type line. The IX customer can originate a call from anywhere within the LATA, while FGA requires customers to initiate the call from within the local exchange of the exchange carrier connecting to the IXC. feature group D (FGD) The class of service associated with equal access arrangements. When equal access is implemented, all other feature groups convert to FGD and the IX is billed for actual measured use, without discount. In some cases an IX carrier may desire to maintain FGA or FGB arrangements, but the FGD equal access rates will apply. feedback Occurs when a control device uses information about the current state of the system to determine the next control action.

FEX Foreign Exchange.

FGA See Feature Group A.

FGB See Feature Group B.

FGD See Feature Group D.

FIB Forward Indicator Bits. fiber optics A data transmission medium made of tiny threads of glass or plastic that transmit huge amounts of data at the speed of light. field A unit of data within a record. Fields are found in data bases as the units that make records. Fields also follow online prompts, where you are expected to enter exactly the number of characters specified, or no more than the specified number of characters.

FIFO First In, First Out. fig Figure. file A collection of one or more related records treated as a basic unit of storage. file backup Copies of data files that can be used to restore a data base that has been damaged or destroyed. file label An external label identifying a file. file layout The arrangement and structure of data in a file, including the sequence and size of its components. file name The identifying label given to a file. File names commonly consist of a name of up to eight letters or digits, followed by a period, followed by an extension of up to three letters or digits.

2001-8.0-RFM03-0302 Glossary 110

file size The number of records in a file.

file structure The format of fields within a data record.

file updating The processing of additions, deletions, and changes against a master file.

fill, line The percentage of working telephone lines in a central office compared with its total capacity.

final group A trunk group connecting an office with an office of higher classification, and which is the last choice route in an alternate route network.

final group busy hour The hour for which the traffic load carried by the final group in an alternate route network is the greatest.

finder Switch in a dial office which seeks and finds a particular input circuit and connects it to the next switching stage.

finder, trunk Switch in a dial office which seeks and finds a trunk circuit incoming to the office on which there is an incoming call.

firmware Software which has been built into the computer and permanently stored within read-only memory (ROM).

first point of switching The first exchange carrier location at which switching occurs on the terminating path of a call proceeding from the customer’s premises to the terminating end office and, at the same time, the last exchange carrier location at which switching occurs on the originating path of a call proceeding from the originating end office to the customer’s premises location.

FIT Federal Income Tax.

floppy disk An oxide-coated plastic disk used as a computer storage medium. The most popular floppy disk sizes are 8, 5¼, or 3½ inches in diameter.

flow Sequence of events in the solution of a problem.

flutter Recurring speed or signal variation.

FM Failure to Match.

footprint The shape and area of floor space required for a piece of equipment.

Force Management The functions and responsibilities of managing an operator work force.

forecast The extrapolation of the past into the future.

foreign exchange (FX) A service by which a telephone or PBX in one city, instead of being connected directly to a central office in that city, is directly connected to a central office in a distant city via a private line. To callers it appears that the telephone or PBX is actually located in the distant city.

format 1. Specified arrangement of data. 2. Prepare a diskette to receive data in an organized fashion.

formatted display A screen display in which the attributes or contents of one or more display fields have been defined by the user.

2001-8.0-RFM03-0302 Glossary 111

form feed The physical transport of continuous paper to the beginning of a new line or page. fortuitous By chance, random. Most telephone traffic theory is based on the assumption that traffic demand originates in a random manner.

FOUR-A (4A) Four-wire switching machine used for switching toll traffic.

FP First Choice Part.

FR Local Line Switch Frame.

fragmentation A disk becomes fragmented when many files are created and erased on it over a long period of time. The space allocated to a file is not necessarily contiguous. If the file is scattered over many widely separated sectors, access to the file is relatively slow. A disk can be defragmented by copying all the files to another disk. Programs exist for some machines that will defragment a disk “in place” by carefully rearranging the files without copying to another disk. frame A structure within a central office designed to provide flexibility of cross connecting to and from various ranks of equipment as well as to outside cable, etc. framing error Occurs when an asynchronously transmitted character appears to contain the wrong number of bits. Framing errors usually result from transmitting or receiving at the wrong speed. frequency division multiplex (FDM) A multiplex system in which the transmitted frequency bandwidth is divided into two or more narrower bandwidths each of which is used for a separate communication channel. frequency shift keying (FSK) A form of frequency modulation in which the modulating signal shifts the output frequency between predetermined values and the output signal has no phase discon- tinuity. friction feed A paper-feed system that operates by clamping a sheet of paper between two rollers.

FSK Frequency Shift Keying.

FSTR False Start.

FTRQ Feature Queue Software Resources. See also OM group FTRQ for an extended description and field list.

FTRQHI (FTRQ high water mark) A register for OM group FTRQ that contains the High Water Mark value for the highest number of successful FTRQ block requests made during a transfer period to date. When register FTRQHI peg count exceeds 65535 the register is reset to zero and extension register FTRQHI2 is incremented.

FTRQHI2 An extension register for OM group FTRQHI.

FTRQOFL2 An extension register for OM group FTRQOVFL.

FTRQOVFL (unsuccessful FTRQ block requests) A register for OM group FTRQ that counts the number of unsuccessful FTRQ block requests made during an OM transfer period.

2001-8.0-RFM03-0302 Glossary 112

FTRQSEIZ (FTRQ) A register for OM group FTRQ that counts the number of successful FTRQ block requests during an OM transfer period. FTRQSEIZ is used in conjunction with extension register FTRQSZ2 to provide the total number of successful FTRQ block requests. Each peg to FTRQSEIZ indicates one successful FTRQ block request in the current OM transfer period. FTRQSEIZ can peg up to 65535 successful FRTQ block requests before it wraps around back to zero and pegs extension register FTRQSZ2.

FTRQSZ2 An extension register for OM group FTRQSEIZ.

full access The ability to connect any server to any demand without restriction.

full availability A condition where each call that may be directed to a particular trunk group has access to all trunks.

full duplex Simultaneous communication in both directions between two points.

full group A trunk group connecting a given office with another office of any classification, except its home office, and which is the last choice route for all traffic between the serving areas of the two offices.

full-screen terminal Allows you to type in characters anywhere on the display screen. A line-at-a-time terminal allows you to type only at the bottom line of the display.

function 1. The operation specified in an instruction. 2. A precoded routine.

function key Key on a keyboard device that results in action such as line feed, carriage return, etc., and does not result in a character being printed.

gain hit A sudden, uncontrolled increase in the received signal level.

garbage Meaningless, unwanted data. “Garbage In, Garbage Out” or GIGO is a common expression in the computer world.

gate Electronic switch.

gateway A link between two or more wide area networks.

gauge Scale used to determine wire diameter.

GBH See Group Busy Hour.

germanium A material used to make semiconductor devices. Each atom in a germanium crystal contains 32 protons and 32 electrons. Of the electrons, 28 are bound tightly to the nucleus, while the outer 4 (valance) electrons can be dislodged easily. Germanium is the second most popular material (after silicon) for making semiconductor devices.

giga A prefix meaning one billion.

gigabyte Specifically, 1,073,741,824 bytes.

gigahertz A frequency of a billion times a second.

GIGO Garbage In, Garbage Out.

GLARE (Glare) A register for OM group TRK that counts when the system drops a trunk that the system selects at an earlier time. The system drops this trunk because the PM detects an origination before the PM can seize the trunk. The operating company

2001-8.0-RFM03-0302 Glossary 113

gives information that indicates that outgoing calls give way to simultaneous incom- ing calls (glare). The system attempts a new selection. If the system encounters glare again, the system routes the call to generalized no-circuit (GNCT) treatment. Register GLARE increases again. The system generates this register for office types that are correct.

GLAT Group Trunk To Line Attempts. Calls incoming via a specified trunk group that require connection to a line. Count made after code translation. glitch Unwanted electronic pulse that causes errors. Software errors are sometimes called glitches. global variable A variable that can be recognized anywhere in a program.

GNCT Generalized no circuit treatment.

GO General Office.

GOTAVAG Got Available Agent. GOTAVAG is incremented each time an agent becomes available and the CAM selects a call from the queue for that agent to handle. CALLQD = GOTAVAG + GOTSPLCL + AGREQCAN

GOTAVAG2 Extension register of GOTAVAG.

GOTPOSIM Got Position Immediately. Incremented each time an agent is immediately available to serve the call that requested an operator position from the QMS CAM. POSRQSTD = CQUEUED + GOTPOSIM + CDEFLECT + COVFLMAX + COVFLNCQ + CQDENIED

GOTPOSI2 Extension register of GOTPOSIM.

GOTSPLCL Got Special Call. GOTSPLCL is incremented each time a call in the application’s queue is found for an agent in response to a request for a special call. CALLQD = GOTAVAG + GOTSPLCL + AGREQCAN SPLCLREQ = GOTSPLCL + NOSPLCL

GOTSPLCL2 Extension register of GOTSPLCL.

GPXOF Group PBX Overflow. Terminating overflow. Scored if terminating call fails due to all lines in the specified multi-line hunt group being busy.

GPXSZ Group PBX Seizure. Count includes originating and terminating traffic from/to specified multi-line hunt group. Scores on successfully seizing a member of the group in either direction.

GPXUS Group PBX Usage. Total usage of all members of the specified multi-line hunt group. Includes originating and terminating usage. grade To arrange connections between groups of switching equipment in an electrome- chanical dial office to maximize the traffic handling capacity of the office. grade, data A circuit whose transmission characteristics, low distortion and low noise allow the circuit to be used safely for data services. grade of service 1. A number of engineering parameters used to provide a measure of adequacy under specified conditions. 2.The probability of a call being blocked, during the busy hour, because of insufficient equipment or trunks. One busy per 100 attempts is

2001-8.0-RFM03-0302 Glossary 114

shown as P.01.

grading The act of arranging, or rearranging, selector bank terminals in order to maximize the traffic handling capacity of an office. Usually accomplished by restrapping of the selector distributing terminal assembly (DTA).

grading pattern Method of arranging trunks or succeeding ranks of switches that will enable the offered traffic to be evenly distributed over the entire group.

graphics Any computer-generated picture produced on a screen, paper, or film. Graphics range from simple images to very colorful, detailed images.

graphics card A video card that can display graphics as well as text.

GRCDL Group Routing Code Dialed. One or more 6, 4, 3, 2, or 1 digit codes may be assigned to 1 of 128 registers for preroute pegging. Code assignment is made via the Translation Table Update overlay. The 128 preroute register maximum depends on the code translation for the office.

greeking The use of random letters or marks to show the overall appearance of a printed page without showing the actual text. With computers, greeking is used when the page is displayed too small for the text to be readable on the screen.

ground Positive potential within the central office.

group Trunk group number.

group busy hour (GBH) The hour at which the traffic load carried by a given trunk group is the greatest.

group identification A name identifying an equipment group that traffic loads are reported for.

grouping Arranging data with common characteristics into groups having common characteris- tics.

GSP General System Practice.

GTIUS Group Trunk Incoming Usage. Incoming usage of all members of a specified trunk group. If it is a two-way group, measurement includes incoming usage only.

GTLAT Group Trunk-to-Line Attempt.

GTOAT Group Trunk Outgoing Attempt. Scored if outgoing call is successfully connected to a free trunk in the specified group.

GTONP Group Trunk Outgoing No Path Available. Scored if last attempt to connect to a free trunk in the specified outgoing trunk group fails due to path blockage in the net- work.

GTOOF Group Trunk Outgoing Overflow. Scored if outgoing call fails to find a free trunk in the specified group.

GTOUS Group Trunk Outgoing Usage. Outgoing usage of all members of the specified trunk group. If it is a two-way group, measurement includes outgoing usage only.

GTTAT Group Trunk-to-Trunk Attempt. Calls incoming via a specific trunk group that require connection to a trunk. Count made after code translation.

2001-8.0-RFM03-0302 Glossary 115 gulp A small group of bytes. half Half hour. half duplex Transmission of data in either direction, but only in one direction at a time. handshaking The mutually agreed upon method by which the rate of data transmission is con- trolled during an ASCII upload or download. Also, any exchange of signals used by communicating systems to establish compatible communications parameters. hands-on The process of physically using a computer. hard copy Output typed or printed on paper. hard disk A storage medium using rigid aluminum disks coated with iron oxide. Hard disks have much greater storage capacity than floppy disks and are normally permanently mounted into the computer. A read/write head travels across the disk on a thin cushion of air without ever actually touching the disk. Hard disks are also called Winchester disks. hard disk management a. Back up your hard disk, and do it frequently. Every hard disk in use today WILL break down within just a few years! b. Divide the disk into subdirectories and put related files in each subdirectory. c. Use the MOS-DOS PATH command or its equivalent so that commonly used commands will work no matter what directory you are in. It is advisable to put the PATH command in your AUTOEXEC.BAT file. d. Delete files that you no longer need. Make a directory called \JUNK in which to put files that will not be needed for very long, so that they will not clutter up other directories. e. Periodically run CHKDSK or its equivalent to check for lost clusters. f. Run a defragmentation program every few months, or eliminate fragmentation by backing up the whole disk, erasing all files, and restoring all files from the backup. hard sector Magnetic floppy disks are divided into wedges called sectors which are physi- cally marked by holes punched through the disk to indicate the various sectors. Soft sectoring is a method of determining the position of data on the disk by software calculations rather than by physical monitoring of the disk. hardware The physical components or equipment that make up a computer system.

Hayes compatibility A modem is Hayes compatible if it responds to the same set of auto-dialing com- mands as the Hayes Smartmodem. Two modems need not be Hayes compatible in order to communicate with each other. Hayes compatibility refers only to the commands used by the computer to control the modem. A sampling of those commands is given in Table 1.

Table 1 Examples Of Hayes Modem Dialing Commands

ATDT9W555-1212 Dial 9, wait for another dial tone, and dial 555-1212 (using tone dialing). ATDP9W555-1212 Same, but use pulse dialing. ATH0 Hang up. ATA Answer an incoming call (right now) with modem. ATO Resume communicating (use this after you have typed “+++” to issue commands in the middle of a session). Note that this command uses the letter O, not the digit 0. ATSO=1 Answer when the phone rings.

2001-8.0-RFM03-0302 Glossary 116

Table 2 gives the DIP switch settings for the Hayes Smartmodem 1200. Other modems use similar settings.

Table 2 DIP Switch Settings For Hayes Smartmodem 1200

Switch 1 Up: Modem uses DTR signal from computer. Down: Modem assumes DTR is always high (true). Explanation: Most computers provide a DTR signal that is high when the communications program is running, and low otherwise. When DTR is low, the modem hangs up the phone and refuses to accept commands. 2 Up: Modem gives English words as result codes. Down: Modem gives numbers as result codes. Explanation: Leave this switch up if you want to see messages such as “CONNECT” or “NO CARRIER”. 3 Up: No result codes are sent. Down: Results codes are sent (either numbers or words as selected by switch 2). Explanation: See switch 2 4 Up: Command characters are echoed. Down: Command characters are not echoed. Explanation: If the letters in commands are invisible on your screen, this switch should be up. If the letters appear twice, this switch should be down. 5 Up: Modem will answer incoming calls. Down: Modem will not answer incoming calls unless commanded to do so. Explanation: This switch should be up if your computer is going to be answering calls from another computer, and down otherwise. 6 Up: The CD signal will be high (true) only when a connection to another modem has been established. Down: The modem will always hold CD high. Explanation: Some computer programs refuse to transmit if CD is not high. If this prevents you from sending commands to the modem, put this switch in the down position. 7 Up: Single line telephone connection. Down: RJ12 or RJ13 telephone connection. Explanation: This switch should almost always be up. In the down position, an additional relay is connected to the phone line to control an indicator light. 8 Up: Modem will not recognize commands. Down: Modem recognizes commands. Explanation: This switch should be down unless you want to disable Hayes compatibility. 9

2001-8.0-RFM03-0302 Glossary 117

Up: Modem uses Bell 103 and 212A data format. Down: Modem uses CCITT V.22 format. Explanation: The Bell formats are used in the United States; the CCITT format in Europe. 10 Up: When DTR goes low, the modem hangs up and awaits commands. Down: When DTR goes low, the modem hangs up and resets, canceling the effect of any commands that have been given. Explanation: This switch should usually be up. It has no effect unless switch 1 is also up.

HDIRREQ (handoff directed request) An analog register for wireless OM group OMMTXHO that counts when the switch receives a handoff directed request message.

HDIRRTRY (handoff directed retry) An analog register for wireless OM group OMMTXHO that counts when the switch sends off a handoff retry message to the serving subcell after the serving subcell sends a directed handoff request message to the switch.

HDLC High Level Data Link Control.

HDTOTAL This is the total number of operator handoff calls. head Device used to read, record, or erase data on a magnetic storage medium. head crash Collision of the read/write head with the recording surface of a hard disk, resulting in loss of data. Also called disk crash. heat coil A protective device used to protect central office equipment from excessive current. help A handy function available on many systems. It supplies the user with additional information on how the system or program works. henry The unit of measure of inductance. One henry is the inductance of a circuit in which an electromotive force of one volt is produced by a current in the circuit that varies at the rate of one ampere per second.

Hertz Unit of frequency representing cycles per second. heuristic Refers to a method of solving problems that involves intelligent trial and error. hex (Hexadecimal notation). The base-16 number system often used in computers. hierarchy Order in which arithmetic operations within a formula or statement will be executed. high High tone. (Pay station tone.) high day (HD) The highest business day busy hour traffic usage value that occurred in the average busy season or is expected to recur in the next average busy season(s). These days would include heavy load days due to snow storms, heavy rain, etc., which are likely to recur in any year. high speed printer A printer capable of printing from 300 to 3,000 lines per minute. high usage trunk group A direct trunk group between two trunking points designed to carry a heavy traffic usage pattern. Overflows during peak periods will be diverted to an alternate route. The term “high usage” derives from the fact that since such groups may overflow

2001-8.0-RFM03-0302 Glossary 118

traffic to an alternate route, they need have no reserve capacity, and hence may carry very close to the maximum amount of traffic per trunk.

HINREQ (handin requests) An analog register for wireless OM group OMMTXHO that counts when a subscriber unit requests a handoff from an outer tier to an inner tier of a cell.

HINRTRY (handin retry) An analog register for wireless OM group OMMTXHO that counts when no voice channel is available on an inner tier for a handin for a subscriber unit.

hit 1. Disconnected before first digit. 2. A transient disturbance to a communications medium.

HLBFM LSG Line Bidirectional Failure to Match. Combined count of terminating and final originating call attempts to/from the LSG that fail due to the inability to match free and available channels in the line group highway switch.

HLBSZ LSG Line Bidirectional Seizures. Combined count of origination off-hook requests for service plus call terminations to the line subgroup. Call terminations are scored on ringing the line. Revertive calls score on call origination only.

HLBUS LSG Line Bidirectional Usage. Combined origination and termination usage of the LSG. Revertive calls score origination usage only.

HLDCALL (Held call) A register for OM group IBNSG that counts when an attendant presses the hold key or another loop key while active on a loop.

HLIU High-speed Link Interface Unit

HMTCREQ (handoff maintenance request) An analog register for wireless OM group OMMTXHO that counts when the switch receives a request to handoff a subscriber unit to another voice channel in the same serving cell.

HMTCRTRY (handoff maintenance retry) An analog register for wireless OM group OMMTXHO that counts when no voice channel is available for the serving subcell to perform a maintenance handoff for the subscriber unit.

HN Host to Network.

HOACKSWB Register HOACKSWB (handoff acknowledgment switch back) pegs the number of times that the connection had to be switched back to the serving port. HOACKSWB is active only when ofcparm mtx_handoff_wait_for_ho_ack is wset to “N” in table OFCVAR.

HOATTS Register HOATTS (handoff attempts) pegs when the switch orders the subscriber unit to handoff from the serving subcell. This register pegs against the serving subcell when the subscriber unit is ordered to handoff to a new channel.

HOCOMPS Register HOCOMPS (handoff completions) pegs a handoff from the serving subcell to a target subcell.

HOFFREQ Register HOFFREQ (handoff requests) is an analog register for wireless OM group OMMTXHO that pegs when the RSSI of a subscriber unit is below the value specified in field HOTL in table HOPARMS.

HOFFRTRY Register HOFFRTRY (handoff retry) is an analog register for wireless OM group OMMTXHO that pegs when one of the following handoff threshold handoffs has to be retried because of one of the following conditions:

2001-8.0-RFM03-0302 Glossary 119

- no adjacent cell is available to accept a handoff from a subscriber unit - no response comes from adjacent cells - no voice channel is available on adjacent cells to accept a handoff from a subscriber unit - link or trunk problem in an intersystem handoff - handoff attempt during direct inward mobile access (DIMA) digit collection - handoff attempt during paging of subscriber unit - handoff attempt during announcement to subscriber unit - handoff attempt during tone treatment to subscriber unit - handoff attempt while ringing foreign exchange subscriber (FXS) trunk - handoff attempt outpulsing of digits holding time (HT) The length of time that an item of equipment is held in use to carry or process a telephone call or switching function. Includes both message time and operating time. Holding time is generally expressed in minutes. home The starting position for the cursor on a screen, usually in the top left-hand corner of the screen.

Home key A keyboard function that directs the cursor to its home position, which is usually in the top left portion of the display screen. home row The row of keys on the keyboard where keyboard users rest their fingers between keystrokes.

HOSENTCP (Handoff Sent to call processing) A register for wireless OM group OMMTXHO that is not in current use. host computer The computer that is in charge of the operations of a group of computers linked in a network. host office An electronic switching system that provides call processing capabilities for one or more remote switching modules or remote switching systems. housekeeping Computer operations that do not directly contribute toward the desired results, but are a necessary part of a program, such as initialization, setup, and cleanup opera- tions.

HOUTREQ (handout requests) An analog register for wireless OM group OMMTXHO that counts When the switch receives a request to handoff a subscriber unit from the inner tier of the serving subcell to the outer tier of the serving subcell.

HOUTRTRY (handout retry) A dual mode register for wireless OM group OMMTXHO that counts when a voice channel is not available on the outer tier of the serving subcell to handoff a subscriber unit. howler Device in a central office which sends a howling signal out to a subscriber’s line when it has been left off-hook.

HOVRHOTL (handover by handoff threshold) A dual mode register for wireless OM group OMMTXHO that counts when a below HOTL handoff request is received and the handoff is attempted to another sector on the serving subcell.

HOVRREQ (handover request by active voice channel scanning) An analog register for wireless OM group OMMTXHO that counts when the switch receives a request to handoff a subscriber unit from one sector of the serving subcell to another sector of the serving subcell. This register applies only to CSC cells.

2001-8.0-RFM03-0302 Glossary 120

HOVRRTRY (handover retry) An analog register for wireless OM group OMMTXHO that counts when a handover has been retried due to one of the following conditions: - no adjacent cell is available to accept a handoff from a subscriber unit - no response comes from adjacent cell - no voice channel is available on adjacent cells to accept a handoff from a sub scriber unit - link or trunk problem in an intersystem handoff - handoff attempt during DIMA digit collection - handoff attempt during paging of subscriber unit - handoff attempt during announcement to subscriber unit - handoff attempt during tone treatment to subscriber unit - handoff attempt while ringing FXS trunk - handoff attempt outpulsing of digits.

HPCBASIC High Probability Completion - Basic. See also OM group HPCBASIC for extended definitions and field list.

HRHF Hourly on the Half Hour.

HRHR Hourly on the Hour.

HS High Speed.

HT Holding Time.

HTGP Hunt Group Number.

HU 1. See High Usage trunk group. 2. Hang up. hue Gradation or variety of color. hunt Directory number hunting and multi-line hunting DMO.

Hunt Hunt groups.

HUNTATT A register for OM group HUNT that counts attempts to terminate a call on a line that is a member of a hunt group.

HUNTOVFL A register for OM group HUNT that counts failed attempts to terminate a call on a line that is a member of a hunt group. The attempts fail because no line is available. The lines can be in a call processing busy state or a maintenance busy state.

HUNTRHNT A register for OM group HUNT that pegs when the system selects an alternate line in a hunt group because of: a connection failure on the first line, a ringing failure on the first line, or other problems on the first line.

HUNTTRF A register for OM group HUNT that records call processing traffic on the hunt groups in the office. Each hunt group is scanned every 100 seconds to record the call processing usage for each member. The register accumulates between transfer periods.

HUNTMNT A register for OM group HUNT that records maintenance traffic on the hunt groups in the office. Each hunt group is scanned every 100 seconds to record the mainte- nance usage for each member. The register accumulates between transfer periods.

H/W Hardware.

2001-8.0-RFM03-0302 Glossary 121

Hz Hertz.

IA Intra-office: A trunk group provided to handle calls between subscribers served by the same switching machine. No tandem traffic routes over this group.

IACBSYDR (Individual attendant console position busy duration) A usage register (10 s scan rate) for OM group IBNAC that counts if an attendant console is in the position busy state. The count starts when an attendant presses the position busy key and stops when position busy deactivates. To deactivate position busy, press the position busy key again if night service is not active. Press the night service key if night service is active.

IACAUTH (Individual attendant console calls involving authorization codes) A register for OM group IBNAC that counts when an attendant enters an authorization code and presses an AUTH code key.

IACCFW (Individual attendant console answered call forward calls) A register for OM group IBNAC that increases when an attendant answers a forwarded call.

IACCTVTU (Individual attendant console activated usage) A usage register (100 s scan rate) for OM group IBNAC that counts if an attendant occupies a console. An attendant console is occupied if the headset is plugged in, even if the console is in position busy or night service mode.

IACDIAL0 (Individual attendant console answered dial 0) A register for OM group IBNAC that increases when an attendant answers a dial 0 type call. Calls counted by IACDIAL0 include: all station dial 0 regardless of station type, automatic station originations routed to the attendant, or incoming calls on attendant trunks.

IACEXTD (Individual attendant console extended calls) A register for OM group IBNAC that counts calls that an attendant extends. The register increases after the attendant dials the destination number.

IACHLD (Individual attendant console hold calls) A register for OM group IBNAC that counts when an attendant presses the hold key or a loop key to place a call on hold while remaining active on another loop key.

IACINTRP (Individual attendant console answered intercept) A register for OM group IBNAC that increases when an attendant answers an intercept-type call. Intercept type calls include: station intercept, incoming intercepted DID, or calls incoming on intercept trunks.

IACLDN (Individual attendant console listed directory number) A register for OM group IBNAC that increases when an attendant answers a call to its assigned listed directory number(s).

IACLDN1 (Individual attendant console listed directory number one) A register for OM group IBNAC that counts call attempts for a listed directory number (LDN) designated as LDN1 for separate attendant consoles. This register counts call attempts for an LDN in table WRDN if then LDNREPRT field is set to Y for yes.

IACLDN2 (Individual attendant console listed directory number two) A register for OM group IBNAC that counts call attempts for a listed directory number (LDN) designated as LDN2 for separate attendant consoles. This register counts call attempts for an LDN in table WRDN if the LDNREPRT field is set to Y for yes.

IACLDN3 (Individual attendant console listed directory number three) A register for OM group

2001-8.0-RFM03-0302 Glossary 122

IBNAC that counts call attempts for a listed directory number (LDN) designated as LDN3 for separate attendant consoles. This register counts call attempts for an LDN in table WRDN if the LDNREPRT field is set to Y for yes.

IACLDN4 (Individual attendant console listed directory number four) A register for OM group IBNAC that counts call attempts for a listed directory number (LDN) designated as LDN4 for separate attendant consoles. This register counts call attempts for an LDN in table WRDN if the LDNREPRT field is set to Y for yes.

IACLDN5 (Individual attendant console listed directory number five) A register for OM group IBNAC that counts call attempts for a listed directory number (LDN) designated as LDN5 for separate attendant consoles. This register counts call attempts for an LDN in table WRDN if the LDNREPRT field is set to Y for yes.

IACLDN6 (Individual attendant console listed directory number six) A register for OM group IBNAC that counts call attempts for a listed directory number (LDN) designated as LDN6 for separate attendant consoles. This register counts call attempts for an LDN in table WRDN if the LDNREPRT field is set to Y for yes.

IACLDN7 (Individual attendant console listed directory number seven) A register for OM group IBNAC that counts call attempts for a listed directory number (LDN) designated as LDN7 for separate attendant consoles. This register counts call attempts for an LDN in table WRDN if the LDNREPRT field is set to Y for yes.

IACLDNR (Individual attendant console routed listed directory number) A register for OM group IBNAC that counts call attempts to a routed listed directory number (LDN) that an attendant answers.

IACORGDR (Individual attendant console duration of originated calls) A usage register (10 s scan rate) for OM group IBNAC that counts if an attendant-originated call is in the talking state. An attendant-originated call starts when an idle loop key is pressed, and stops when the hold key, release key, or other loop key is pressed while the attendant is active on a different loop.

IACORIG (Individual attendant console originated calls) A register for OM group IBNAC that counts calls that originate at an attendant console. The register increases each time the attendant presses an idle loop key and starts to dial.

IACPOSBY (Individual attendant console position busy) A register for OM group IBNAC that counts when an attendant presses the position busy key to place the attendant console in the position busy state.

IACQTOTL (Individual attendant console) A register for OM group IBNAC that increases when an attendant answers a call type that any of the following registers do not count: IACLDN, IACINTRP, IACDIAL0, IACXRAT, IACCFW, or IACRECAL.

IACRECAL (Individual attendant console answered timed recalls) A register for OM group IBNAC that counts when an attendant answers a recall that results from use of Call Waiting, Camp-on or No-Answer features.

IACSPCL (Individual attendant console answered miscellaneous calls) A register for OM group IBNAC that counts when an attendant answers a call type that any of the following registers do not count: IACLDN, IACINTRP, IACDIAL0, IACXRAT, IACCFW or IACRECAL.

IACTOTDR (Individual attendant console total duration of answered calls) A usage register (10 s scan rate) for OM group IBNAC that records if an answered call is in the talking state.

2001-8.0-RFM03-0302 Glossary 123

The call starts when the attendant presses a loop or ICI key. The call stops when the attendant presses the hold key, release key, or other loop key while the attendant is active on a different loop.

IACTOTDR (Individual attendant console total duration of answered calls) A usage register (10 s scan rate) for OM group IBNAC that records if an answered call is in the talking state. The call starts when the attendant presses a loop or ICI key. The call stops when the attendant presses the hold key, release key, or other loop key while the attendant is active on a different loop.

IACXFRAT (Individual attendant console answered transfer to attendant) A register for OM group IBNAC that counts calls that a switch flash and dial 0 or 2 transfers from a station by switch flash and dial 0 or 2. IACXFRAT also counts calls that are recalled to the attendant over tie trunks.

IAO Intra-office.

IBM International Business Machines.

IBNAC Integrated Business Network Attendant Console. See also OM group IBNAC for extended description and field names.

IBNSG Integrated Business Network Subgroup. See also OM group IBNSG for extended description and field names.

IC 1. Integrated Circuit. 2. Interexchange Carrier.

I/C Incoming.

ICC Interstate Commerce Commission.

ICP Intelligent Cellular Peripheral.

ICT Incoming Test Trunk.

ICUP Individual Circuit Usage and Peg Count. A computer-based system designed to measure the number of calls placed on an individual circuit. Holding time for the circuit is calculated, thus facilitating the detection of nonworking or malfunctioning circuits or trunks.

IDD International Direct Dialing. identifier A character, or group of characters, used to name an item of data and possibly indicate certain properties of that data.

IDF Intermediate Distribution Frame. idle characters Characters used in data communications to synchronize the transmission. idle time The time that a computer system is available for use, but is not in actual operation.

IDLT Idle Time. The total time spent by operators on a particular team not made busy or calls withheld, but with no call at the position Measured in tenths of seconds and reported in seconds. IDLT is measured at the end of the occurrence and reported in the ending period.

IE Inter-office: A direct trunk group between Class 5 end offices regardless of location

2001-8.0-RFM03-0302 Glossary 124

No tandem traffic routes over this group.

IEEE Institute of Electrical and Electronic Engineers.

IEMAT Individual Equipment Number Termination Attempt. Number of times the circuit assigned to the DCO port was seized terminating or outgoing. Terminating/outgoing circuit types include: line, line switch PGH/TS, DSI channel, one-way outgoing trunk, two-way trunk, tone-dial receiver, MFR, conference bridge port, etc.

IEMUS Individual Equipment Number Termination Usage. Terminating or outgoing usage of the circuits assigned to the DCO port. Terminating/outgoing circuit types as for IEMAT.

IEOSZ Individual Equipment Number Origination Seizures. Number of times the circuit assigned to the DCO port was seized originating or incoming. Originating/incoming circuit types include: DCO line, line switch PGH/TS, digital satellite interface channel, one-way incoming trunks, MFS, etc.

IEOUS Individual Equipment Number Origination Usage. Originating or incoming usage of the circuit assigned to the DCO port. Originating/incoming circuit types as for IEOSZ.

I/F Interface.

IGP Incoming Group Number.

IGS Intergroup Switch Packs. Disabled Intergroup Switch Pack (DMS-10 OPM008).

IGNORE A register for OM group CIANTRIG that counts the number of times a CAIN call has IGNORE datafilled as the trigger action in the trigger table or encounters an Event Detection Point (EDP) with an IGNORE action specified in the appropriate EDP action extension parameter.

IHU Intermediate High Usage. When the offered load to a high usage group includes overflow traffic, it is called an intermediate high usage group.

I-I Independent-Independent.

II INT Independent-Independent Interstate.

II ST Independent-Independent State.

illegal character A character or combination of bits not accepted as a valid or known representation by the computer.

illuminate To increase the brightness or luminosity of graphical output at a display screen.

IM 1. Intermarker Group: A trunk group that interconnects two Number 5 Crossbar marker groups in the same building by intermarker group operation. 2. Intra-nodal Termination (Stromberg-Carlson).

IMEDPAG Immediately Available Priority Agent. IMEDPAG is incremented each time an applica- tion presents a call to the CAM and an agent in the priority agent queue is immedi- ately available to serve the call. CALLARIV = IMEDQAG + IMEDTAG + IMEDPAG + CALLQD + CALLDEFL + OVLMAX + OVLNOCQE

IMEDPAG2 Extension register of IMEDPAG.

2001-8.0-RFM03-0302 Glossary 125

IMEDQAG Immediately Available Agent With Call Queue Profile. IMEDQAG is incremented each time an application presents a call to the CAM and an agent with a call queue profile is immediately available to serve the call. CALLARIV = IMEDQAG + IMEDTAG + IMEDPAG + CALLQD + CALLDEFL + OVLMAX + OVLNOCQE

IMEDQAG2 Extension register of IMEDQAG.

IMEDTAG Immediately Available Agent With Controlled Traffic Profile. IMEDTAG is incremented each time an application presents a call to the CAM and an agent with a controlled traffic profile is immediately available to serve the call. CALLARIV = IMEDQAG + IMEDTAG + IMEDPAG + CALLQD + CALLDEFL + OVLMAX + OVLNOCQE

IMEDTAG2 Extension register of IMEDTAG.

IML See Incoming Matching Loss. immediate access Ability of a computer to put data in, or remove it from storage without delay. import To read a file created by another program into a data base system. impulse noise Irregular energy spikes of short duration and relatively high amplitude whose pres- ence in a data channel can be a prime cause of errors.

IMTS Improved Mobile Telephone System.

IN 1.Information: A one-way trunk which connects any dial telephone served by a dial central office or from an outward toll operator to an attended switchboard or information board. 2. Intra-nodal (Stromberg-Carlson).

INABNC (Incoming calls abandoned by customer) A register for OM group OFZ that counts incoming calls the subscriber abandons before processing. No treatment required.

INABNM (Incoming calls abandoned by the machine) A register for OM group OFZ that counts incoming calls that the machine abandons before processing. The machine abandons a call when a call times out at the upstream office while waiting for a receiver. The machine also abandons a call when there is an equipment problem.

INANN (Incoming calls to an announcement) A register for OM group OFZ that counts incoming calls that the system routes to an announcement. The announcement is the result of a treatment applied during inpulsing, or the intended result of the call. The call is counted before it attempts to get a network connection.

INANSWER (Answer messages sent and received on incoming trunk) A register for OM group TRK that counts the answered calls for incoming traffic for each incoming or two-way trunk.

INANSU (Answer messages sent and received on incoming trunk) A usage register for OM group TRK that counts that shows the number of answered calls on incoming trunk calls. This register measures traffic in the answered state for each incoming or two- way trunk. The register measures the occupancy in Erlangs. The value of register INANSU increases every 100 s according to the number of trunks occupied with answered calls.

INC Incoming trunk/equipment.

INCABNC (Incoming abandoned by the customer) A register for OM group OTS that counts incoming call attempts abandoned by the customer (subscriber). The calls are

2001-8.0-RFM03-0302 Glossary 126

abandoned before they connect to a terminating line, outgoing trunk, tone, an- nouncement, lockout status, or feature activation or deactivation.

INCABNM (Incoming abandoned by the machine) A register for OM group OTS that counts incoming call attempts abandoned by the machine. The calls are abandoned before they connect to terminating traffic, outgoing traffic, a tone, an announcement, lockout status, or feature activation/deactivation.

INCATOT (Incoming attempts total) A register for OM group TRK that counts incoming seizures on a trunk group, including seizures that fail or that the system abandons before routing. The system generates this register for all office types that are correct. For DMS-MTX switches, this register increases when the system attempts to originate on an MTX trunk group. The system attempt includes handoff attempts for an originat- ing mobile. This system can assign a maximum of eight MTX trunk groups to a cell site. The register can increase a maximum of eight times for a single origination, one time for each group.

INCFSET (Incoming to custom calling features) A register for OM group OTS that counts incoming call attempts that activate or deactivate a custom calling feature. This register also reflects the number of message waiting indicator requests received by the voice message retrieval system (VMRS). Register INCFSET currently has a value of zero. Note: This register does not increase in the POTS environment or in DMS-300 Gateway offices.

INCLKT (Incoming to lockout) A register for OM group OTS that counts incoming call attempts that fail to connect or receive a treatment. The call attempts route to lockout.

INCOUT (Incoming to outgoing connections) A register for OM group OTS that counts incom- ing call attempts that connect to an outgoing trunk.

INCTRM (Incoming to terminating connections) A register for OM group OTS that counts incoming call attempts that terminate to a line. A line termination is the connection of a busy tone when a line is busy. Register INCTRM counts line terminations.

INCTRMT (Incoming to a treatment) A register for OM group OTS that counts incoming call attempts that route to a tone or an announcement because of an error condition.

INCOM Recording Coming in on Toll.

INCOM Register Incoming Register.

incoming call A call initiated in another office and incoming to the office being considered.

incoming matching loss (IML) 1. Unit of measurement used to express the degree of failure to match, while attempting to setup a connection between an incoming trunk and a called line in Number 5 Crossbar central offices. 2. The loss of a call completion because an incoming call to the switching equipment could not find an idle path from the incoming trunk to the called subscriber line.

incoming traffic Traffic entering a network generated by sources outside it, whatever its destination.

incoming trunk busy (ITB) A network management feature which restricts incoming attempts to access an overloaded switch by selectively removing from service a proportion of incoming trunks.

2001-8.0-RFM03-0302 Glossary 127

INCP Change of numbers or disconnect.

INCPGRES (Incorrect Page Responses) A register for wireless OM group ICPCP that pegs when a page response message is received by the ICP and the electronic serial number (ESN) and mobile identification number (MIN) of the subscriber unit do not match the expected values.

INCP LIVE Intercept.

increment Increase a variable by a specified amount.

incremental backup Backup that only copies files that have not already been backed up.

index A table of reference, held in storage in some sequence, that may be accessed to obtain the addresses of other items of data.

inf Information.

INFAIL (Incoming failures) A register for OM group TRK that counts when any one of the following events occurs on a trunk that has originated a call or appears to have originated a call: - permanent signal - partial dial timeouts and false starts - bad digits, including bad signaling terminal (ST) digit - any originations on one-way outgoing trunks - lost integrity on the network path while connected to a service circuit or to another trunk before answer - failure to attach a receiver after two attempts - receiver queue overflow - receiver queue wait time-out - failure to time-out after 30 s while waiting for a multifrequency receiver - progress message of a type not expected in the current call environment - force-release before connection These events can indicate a need for maintenance action. These events can result in call failure if a call was in progress. This register generates for office types that are correct.

infinite loop A set of instructions that continuously repeat in a program. A loop that has no exit condition.

INFOANLZ (Info_Analyzed Message) A register for OM group CAINMSGS that counts Info_Analyzed messages sent to the SCP by the UCS DMS-250 switch.

INFOCOLL (Info_Collected Message) A register for OM group CAINMSGS that counts the number of Info_Collected messages sent to the SCP. information bits In telecommunications, those bits that are generated by the data source and do not include error control bits. information board/desk Position(s) manned by operators solely for the purpose of providing information and intercepting service for the public. information processing The totality of operations performed by a computer. It includes evaluating, analyz- ing, and processing data to produce usable information. information science The study of how people create, use, and communicate information in all forms.

INI 1. Initialization. 2. Total Initialization (DMS-10 OPM008).

2001-8.0-RFM03-0302 Glossary 128

INITDENY (Call Originations Denied, cold and warm restarts) A register for OM group CP that counts line and trunk call originations that are lost during cold and warm restarts.

initialization string A character string that “wakes up” a modem; such a string usually precedes dialing commands. A typical modem initialization string consists of AT (for Attention).

INLBOVFL (Incoming Long Buffer Overflow) A register for OM group CP that counts requests for a long buffer for incoming long messages that are unsuccessful because there were no free long buffers in the system.

INLBSZ (Incoming Long Buffer Seizures) A register for OM group CP that counts the success- ful requests that incoming long messages make for long buffers.

INLKT (Incoming Calls to Lockout) A register for OM group OFZ that counts incoming calls that fail and that the system routes to lockout. The call fails for one of the following reasons: - the incoming trunk loses its true identity - the system cannot connect the call to a tone or announcement - a forced release initiates manually - a forced release initiates because call processing requests a delay

INLNPINF (Local Routing Number On Local Number Portability) A register for OM group CAINLNP that pegs when the FCI bits on an incoming ISUP call indicated that LNP has been performed by a previous switch.

INNC Incoming Noncompleting.

INode Integrated Node

INOG Incoming Outgoing (tandem).

INOUT (Incoming to Outgoing) A register for OM group OFZ that counts incoming calls from the following: trunks, present conferences, originating test lines, auxiliary operator services system (AOSS) positions, and terminating ARTER trunk test facilities that the system routes at the start to trunks, TOPS, or AOSS positions.

input The introduction of data from an input device or auxiliary storage device into a computer’s main storage unit.

input/output (I/O) operations The process of transmitting data to and from the processor and its peripherals.

inquiry A request for data from storage.

INRTERM (Incoming routed to terminating) A register for OM group SITE that counts incoming calls that the system first routes to a line at a remote site.

insertion point The insertion point in a full-screen editor or drawing program is the place where characters will appear if you start typing. The insertion point is usually indicated with a cursor or a thin vertical bar.

INT Interstate.

INTCP PCO Dialing an unassigned code.

integrate The process of putting various components together to form a harmonious computer

2001-8.0-RFM03-0302 Glossary 129

system. integrity The preservation of programs or data for their intended purpose.

Intel Intel produces the 8088 microprocessor that is used in the IBM PC and other computers. The 8088 processor has 16-bit internal registers. intelligence Processing capability. interactive system In an interactive computer system the user communicates with the computer through a keyboard and a CRT screen. The computer presents the results almost immediately after an instruction has been entered, and the user can type in new instructions after seeing the results of the previous ones. intercept To stop a telephone call directed to an improper telephone number, and redirect that call to an operator or a recording. interchange circuits A circuit between the DTE and DCE for purposes of exchanging data and signaling information. interexchange Includes services or facilities provided as an integral part of interstate or foreign telecommunications that is not described as access service. interexchange carrier (IEC) or interexchange common carrier Any individual, partnership, association, joint-stock company, trust, entity or corpora- tion engaged for hire in interstate or foreign communication, by wire or radio, between two or more exchanges. interexchange channel A circuit which includes the interexchange transmission equipment. interface The point of meeting between a computer and a person, peripheral device, or communications medium. An interface may be physical involving a connector, or logical involving software. inter-LATA Communications between two geographic areas established by the exchange carrier for the provision and administration of service defined as a LATA. interlocal trunk A circuit between two local central office units, either manual or dial. Interlocal trunks may be used for either exchange or toll traffic or both. intermittent error An error that occurs intermittently and is extremely difficult to reproduce. Usually it occurs frequently enough to cause degradation of service. internal traffic Traffic originating and terminating within the network considered. inter-office trunk Used in the broad generic sense, this term refers to any trunk connecting two switching machines or offices, as opposed to an intra-office trunk, which connects switching points within the same office. As a specific term, inter-office trunk refers to a flat rate or free service trunk between offices in the same exchange. interrupt An instruction that causes the microprocessor to put aside what it is doing and call a specified routine.

INTERSIT (Intersite) A register for OM group SITE that counts counts the calls that the system routes to a line at another site for calls that originate at the following locations: - a remote line module (RLM) - a remote line concentrating module (RLCM)

2001-8.0-RFM03-0302 Glossary 130

- a remote switching center (RSC) - a remote concentrating terminal (RCT) Register INTERSIT increases: - before the system makes an attempt to set up network connections between the two lines - before the originating office determines if the called line is busy or otherwise unavailable

interstate Crossing state lines, or between states.

interstate communicationsBoth interstate and foreign communications.

interstate MTS/WATS Services provided under American Telephone and Telegraph Company, Long Lines Department Tariff FCC No. 263 and American Telephone and Telegraph Company, Long Lines Department Tariff FCC No. 259, or its successor company and/or succes- sor tariffs.

intertoll Trunk and equipment used between two toll offices.

INTM Incoming Terminating (incoming trunks).

INTONE (Incoming call to a tone) A register for OM group OFZ that counts incoming calls system routed to a tone.

INTR Interrupt.

intra-LATA Communications within a geographic area established by the exchange carrier for the provision and administration of service defined as a LATA.

intra-office Equipment used within the same switching center or central office.

INTRASIT Register INTRASIT (intrasite) counts calls that originate at an RLM, RLCM, RSC, or RCT that the system routes to another line at the same remote site. Register INTRASIT increases: - before the system makes an attempt to set up network connections between the two lines - before the originating office determines either the called line is busy or otherwise unavailable

intrastate Within the boundaries of a state.

intrastate communicationsAny communications within a state subject to oversight by a state regulatory com- mission as provided by the laws of the state involved.

INTRM (Incoming to Terminating) A register for OM group OFZ that counts incoming calls that are system routed to a line.

INVAUTH (Invalid authorization code) A register for wireless OM group TRK that counts authorization codes that are not correct. The system generates register INVAUTH in office types OFF250, OFF250IBN, OFFMTX100I, OFF500, OFFCOMBLWNand OFFCOMB300. However the register is primarily pegged when the office type is set to OFF250IBN.

INVDVCC (Invalid Digital Voice Color Code) A register for wireless OM group ICPDCP that pegs wehn the serving subcell receives an invalid DVCC message from a digital-capable subscriber unit.

2001-8.0-RFM03-0302 Glossary 131

INVDTOP The number of calls that were routed to an operator due to too many invalid DTMF responses. The call is routed to an operator when the retry limit Billing_Reject_Err is reached (table USER INTERACTION). This count is pegged only if Billing_Acceptance_Validation is set to DTMF.

INVSATDT (Invalid Supervisory Audio Tone Detected) A register for wireless OM group ICPCP that pegs when an ICP receives a supervisory audio tone (SAT) failure message. inward Trunk group that terminates on an inward toll switchboard that will allow any other operator to complete a call via the inward operator over a universal inward number.

INWATS Inward Wide Area Telephone Service. A service which allows other telephone users to call particular numbers without being charged. The charges are met by the called subscriber on a bulk time basis.

IO Intra-nodal Origination (Stromberg-Carlson).

I/O Input/Output.

IOD Input/Output Device.

I/O port A connection to a central processing unit (CPU) that provides for data paths between the CPU and peripheral devices.

IPABORT A register for OM group CAINIP the number of Resource_Clear messages with a ClearCause value of “abort”.

IPAUNLEG A register for OM group CAINIP the number of Resource_Clear messages with a ClearCause value of “unasweredLeg”.

IPCAPFL A register for OM group CAINIP the number of Resource_Clear messages with a ClearCause value of “capabilityFailure”.

IPCHBSY A register for OM group CAINIP the number of Resource_Clear messages with a ClearCause value of “channelsBusy”.

IPCTRCAN A register for OM group CAINIP the number of Resource_Clear messages with a ClearCause value of “ctrCancelled”.

IPFAIL A register for OM group CAINIP the number of Resource_Clear messages with a ClearCause value of “failure”.

IPINVCOD A register for OM group CAINIP the number of Resource_Clear messages with a ClearCause value of “invalidCallerResponse”.

IPINVCRS A register for OM group CAINIP the number of Resource_Clear messages with a ClearCause value of “invalidCode”.

IPINVLEG A register for OM group CAINIP the number of Resource_Clear messages with a ClearCause value of “invalidLeg”.

IPIPTMO A register for OM group CAINIP the number of Resource_Clear messages with a ClearCause value of “ipTimeout”.

IPISDNTO A register for OM group CAINIP the number of Resource_Clear messages with a ClearCause value of “isdnTimeout”.

2001-8.0-RFM03-0302 Glossary 132

IPPROTER A register for OM group CAINIP the number of Resource_Clear messages with a ClearCause value of “protocolError”.

IPTDISC A register for OM group CAINIP the number of times the TDISC timer has expired.

IPTSTRC A register for OM group CAINIP the number of times the TSTRC timer has expired.

IPSUPINV A register for OM group CAINIP the number of Resource_Clear messages with a ClearCause value of “suppServiceInvoked”.

IPTMPFL A register for OM group CAINIP the number of Resource_Clear messages with a ClearCause value of “temporaryFailure”.

IPUABNDN A register for OM group CAINIP the number of Resource_Clear messages with a ClearCause value of “userAbandon”.

IPNORMAL A register for OM group CAINIP that counts the number of Resource_Clear messages with a ClearCause value of “normal”.

IPRESCAN A register for OM group CAINIP the number of Resource_Clear messages with a ClearCause value of “resourceCancelled”.

IPRESNAV A register for OM group CAINIP the number of Resource_Clear messages with a ClearCause value of “isdnNotAvailable”.

IPRESTNS A register for OM group CAINIP the number of Resource_Clear messages with a ClearCause value of “resourceTypeNotSupported”.

IPS 1. Initial Position Seizures. 2. A traffic office measurement of the number of calls intially routed to operators in a particular team. It marks a call for the queue in which the call arrives. Also includes delay calls.

IPSTRCAN A register for OM group CAINIP the number of Resource_Clear messages with a ClearCause value of “strCancelled”.

IPTMO A register for OM group CAINIP that counts the number of Resrouce_Clear messages with a ClearCause value of “timeout”.

IPTSKRFS A register for OM group CAINIP the number of Resource_Clear messages with a ClearCause value of “taskRefused”.

ISCONBAD (ISUP Bad) A register for wireless OM group ISUPCONN that pegs call attempts that fail during call setup. When a call attempt fails during call setup, the originating office receives a release message instead of an address complete message.

ISCONCOT (ISUP Continuity) A register for wireless OM group ISUPCONN that pegs when a call fails the first continuity check test initiated by the continuity check request (CCR) message. The CCR message performs an automatic recheck 10 seconds after the first continuity check failure.

ISCONFAR (ISUP Facility Request) A register for wireless OM group ISUPCONN that pegs when a failure occurs because there is no response to the second attempt to send a facility request message.

ISCONICC (ISUP Continuity Check) A register for wireless OM group ISUPCONN that pegs when a call receives a continuity check test. This count is made at the office that performs

2001-8.0-RFM03-0302 Glossary 133

the continuity check test requested by the initial address message.

ISCONINR (ISUP Information Request) A register for wireless OM group ISUPCONN that pegs when a failure occurs because there is no response to the second attempt to send an information request message.

ISCONUCA (ISUP Unsuccessful Address) A register for OM group ISUPCONN that pegs when a call attempt is unsuccessful because another office has determined that the number is not in a valid format or is incomplete.

ISCONUCB (ISUP Unsuccessful Busy) A register for wireless OM group ISUPCONN that pegs when a call attempt is unsuccessful because the called party is busy.

ISCONUCC (ISUP Unsuccessful Circuit) A register for wireless OM group ISUPCONN that pegs when a call attempt is unsuccessful because there are no appropriate idle circuits in another office to handle the call.

ISCONUCE (ISUP Unsuccessful) A register for wireless OM group ISUPCONN that pegs when a call attempt is unsuccessful because switching equipment in another office is handling too many calls.

ISCONUCF (ISUP Unsuccessful Faults) A register for wireless OM group ISUPCONN that pegs when a call attempt is unsuccessful because of a temporary fault in the network at the far-end office.

ISCONUCN (ISUP Unsuccessful Numbers) A register for wireless OM group ISUPCONN that pegs when a call attempt is unsuccessful because the dialed number is a blank directory number in the far-end office.

ISCONUCO (ISUP Unsuccessful Other) A register for wireless OM group ISUPCONN that pegs when a call attempt is unsuccessful due to reasons other than the following: - destination out-of-service faults - called party busy condition - unallocated numbers - temporary faults - incomplete address - unavailability of circuit - switching equipment congestion

ISCONUCS (ISUP Unsuccessful Service) A register for wireless OM group ISUPCONN that pegs when a call attempt is unsuccessful because of an equipment failure at the far-end office or because the called party’s directory number has been disconnected or is out of service.

ISDDMSG (Incoming start-to-dial delay (ISDD) message) A register for OM group ISDD that increases when the CC receives an ISDD message from an XPM.

ISDN Integrated Services Digital Network. Switched network providing end-to-end digital transparency where voice and data services are provided over the same transmission and switching facilities. ISDN service began in the U.S. in 1988 and will eventually replace conventional telephone service.

ISDX Integrated Services Digital Exchange.

ISERRBAD (ISUP error bad) A register for wireless OM group ISUPERRS that pegs when a message is received in an inappropriate situation. Examples include: - an REL or RLS message received on an idle circuit

2001-8.0-RFM03-0302 Glossary 134

- a blocking message received for a blocked circuit - an unblocking message received for an unblocked circuit - an unexpected blocking acknowledgment message - an unexcpected unblocking acknowledgment message - any other unreasonable message received after the initial address message has been sent - an invalid message

ISERRBLO (ISUP Error Blocking Message) A register for wireless OM group ISUPERRS that pegs when an acknowledgment message is not received within one minute of sending blocking/unblocking messages at 4-15 second intervals. Intervals are determined by the blocking/unblocking maintenance timer. It pegs at the end of the one minute period.

ISERRREL (ISUP Error Release Message) A register for wireless OM group ISUPERRS that pegs when circuits are released in outgoing offices because of one of the following abnormal conditions: - No address complete message (ACM) is recieved within 20 to 30 seconds of an initial address message sent by this office. - An RLF message is received after an ACM and before an answer message. - A circuit is released in an incoming office because no continuity message (if applicable) is received at the incoming office after receipt of the initial address message.

All abnormal conditions listed above cause the release of circuits in transit offices because they are both incoming and outgoing offices.

ISERRGRS (ISUP Error Reset Circuit Group) A register for wireless OM group ISUPERRS that pegs when a reset circuit group acknowledgment (GRA) is not received within one minute of sending a GRS message. GRS messages originate from the switch only after cold and reload system restarts.

ISERRRLC (ISUP Error Release Complete Message) A register for wireless OM group ISUPERRS that pegs when an RLC message is not received within one minute after an REL message is sent. The REL message is repeated every 4 to 15 seconds, as determined by the REL timer, for up to one minute from the initial REL message.

ISERRRSC (ISUP Error Reset Circuit Message) A register for wireless OM group ISUPERRS that pegs when an RLC message is not received within 60 seconds of sending an RSC message. An initial RSC message is sent, followed by RSC messages every 4 to 15 seconds (determined by the RSC timer). The RSC message is repeated every 60 seconds until an RLC message is received or maintenance personnel intervene. This register pegs every 60 sedonds as long as an RSC message is sent again.

ISGCPU ISDN services group CPU occupancy. See also OM group ISGCPU for an extended description and field names.

ISGOVLD ISDN services group overload. See also OM group ISGOVLD for an extended description and field names.

ISMAT Individual Satellite Number Termination Attempts. Count made when starting attempt to terminate to satellite line. Call may have originated from line or trunk.

ISMSGIN (ISUP Messages Incoming) A register for wireless OM group ISUPUSAG that pegs when ISUP messages are received at the office, including incoming messages passing through a transit (tandem) office. Each type of incoming ISUP message is pegged separately. These measurements are collected in the message switch and buffer for

2001-8.0-RFM03-0302 Glossary 135

SS7 (MSB7) and sent to the CCC every 15 seconds or when at least one count reaches the maximum value of 255.

ISMSGIN2 An extension register for ISMSGIN2.

ISMSGOT2 An extension register for ISMSGOUT.

ISMSGOUT (ISUP Messages Outgoing) A register for wireless OM group ISUPUSAG that pegs when ISUP messages are sent from an office, including messages passing through a transit (tandem) office. Each type of ISUP message is pegged separately. Maintenance messages are counted in the central control complex (CCC) and outgoing call processing messages are collected in the digital trunk controller (DTC) and sent to the control module (CM) every 15 seconds or when at least one count reaches the maximum value of 255.

ISMUS Individual Satellite Number Termination Usage. Terminating usage of satellite line.

ISO International Standards Organization.

ISOSZ Individual Satellite Number Origination Seizures. Off-hook requests for service from satellite line. Count made when starting attempt to connect dial tone.

ISOUS Individual Satellite Number Origination Usage. Originating usage of satellite line.

ISR Information Storage and Retrieval.

ISSN Integrated Special Services Network.

ISTOTATT (Total intraswitching call attempts) A register for OM group RLCDIS that counts intraswitch call attempts that occur in an RLCM or IRLCM, including the following components: intraswitched calls when the same unit of the RLCM or IRLCM services both the calling and called parties; intraswitched calls when different units of the RLCM or IRLCM service the calling and called parties; call attempts that the system blocks because all intraswitching channels are busy.

ISTOTBLK (Total intraswitching calls blocked) A register for OM group RLCDIS that counts when the system blocks an intraswitched call attempt in RLCM or IRLCM because intraswitch channels are not available. It counts intraswitched calls if the same unit or different units of RLCM or IRLCM service both calling parties.

ISTOTTRU (Total intraswitching channels traffic busy usage) A usage register (100 s scan rate) for OM group RLCDIS that records if intraswitch channels are in use within units or between units of an RLCM or IRLCM. The results are accumulated in the remote and the counter is updated in the CM every 15 minutes.

ISUN0ATT (Total intraswitching unit 0 call attempts) A register for OM group RLCDIS that counts intraswitched call attempts that occur when unit 0 of an RLCM or IRLCM services calling and called parties. It also counts calls that the system interswitches in unit 0 and calls that the system blocks in unit 0 because all intraswitch channels are busy.

ISUN0BLK (Total intraswitching unit 0 calls blocked) A register for OM group RLCDIS that counts when the system blocks an intraswitched call attmept in unit 0 or RLCM or IRLCM. The system blocks the call because intraswitch channels are not available.

ISUN0TRU (Total intraswitching unit 0 calls busy usage) A usage register (100 s scan rate) for OM group RLCDIS that counts if intraswitch channels are in use in unit 0 of an RLCM

2001-8.0-RFM03-0302 Glossary 136

or IRLCM. The results are accumulated in the remote and the counter is updated in the CM every 15 mintues.

ISUN1ATT (Intraswitched unit 1 call attempts) A register for OM group RLCDIS that counts intraswitched call attempts that occur when unit 1 of an RLCM or IRLCM services calling and called parties or calls that the system intraswitches in unit 1. It also counts calls that the system blocks in unti 1 because all intraswitch channels are busy.

ISUN1BLK (Intraswitched unit 1 calls blocked) A register for OM group RLCDIS that counts when the system blocks an intraswitched call attempt in unit 1 or RLCM or IRLCM. The system blocks the call because no intraswitch channels are available.

ISUN1TRU (Intraswitched unit 1 traffic busy usage) A usage register (100 s scan rate) for OM group RLCDIS that counts if intraswitch channels are in use in unit 1 of an RLCM or IRLCM. The results are accumulated in the remote and the counter is updated in the CM every 15 minutes.

ISUP ISDN user part performance.

ISVC Incoming Service.

IT Intertoll: Trunks in this category interconnect switching machines with an office class of 1 to 4 inclusive. This category also includes groups that interconnect a local tandem (Class 0) and a higher order switching machine for completion of TSPS traffic.

ITB Incoming Trunk Busy.

ITC Independent Telephone Company.

ITDM Intelligent Time-Division Multiplexer.

ITDN Integrated Telephone & Data Network.

ITR trunk Inter-office trunk.

ITT International Telephone & Telegraph Corp.

IWMAT Individual Line Switch Number Termination Attempts. Count made on starting attempt to terminate to LS line. Does not include revertive call attempts.

IWMUS Individual Line Switch Number Termination Usage. Terminating usage of LS line. Does not include revertive call usage.

IWOSZ Individual Line Switch Number Origination Seizures. Off-hook request for service from LS line. Counted when starting attempt to connect dial tone.

IWOUS Individual Line Switch Number Origination Usage. Originating usage of LS line.

IX Interexchange.

IX carrier Interexchange carrier, which provides connections between exchanges.

jack A connecting device to which a wire(s) of a circuit may be attached and that is arranged so that a plug may be inserted to make electrical contacts.

2001-8.0-RFM03-0302 Glossary 137

jacket 1. A floppy disk is encased in a stiff plastic jacket which contains holes giving the disk drive access to the information on the disk. The disk should never be removed from the jacket. 2. The outer protective sheath of a cable.

JCTR Junctor group.

jitter Signal instability.

JRTS 1. Junctor Time Slot Pairs. 2. Faulty Junctor Time Slot Pair (DMS-10 OPM008).

JTSS Jurisdictional Traffic Separations Systems.

Julian date A chronological date in which days of the year are numbered in sequence. The Julian date indicates the year and the number of elapsed days in the year. jumper A means of connecting two pieces of equipment together for an undetermined period of time. Normally a jumper is used for connections of equipment or assign- ments on a frame. junctor group A special trunk group that provides talking channels between networks or frames in a crossbar or electronic switching architecture. junk Refers to garbled data received over a communications line. If proper communication is not established with a remote system, random, meaningless characters (junk) may appear on the screen.

K Short for kilobyte, which is approximately 1,000 bytes. The symbol for the unit used to measure the size of a computer’s memory. A computer with 1K of memory can store 1,024 characters. The maximum memory size (without bank switching) is 64K for older eight-bit systems and 640K for the IBM PC. Some more recent microcom- puters have several megabytes of memory.

KB Kilobyte, 1,024 bytes.

KBD See keyboard. key 1. The buttons on a keyboard are called keys. 2. The item by which a data file is sorted or searched is called the key. 3. The password or other secret information needed to decode an encrypted message is called the key. 4. To enter data into a system by means of a keyboard. keyboard An input device used to key programs and data into the computer’s storage. keypad See numeric keypad. key pulse System of signaling where keys are used in place of a dial on a switchboard. key-to-diskette A data entry device used to manually record data onto a floppy disk. killer trunk A trunk circuit within a trunk group that appears to be idle, but cannot successfully carry calls because of malfunctioning equipment or wiring error unique to that trunk. kilo Prefix meaning one thousand. kilobit One thousand bits.

KSDLY A register for OM group DTSRPM that counts the total number calls on lines with

2001-8.0-RFM03-0302 Glossary 138

key-set signaling that have a 3 second dial tone delay during a given period of time.

KSTOT A register for OM group DTSRPM that counts the total number calls on lines with key-set signaling during a given period of time.

LAMA Local Automatic Message Accounting.

LAN See Local Area Network.

LAPB Link Access Procedure (Balanced).

last trunk busy (LTB) A count of the number of times the last trunk was busy in a graded group or subgroup of trunks.

LATAs See Local Access and Transport Areas.

LB Line Bidirectional.

LCD See Liquid Crystal Display.

LCMDP_D (Line Concentrating Module Dial Pulse Delay) A register for OM group SITE that counts calls that experience dial-tone delays that exceeds 3 s for dial pulse lines on LCM-based remote sites. The system updates this register every 15 min before the OM transfer process. A high count in this register indicates high switch use, trouble on the LCM-based remote sites, or a blocked channel.

LCMDP_D2 An extension of register LCMDP_D in OM group SITE.

LCMDP_T (Line Concentrating Module Dial Pulse Total) A register for OM group SITE that counts calls on dial pulse lines on LCM-based remotes. The system updates the register every 15 min before the OM transfer period.

LCMDP_T2 An extension of register LCMDP_T in OM group SITE.

LCMDT_D (Line Concentrating Module Digitone Delay) A register for OM group SITE that counts calls for Digitone lines on LCM-based remotes that experience one of the following conditions: - dial tone delays that exceeds 3 s - DTMF receiver queue overflow The system updates this register every 15 min before the OM transfer process. A high count in this register indicates: - high switch use - trouble on LCM-based remotes - channel blockage - not enough DTMF receivers

LCMDT_D2 An extension of register LCMDT_D in OM group SITE.

LCMDT_T (Line Concentrating Module Digitone Total) A register for OM group SITE that counts calls that are on Digitone lines on LCM-based remotes. The system updates this register every 15 min before the OM transfer process.

LCMDT_T2 An extension of register LCMDT_T in OM group SITE.

LCMKS_D (Line Concentrating Module Key-driven Set Delay) A register for OM group SITE that counts calls for key-driven set lines on LCM-based remote sites that experience a dial- tone delay exceeding 3 s. Some examples of key-driven lines are business sets and

2001-8.0-RFM03-0302 Glossary 139

data units. The system updates this register every 15 min before the OM transfer process. A high count in this register indicates high switch use, trouble on the LCM- based remote, or a channel blockage.

LCMKS_D2 An extension of register LCMKS_D in OM group SITE.

LCMKS_T (Line Concentrating Module Key-driven Set Total) A register for OM group SITE that counts test calls on key-driven set lines on LCM-based remotes. The system updates this register every 15 min before the OM transfer process.

LCMKS_T2 An extension of register LCMKS_T in OM group SITE.

LCR 1. Least Cost Routing. 2. Locating Receiver Request.

LCRREQS (locating receiver requests) An analog register for wireless OM group OMMTXHO that counts when an LCR request message is sent by the switch to the target subcell.

LCRRESPS (locating receiver responses) An analog register for wireless OM group OMMTXHO that counts when the switch receives an LCR response message from the target subcell.

LD Long Distance.

LDI Long Distance Interstate.

LDIDEL (LDI delivered) A register for OM group CND that increases when the calling informa- tion delivered to the subscriber has call qualifier L, indicating a long-distance call. This register does not apply to ISDN sets. This register is not supported on the DMS 100G switch.

LDIDEL2 An extension register for LDIDEL.

LDIOVFL (LDI overflow) A Canada-only register for OM group CND that increases when the long-distance call qualifier is not sent to the subscriber. The qualifier is not sent to the subscriber because room in the multiple data message is not present. This register does not apply to ISDN sets. This register is not supported on the DMS 100G switch.

LDMTS Long Distance Message & Telecommunications Service.

LDS Long Distance State.

LEAVETDP A register for OM group CAINTRIG that counts the number of times a CAIN call has LEAVE_TDP datafilled as tthe trigger action in the trigger table. Call processing continues, at this current TDP (Trigger Detection Point) without any remaining triggers.

LEC Local Exchange Carrier.

LED Light-Emitting Diode. level The vertical step from 1 through 0, reached by a step-by-step selector in response to the digit dialed into the selector. Each working level of a selector bank is connected to an intra- or inter-office trunk group. level hunting connector A connector that has the capability of searching over ten trunks that may serve one trunk hunting subscriber.

2001-8.0-RFM03-0302 Glossary 140

LG Line Group.

library A collection of files, computer programs, or subroutines. A loader library is a file containing subroutines that can be link-edited into a machine language program.

LID Line Identification.

LIFO Last In, First Out.

LINABAN (Line call abandons) A register for OM group LINAC that counts calls in a line concentrating module (LCM) that abandon before the dial tone receives.

LINCAT (Line call attempts) A register for OM group LINAC that counts call attempts in an LCM.

LINCATF (Line call attempt failures) A register for OM group LINAC that counts call attempts from an LCM that fail to receive a response from the central control (CC).

line 1. The two wires from a telephone set that connect a subscriber to the central office. 2. Communications channel. 3. A subscriber’s line or a toll line. 4. Line Out of Service (DMS-10 OPM008).

LINEATT (Register Line Attempts) A register for OM group HPCBASIC that counts the number of line origination attempts (including PX, P2, and PRI), recognized as HPC calls on lines served by the measuring switch.

Line By Line Busy.

line equipment The circuit that provides a path from a line to reach dial tone.

linefinder The first switch used when originating a call in a step-by-step central office. A group of linefinders, usually from 16 to 22 in number, serve a group of 200 lines. When a subscriber lifts their handset, a linefinder is assigned to find their line and attach it to a 1st selector, which furnishes dial tone and accepts the first digit dialed.

linefinder shelf Shelf that contains group relays, distributor, etc., and enables a linefinder switch to operate.

linefinder switch The first switch to operate in a step-by-step switch train that connects the subscriber’s line equipment to dial tone, thus providing an outward dialing path.

line monitor A device that displays transmitted data.

line of code A statement in a programming language usually occupying one line of code.

line printer A high-speed printer for computer output. A line printer consists of a separate chain of type elements for each column, so it is capable of printing an entire line of output at one time. Fast line printers are capable of printing output at rates of up to 1,400 lines per minute.

line seizures Call attempts receiving dial tone.

line side connection A connection of a transmission path to the line side of a local exchange switching system.

line speed The maximum rate at which signals may be transmitted over a given channel, usually in baud, or bits per second.

2001-8.0-RFM03-0302 Glossary 141

lines by class of service 1. 1B One-Party Business. 2. 1R One-Party Residence. 3. 2B Two-Party Business. 4. 2R Two-Party Residence. 5. 4B Four-Party Business. 6. 4R Four-Party Residence. 7. Suburban All over four parties. 8. Multi-party Same as Suburban. 9. Public Telephone Coin Station. 10. PBX Private Branch Exchange. link In data communications, a physical connection between one location and another whose function is to transmit data.

LINTDEL (Line access dial tone delay) A register for OM group LINAC that counts the total dial tone delay time for all calls from an LCM that receive a dial tone during the XPM OM transfer period. Dial tone delay is the time between a subscriber going off-hook and hearing dial tone. The system reports the value in LINTDEL in tenths of a second. liquid crystal display (LCD) The type of display found on many portable computers.

LIU7 Link Interface Unit

LF See Linefinder.

LFPC Linefinder Peg Count.

LK See Link.

LL 1. Line-to-Line. 2. Long Lines.

LLA’S Line equipment.

LLB’S Matrix, from one line to another.

LM Line Termination.

LMATTS (Land to Mobile Call Attempts) A register for wireless OM group OMMTX that counts when a call is made to connect a land line trunk to a subscriber unit. This register counts against the target subcell after receiving a successful page response message. Calls from an operator are not included in this register. This register also pegs on the serving MSC (MSC-S) when a call delivery attempt is made to a subscriber unit that is roaming outside of its home system.

LMCCTDG (Line Module Circuit Diagnostics run) A register for OM group LM that counts line card diagnostic test sequences that run because call processing refers a problem to the maintenance system. The register increases after the diagnostic is complete.

LMCCTFL (Line Module Circuit Diagnostics Failed) A register for OM group LM that pegs when the line card diagnostic can find one of the following faults: - a peripheral module fault - a card fault - a facility fault - no card - the wrong card

LMCCTOP (Line Module Circuit Diagnostics Outside Plant) A register for OM group LM that pegs outside plant circuit failures. The failures are detected by one of the following: - system diagnostics - automatic line tests - line insulation tests

2001-8.0-RFM03-0302 Glossary 142

- long tests

LMCOMPS (land to mobile call attempts) A register for wireless OM group OMMTX that pegs when a call is completed from a land line trunk to a subscriber unit. This register pegs against the target subcell after a successful routing to a VCH in the switch, but does not imply the call has been answered. Calls from an operator are not included in this register. This register also pegs on the MSC-S on successful routing to a VCH when a call delivery is made to a subscriber unit that is roaming outside of its home system.

LMDP_D (Line Module Dial Pulse Delay) A register for OM group SITE that counts DTSR test calls for dial pulse lines on RLM that experience one of the following conditions: - a dial tone delay that exceeds 3 s - a previous DTSR test still in progress on the remote line module (RLM) The system initiates a test on an RLM at the site every 4 s. A high number of delayed calls means high switch use, RLM trouble, or a channel blockage.

LMDP_T (Line Module Dial Pulse Delay) A register for OM group SITE that counts DTSR test calls on RLM dial pulse lines and increases after the result of the test.

LMDT_D (Line Module Digitone Delay) A register for OM group SITE that counts counts DTSR test calls for Digitone lines on RLMs that experience one of the following conditions: - a dial tone that exceeds 3 s - a DTMF receiver queue overflow - a previous DTSR test still in progress on the remote line module (RLM) The system initiates a test on an RLM at the site every 4 s. A high number of delayed calls means high switch use, RLM trouble, or a channel blockage.

LMDT_T (Line Module Digitone Total) A register for OM group SITE that counts DTSR test calls for Digitone lines on the RLM. Register LMDT_T increases after the system deter- mines the result of the test.

LMERR (Line Module Errors) A register for OM group LM that pegs errors in an in-service LM. The register increases when an in-service LM does one of the following: - reports a software error, RAM parity failure, LM firmware error, or LM controller message congestion. - experiences an accuracy failure - fails a test during a routine or initializing audit. - puts up a WAI (who-am-I) flag, indicating that processing in the LM compeltely fails. - fails to respond to messages over either plane.

LMFLT (Line Module Faults) A register for OM group LM that pegs LM errors that leave the LM system busy. The system performs the count pending manual interruption or a successful system-initiated recovery attempt. Errors that are counted in LMFLT are also counted in LMERR.

LMMBP (Line Module Changes to man-busy) A register for OM group LM that pegs LM in an in-service or an in-service troulbe state that are made manual busy.

LMMBTCO (Line Module Man Busy Terminals Cut Off) A register for OM group LM that pegs terminals that are call processing busy, or in the call processing busy deload state, when the LM is manual busy. If a warm restart occurs, two-port calls are not cut off. If a restart does not occur, this register increases only once for the two terminals that are involved in a two-port call. When a warm restart occurs from a manual busy state, this register counts the terminals that are cut off.

2001-8.0-RFM03-0302 Glossary 143

LMMBU (Line Module Manual Busy Usage) A usage register for OM group LM that records if a line module is manual busy. It has a slow scan rate of 100 seconds.

LMSBP (Line Module Changes to System Busy) A register for OM group LM that counts LM in an in-service or an in-service trouble state that are made system busy.

LMSBTCO (Line Module Changes to System Busy) A register for OM group LM that counts terminals that are call processing busy, or in the call processing busy deload state, when the line module (LM) is system busy.

LMSBU (Line Module System Busy Usage) A usage register for OM group LM that records if an LM is system busy. LM’s are busy if they fail an audit of common control func- tions, are inaccessible, or more than 200 controller or line errors are reported within one 10-minute audit period.

LMBTRU (Traffic Busy Use) A usage register for OM group LMD that counts the number of lines that are call processing busy or call processing busy deloading. It has a scan rate of 100 seconds.

LNGGREET The number of times answering machine interaction is suspected. The number is incremented for the relevant key each time the value for the greeting length param- eter is exceeded.

LNMBPC (Line Manual Busy Peg Count) A register for OM group OFZ that counts manual busy lines.

LNP Local Number Portability.

LNPDISCD (LNP Discarded) A register for OM group CAINLNP that counts when LNP has been performed, but the information obtained must be discarded, since the terminating agent leaving the current switch is not ISUP.

LNPPORT (LNP Ported Number) A register for OM group LNP that counts the number of SCP responses to LNP SCP queries containing a Location Routing Number.

LNPPORT1 (LNP Ported Number Extension) An extension register for OM group LNP that counts the overflow from register LNPPORT.

LNPQESC (LNP Query Escaped) A register for OM group LNP that counts the number of calls that encounter an LNP trigger that does not launch a query to the LNP SCP.

LNPQESC1 (LNP Query Escaped Extension) An extension register for OM group LNP that counts the overflow from register LNPQESC.

LNPQFACG (LNP Query blocked by Automatic Call Gapping) A register for OM group LNP that counts the number of queris the ACG (Automatic Call Gapping) blocks.

LNPQFRTE (LNP Query Failure - SS7 Error) A register for OM group LNP that counts the number of SCP queries because of problems with Signaling System 7 (SS7)

LNPQFSCP (LNP Fatal protocol/Application Error in the Query Message) A register for OM group LNP that counts the number of calls that meet an LNP trigger that result in a failed LNP SCP query. The query fails because the SCP query message reports a fatal protocol error or application error.

LNPQFSSP (LNP Query Cannot Be Built) A register for OM group LNP that counts the number of queries the system cannot build.

2001-8.0-RFM03-0302 Glossary 144

LNPQFT1 (LNP Query Failure - T1 Timer Expiration) A register for OM group LNP that counts the number of calls that fail because of a T1 timer time-out. A T1 timer starts when the switch makes query to an LNP SCP. The switch queries the LNP SCP for a call that meets LNP trigger.

LNPQLRNA (LNP Query LRN tool - ACG Count) A register for OM group LNP that counts the number of times a user of the query-LRN command QLRN selected to override ACG controls.

LNPQLRNQ (LNP Query LRN tool - Count of Queries) A register for OM group LNP that counts the number of queries the query-LRN command QLRN sent.

LNPQLRNR (LNP Query LRN tool - Count of Responses) A register for OM group LNP that counts the number of responses for the query-LRN command QLRN.

LNPQLRNV (LNP Query LRN tool - Correct Count) A register for OM group LNP that counts the correct responses the query-LRN command QLRN receives.

LNPQRY A register for OM group LNP that counts the calls that meet an LNP trigger and result in an LNP SCP query.

LNPQRY1 A query extension register for OM group LNP that counts overflows from the LNPQRY register.

LNPQUERY (LNP Query) A register for OM group LNP that counts when the Service Switching Point (SSP) queries the Service Control Point (SCP) for LNP information.

LNPREL (LNP ISUP Release - cause 26) A register for OM group LNP that counts the number of LNP calls that cause an ISUP REL message with an ISUP cause value 26.

LNPRFCNT (LNP Continue Response Received) A register for OM group LNP that counts the number of continue responses the system receives from the SCP.

LNPRFDSC (LNP Disconnect Response Received) A register for OM group LNP that counts the number of disconnect responses that the system recieved.

LNPRFERR (LNP Response Failure) A register for OM group LNP that counts the number of calls that result in a failed LNP SCP query. The query fails becuase the response generates a fatal protocol error or because of an application error.

LNPRFSTR (LNP Send_To_Resource received) A register for OM group LNP that counts the number of send to resource responses that the system received.

LNPUADNR (LNP Unallocated Number on Donor) A register for OM group LNP that counts the number of LNP calls that meet an indication in the donor switch that is not allocated. This register also counts the number of LNP calls that meet an empty number indication in the donor switch. This indication follows an LNP query in this switch or another switch.

LNPAUHOM (LNP Unallocated Number on Recipient) A register for OM group LNP that counts the number of LNP calls that encounter an indication in the recipient switch that is not allocated. This register also counts the number of LNP calls that encounter an empty number indication in the recipient switch. This indication follows an LNP query in this switch or another switch.

LO Line Origination.

2001-8.0-RFM03-0302 Glossary 145

load Transfer information from a storage device into the computer. load balance Process of spreading demand sources over all servers to achieve statistical random- ness. load balance index (LBI) A unit of measurement used to express the degree of imbalance of equipment groups within a loading division. loading division One or more equipment groups (linefinders, connectors, originating junctors, etc.) in an entity having the same class of service and the same CCS traffic load capacity. loading division busy hour (LDBH) The hour for which the traffic CCS load of all equipment groups comprising a specific loading division is greatest. loading division code A three digit code (numeric) used to identify the number of trunks assigned to a specific originating or terminating equipment group.

Local Access and Transport Area (LATA) A geographic area established for the provision and administration of communica- tions service. It encompasses one or more designated exchanges, which are grouped to serve common social, economic, and other interests. The federal court, in breaking up the Bell System, approved the United States being divided up into 184 LATAs. A regional BOC handles all traffic within the LATA and must turn over all inter-LATA calls to an interexchange carrier to haul the calls across LATA boundaries. local area network (LAN) 1. Connects together several machines that are located nearby, allowing them to share resources such as storage devices and printers. 2. Communications path that connects all types of data within a local office or building complex. local call Any call within a local charging area. For traffic engineering purposes, it is a call to another number on the same central office. local exchange An exchange where subscribers’ lines are terminated. local line The subscriber local loop facilities connecting the end central office to the end-user premises. local message A completed local call. local office A central office serving primarily as a place of termination for subscriber lines and for providing telephone service to the subscribers on these lines.

LOCAL ORIG Dial tone. local recording A disconnected number.

Local Switching Equipment Category 3 Comprises all central office switching equipment not assigned to other categories. Examples of local switching equipment are basic switching train, toll connecting trunk equipment, interlocal trunks, tandem trunks, terminating senders used for toll completion, toll completing train, call reverting equipment, weather and time of day service equipment, and switching equipment at electronic analog or digital remote line locations. Equipment used for the identification, recording and timing of customer charge traffic, or switched private line traffic (e.g., transmitters, recorders, call identity indexers, perforators, ticketers, detectors, master timers) switchboards

2001-8.0-RFM03-0302 Glossary 146

used solely for recording of calling telephone numbers in connection with customer dialed charge traffic, or switched private line traffic (or both) is included in this local switching category. Equipment provided and used primarily for operator dialed toll or customer dialed charge traffic, except such equipment included in Category 2 Tandem Switching Equipment, is also included in this local switching category. This includes such items as directors, translators, sender registers, out trunk selectors, and facilities for toll intercepting and digit absorption. Special services switching equip- ment which primarily performs the switching function for special services (e.g., switching equipment, TWX concentrators and switchboards) is also included in this local switching category.

local tandem switch A local telephone company switching unit by which local or access telephonic communications are switched to and from an end office switch.

LOCAL TERM Local Terminating Call.

local testboard/desk Point of access into a central office to enable maintenance personnel to test both the inside and outside plant searching for subscriber reported trouble.

LOCFAILD The number of calls that cannot be identified as locality calls. A probable cause is the inability of the ACPE to communicate with the locality database.

LOCLKUP (Local Lookup) A register for OM group CNAMD that counts each time a TCAP name query is saved by using a local name lookup. This register is pegged as a line is allocated and a TCAP name query is not launched due to the local lookup activity. The validation formula is NAMTCPQ + LOCLKUP = the total number of TCAP name queries saved.

log Record events in chronological sequence.

log off To terminate connection with the computer system or network.

log on Sign onto a computer system or network and identify yourself as an authorized user.

LOH Length Of Haul.

loop 1. A pair of wires, or its equivalent, between a customer’s station and the central office from which the station is served. Originates from the concept of an electrical current path comprised of one conductor from the central office to the telephone and another conductor from the telephone back to the central office, thus forming a “loop.” 2. A loop in a computer program is a closed sequence of instructions performed repeatedly.

lost call A request for a connection which is rejected due to network congestion.

lost cluster In MOS-DOS (PC-DOS) and other operating systems, a lost cluster is a group of disk sectors that are not marked as free but are not allocated to a file. Lost clusters result when the operation of creating a file is interrupted. They waste space and should be cleaned up periodically; this is done with the CHKDSK/F command.

lost traffic That part of the traffic offered to a pool of resources which is not carried, and no additional resource is provided to handle such traffic.

low Low tone.

LPM Lines Per Minute.

2001-8.0-RFM03-0302 Glossary 147

LPO Local Processor Outage

LPTS 1. Loop Time Slots. 2. Faulty Loop Time Slot (DMS-10 OPM008).

LRNONLNP (Local Routing Number Portability On Ocal Number Portability) A register for OM group CAINLNP that is pegged when an LNPQUERY is made to the SCP and a response message is received containing the Local Routing Number (LRN) to be used for the call.

LSG Line SubGroup.

LT Line-to-Trunk.

LTB Last Trunk Busy.

LPHLDREC (Loop held recalls) A register for OM group IBNSG that counts when an attendant answers a recall held on a loop.

LPOVFL (Loop overflows) A register for OM group IBNSG that counts loops in a subgroup attendant consoles that are busy because the loop has held and queued calls. The calls wait for an attendant console to become free.

LPU (Loop usage) A usage register (10 s scan rate) for OM group IBNSG that records if the customer subgroup uses attendant loops.

LTT Line and Trunk Tester.

LW Leave Word: A trunk group provided from a switching machine to a switchboard which is accessed by distant switchboard operators by dialing a LW code.

M Abbreviation for mega, meaning one million.

MAC Multi-Access Computing. machine-dependent program A program that works on only one particular type of computer. machine language Machine language contains instructions that a computer can execute directly. Machine language statements are written in binary code and each statement corre- sponds to one machine action. machine-readable data Data recorded on any medium in such a way that it can be sensed or read by a machine. macro A single, symbolic programming language statement that, when translated, results in a series of machine language statements.

MADNTATT (Multiple Appearance Directory Number Secondary Member Terminating Attempts) A register for OM group LMD that counts secondary units of MADN groups in the PM that notify the system of an incoming call. magnetic bubble memory Memory that can be used in the same way as RAM but does not go blank when power to it is turned off. magnetic disk A disk made of rigid material.

MAHOATT (mobile-assisted handoff attempts) An analog register for wireless OM group

2001-8.0-RFM03-0302 Glossary 148

OMMTXHO that counts when a handoff is attempted to mobile assisted handoff (MAHO) selected (without digital locate receiver [DLR] measurements) handoff candidate.

MAHOCMP (mobile-assisted handoff completed) An analog register for wireless OM group OMMTXHO that counts when a handoff is successful when the target subcell is selected using MAHO-selected (without DLR measurements) candidate.

mainframe A very large computer typically supporting 100-500 users at a time.

main station 1. A primary (as opposed to an extension) telephone directly connected to a central office. 2. Primary extension in a PBX numbering plan.

maintenance control center The centralized control equipment of an ESS central office from which the telephone company’s operating and maintenance personnel may observe, monitor, and control the ESS performance.

malfunction A failure in the operation of the central processing unit or peripheral device.

malicious call A hateful, nuisance, or obscene call.

MAN Metropolitan Area Network.

MAP/TOP Manufacturing Automation Protocol/Technical and Office Protocol.

marginal circuit A circuit which is right on the margin of acceptability, particularly for its transmission parameters.

marker A switching control unit in a central office which locates the calling line and selects, marks, and tests paths through the office to the called line.

master Unit that controls the operation of one or more smaller (slave) units.

math Mathematics.

M-ATR Modified Answering Time Recorder.

matrix 1. That portion of a telecommunication switching system that connects lines and trunks with intra-switch communication paths as determined by the “control” portion of the system. 2. A simple switching network in which a specified inlet (matrix row) has access to a specified outlet (matrix column) via a crosspoint placed at the intersection of the row and column in question.

matrix printer Type of printer that forms letters and other symbols by printing a pattern of dots.

max Maximum.

MAXBU (Maximum busy circuits) A usage register (100 s scan rate) for OM group TRK that increases if the number of busy circuits exceeds the maximum number that the system recorded at an earlier time. The system generates register MAXBU only in DMS-250 offices.

MAX CCT Maximum Circuits.

MB Megabyte, 1,048,576 bytes.

2001-8.0-RFM03-0302 Glossary 149

MBLINCPT (Mobile Intercept) A register for wireless OM group ICPCP that pegs wehn an ICP sends an intercept message to the CCHs in response to an origination message from a subscriber unit. The intercept message is usually sent when a subscriber unit fails to pass verification.

MBLORG (Mobile Originations) A register for wireless OM group ICPCP that pegs when an ICP receives from the CCH an origination message from a subscriber unit.

MBLORGCO (Mobile Origination Completions) A register for wireless OM group ICPCP that pegs when an ICP receives a SAT present message from the CCH for an originating subscriber unit.

MBLREGR (Mobile Reorder) A register for wireless OM group ICPCP that pegs when an ICP sends a reorder message to the CCHs because there was an access attempt from a subscriber unit. A reorder message is usually sent when no voice channels are available to service the accessing subscriber unit.

MBLREGR (Mobile Registrations Received) A register for wireless OM group ICPCP that pegs when an ICP receives a registration message from a subscriber unit.

MBLTERCO (Mobile Termination Completions) A register for wireless OM group ICPCP that pegs when a call terminated to a subscriber unit and the subscriber unit successfully tunes to a voice channel, indicated by detection fo a SAT.

MBORIGS (Mobile Originations) A dual mode register for wireless OM group OMMTX that pegs when the switch receives a call origination message from the serving subcell. A call is not in progress at this time.

MBSCABDN A register for OM group CALLWAIT that counts when a calling party transferred by a line with the MBSCAMP feature, goes on-hook. The calling party must go on-hook before the called party answers. Register MSBCABDN increases if the recall timer expires and the MBSCAMP line is rung again when the calling party goes on-hook.

MBSCATT A register for OM group CALLWAIT that counts when a subscriber attempts a meridian Business Set camp on (MBSCAMP) call to a busy line.

MBSCFAIL A register for OM group CALLWAIT that counts when an MBSCAMP attempt fails because of feature interactions. This register also increases when call attempts fail overIBN7 as a result of feature interactions.

MBSEXMPT A register for OM group CALLWAIT that counts when a subscriber attempts Meridian Business Set camp on (MBSCAMP) call to a line that has the call-waiting exempt (CWX) option.

MBU (Maintenance busy usage) A usage register (100 s scan rate) if a trunk is in one of the following states: - manual busy - seized - network management busy The system generates register MBU for office types that are correct.

MCC See Maintenance Control Center.

MCCS Mechanized calling card service.

MCCSABN (Abandoned subscriber-dials MCCS) A register for OM group CDMCCS that increases when a subscriber abandons a MCCS call while call connects to the first DRAM

2001-8.0-RFM03-0302 Glossary 150

message.

MCCSACBF (Account code billing call failures MCCS) A register for OM group CDMCCS that increases when the MCCS cannot complete an account code billing call. The system cannot complete the call because of an account code or an error condition the DMS switch detects.

MCCSACBS (Account code billing calls MCCS) A register for OM group CDMCCS that increases when the MCCS completes an account code billing call.

MCCSATT (Subscriber dialed MCCS call attempts) A register for OM group CDMCCS that increases when a subscriber dials a 0+ call on a line and receives MCCS. The value in this register includes 0+ calls the system routes over trunks that have MCCS. If hardware problems occur with either the DRAM or an MCCS receiver, the system routes the call to a traffic operator position system (TOPS) operator.

MCCSFAIL (Subscriber dialed MCCS call failures) A register for OM group CDMCCS that in- creases when subscriber-dialed MCCS calls fail. Failure occurs because of hardware problems with the digital recorded announcement machine (DRAM) or with an MCCS receiver. If a hardware problem occurs with the DRAM or an MCCS receiver, the system routes the call to a (TOPS) operator.

MCCSOPR (Subscriber dialed MCCS call failures) A register for OM group CDMCCS that in- creases when the system routes a call to an operator because of a timeout. Register MCCSOPR also increases because the subscriber flashes the switchhook.

MCCSUCC (Subscriber dialed MCCS call failures) A register for OM group CDMCCS that in- creases when a subscriber successfully completes a credit card call.

MCI Microwave Communications, Inc.

MCKF Match Check Failure.

MCTAHRQF (MCTA handoff request full) A register for OM group CAUCPSCT that counts when there is an MCTA capacity request failure for a handoff; pegs on a sector basis.

MCTALLTO (MCTA all timeout) A register for OM group CAUCPSCT that counts when call MCTA capacity requests time out; pegs on a sector basis.

MCTALLFU (MCTA all full) A register for OM group CAUCPSCT that counts when all MCTA capacity is full; pegs on a sector basis.

MCTAREQF (MCTA request failure) A register for OM group CAUCPSCT that counts whenever responses are all full or requests all time out or are mixed; pegs on a sector basis.

MDO Main Dial Office.

MDF Main Distribution Frame.

MDR Message Detail Recording. MDR telecommunications expenses can be distributed fairly to all departments within a company.

mean time between failure A measure of the average life of a system component.

meas Measured.

2001-8.0-RFM03-0302 Glossary 151 med Medium. mega Prefix meaning one million. megabyte 1,048,576 bytes; or roughly one million bytes. megahertz A unit of electrical frequency equal to one million Hertz or one million cycles per second.

MEM 1. Memory. 2. Initialization Caused by Memory Fault (DMS-10 OPM008). memory Space within a computer where information is stored. The memory requirements of a computer are dictated by the software that is to be run on it. General purpose microcomputers usually have 64 to 640K of RAM. memory chips Memory is often added to a computer simply by plugging RAM chips into sockets. This entails checking the following things: 1. The type of memory chips required. Each chip holds a particular number of bits (e.g., 64K, 256K, or 1 megabyte). Some computers allow use of different types of chips (e.g., 64K or 256K) by setting a switch to indicate which kind are installed. Check that you actually have space to install additional chips; you may need to buy an additional board to hold them. 2. The number of chips needed. A byte is 8 bits (even on a 16- or 32-bit processor), so if you are adding 64K bytes of memory, you will need eight 64K chips to hold the data, plus (on most computers) a ninth 64K chip for parity checking. 3. The speed rating of the chips, typically 120 or 150 nanoseconds. This is a measure of how quickly the chip can return valid data to the CPU. If you install chips that are too slow, you will get memory errors; if your chips are faster than needed, you may be wasting money, because the CPU controls the speed at which the chips actually run. 4. How to tell the computer that additional memory has been installed. This usually involves setting switches or running a configuration program. memory resident A memory resident program remains in memory after being run, so that it can be called up later. Memory resident programs extend the capabilities of the operating system or provide “pop-up” functions, such as a calendar or calculator, that can be called up in the middle of another program without disturbing it. You can then return to the original program as if nothing had happened. menu A list of options from which to choose when executing a program. The presence of menus in a program makes it easy for people to use the program because they do not need to memorize all the commands. By looking at the menu, they can see all their options and select a course of action. merge Combine two or more ordered sets of records or files into a single file that is also in order. message A completed telephone call. message rate A classification of service which is measured in terms of messages for the purpose of charging for the service. message service or message toll service Switched service furnished to the general public (as distinguished from private line service). message units Unit of measurement used for charging for measured message telephone exchange

2001-8.0-RFM03-0302 Glossary 152

traffic within a specified area. It is based on time and charges.

meter Also called a traffic register. Normally consists of 4 or 5 digit counters to tally peg counts, OFL, ATB, etc., as well as usage when required.

MF Multifrequency.

MFABDN (Multi-frequency Abandon) A register for OM group ISDD that increases when an XPM detects an on-hook condition on an incoming MF trunk. The XPM detects the on-hook condition before the XPM returns a start-to-dial signal. The system abandons the call.

MFABDN (Multi-frequency Attempt) A register for OM group ISDD that increases when the XPM accepts a SEIZ of an incoming MF trunk of an XPM for further processing.

MFDENY (MF resources denied (call processing failed to allocate for a call)) A register for OM group DSPRMAN. MFUTIL should be 100% before MFDENY increments the peg register.

MFHI (High-water-mark for MF allocations from the MF pool) A register for OM group DSPRMAN that counts the highest number of MF resources allocated from the node- level pool during a collection/transfer period. Its value starts at zero at the beginning of each collection/transfer period for the node. An update occurs when there is a new high-water-mark in the collection period. This occurs when the total number of resources allocated from the MF pool exceeds the previous high-water-mark for the pool.

MFLOW (Multifrequency (MF) low-water-mark threshold violations on the node-level MF pool) A register for OM group DSPRMAN that counts the low-water-mark threshold violations on the SPM node-level pool of MF resources since the last collection period. Crossing the threshold once indicates a potential for resource exhaustion on the node. Crossing the threshold more than once in a collection period indicates the user (call processing) is operating around the threshold for extended periods.

MFLOST (Number of MF resources lost by or taken away from resource management users) A register for OM group DSPRMAN that counts the MF resources taken away from users of SPM resource management (such as call processing) due to sparing actions.

MFR Multifrequency Receiver.

MFRC Multifrequency Receiver Call.

MFSEIZ (Multi-frequency seizure) A register for OM group ISDD that increases when the system seizes an MF trunk of an XPM for an incoming call. The system detects a SEIZ when an XPM detects an off-hook condition lasting for 6 to 9 ms on an idle incom- ing trunk.

MFTDLY (Multi-frequency Trunk Delay) A register for OM group ISDD that increases when one of the following intervals exceeds a preset TDLY threshold: the interval between the SEIZ of an incoming MF call and the return of a start-to-dial signal; the interval between call SEIZ and call ABDN, exceeds a preset TDLY threshold (the default TDLY threshold is 3 s).

MFUTIL (Average percent utilization of MF resources) A register for OM group DSPRMAN that calculates the percentage of the total MF resources in the node-level pool allocated

2001-8.0-RFM03-0302 Glossary 153

to users of resource management (such as call processing). MFUTIL is the average percentage utilization for all scan periods during a collection/transfer period. It does not indicate the total number in use at the end of a scan or transfer period.

MHLD Music on Hold.

MHz See Megahertz. mi Mile. micro Very small. A prefix meaning one millionth. For example, a microsecond is one millionth of a second. microchip A tiny silicon chip with thousands of electronic components and circuit patterns etched onto its surface. microcom networking protocol A method for detecting and correcting errors in data transmission. microcomputer A computer whose CPU consists of a single integrated circuit known as the micropro- cessor. Ordinarily, a microcomputer is used by only one person at a time. microprocessor An integrated circuit containing the entire CPU of a computer, all on one chip, so that only the memory and input/output devices need to be added. The first popular microprocessor, the Intel 8080, came out in 1973 and cost approximately $400; it now sells for about $1.00. microwave A method of sending messages at radio frequencies from one point to another using transmitters and receivers in an unobstructed “line of sight.” Amplifiers are required about every 30 miles. A typical microwave route will carry 12,000 voice circuits.

MID Manual Identification.

Mil Mileage. mileage Distance used in tariff calculations. It is locally defined and usually refers to airline distance, rather than actual route miles. milli Prefix meaning one thousandth.

MIN Mobile Identification Number. minutes of use (MOU) A unit of measurement expressed as either holding time or conversation time. The amount of time during which a connection exists. minutes of use miles (MOUM) The product of the number of minutes of use and the average route miles of circuits involved.

MIPS Million Instructions Per Second.

MIS Management Information System.

MISCERR1 1. The total number of errors made during the first attempt to record the name, other than no response, speaking too soon, or speaking too long. This number is incremented for the relevant key each time non-speech errors such as DTMF input are detected. 2. The total number of errors made during the first billing acceptance

2001-8.0-RFM03-0302 Glossary 154

attempt, other than unrecognized speech, speaking too soon, speaking too long, or calls routed to the operator because of too many errors. This number is incremented for the relevant key each time other errors such as DTMF input were detected instead of speech.

MLATTS Register MLATTS (mobile-to-land call attempts) pegs when a call is made from the serving subcell to a land trunk. This register pegs against the serving subcell after routing. Calls to an operator are not included in this register. This register also pegs on the originating MSC (MSC-o)/home MSC (MSC-H) when a call delivery attempt is made from a subscriber unit that is roaming outside of its home system.

MLCOMPS Register MLCOMPS (mobile-to-land call completions) pegs when a call is successfully completed from a serving subcell to a land trunk. This register pegs against the serving subcell after a successful routing to a land trunk, but does not imply that the call has been answered. Calls to an operator are not included in this register. This register also pegs on the MSC-O/MSC-H on successful routing to a land trunk when a call delivery is made from a subscriber unit to another subscriber unit that is roaming outside of its home system.

MKR See marker.

MKR1, OAC Same as Dial Tone.

MKR1, REC Same as Local Terminating Call.

MMATTS Register MMATTS (mobile to mobile call attempts) counts when a call is made from a subscriber unit to another subscriber unit. This register pegs against the serving subcell after routing. This register also pegs on the MSC-O/MSC-H when a call delivery is attempted froma subscriber unit to another subscriber unit. It also pegs on the forwarding switch when a call forwarding attempt is made from a subscriber unit to another subscriber unit.

MMCOMPS Register MMCOMPS (mobile to mobile call completions) counts when a call is successfully completed from a subscriber unit to another subscriber unit. This register is pegged against the target subcell after a successful routing to a VCH in the switch, but does not imply the call has been answered.

MMM Message Minute Mile.

MMS Message Metered Service. The subscriber pays for only the amount of telephone service used.

MMU Multiple Message Unit.

mnemonic A device that helps you remember something; usually an abbreviation or arrange- ment of symbols that has an easily remembered relationship to the subject.

MNP See Microcom Networking Protocol.

MOATTS (Mobile to operator call attempts) A dual mode register for wireless OM group OMMTX that pegs when a call is made from a subscriber unit to an operator. This register is pegged against the serving subcell after routing.

MOBANS (Mobile answered call pegged for terminator’s partition) A dual mode register for wireless OM group OMMTX that pegs when a mobile is involved in a call as a terminator and answers the call as indicated by an answer message proceeded by the CM. This register pegs against the terminating MS’s partition.

2001-8.0-RFM03-0302 Glossary 155

mobile telephone service Sending and receiving calls from a base station to an automobile over radio frequen- cies.

mobile telephone switching office The heart of a cellular radio system, this sophisticated computer center interfaces all cell site radio transmitters and receivers serving the mobile vehicle stations, and directs which one will serve a vehicle as it travels through the system.

MOCOMPS Register MOCOMPS (mobile to operator call completions) pegs when a call us successfully completed from a subscriber unit to an operator. This register is pegged against the serving subcell after a successful routing to an operator circuit, but does not imply that the call has been answered.

mode A method or condition of operation.

modem An acronym for modulator-demodulator, a device which translates digital pulses from a computer into analog signals for telephone transmission, and analog signals from the telephone into digital pulses the computer can understand. The modems commonly used with computer terminals and microcomputers transmit RS-232 serial data over telephone lines. Since the RS-232 interface is standard, practically any modem can be used with any terminal or computer.

module Part of a larger system. A module in a computer program is a part of the program that is written and tested separately and then is combined with other modules to form the complete program.

monitor 1. The control program that schedules and manages the computer’s resources. Also, the memory-resident portion of a disk operating system. 2. A device similar to a television set that accepts video signals from a computer and displays information on its screen.

monochrome display A display in which data appears in only one color. Monochrome monitors generally are better when working with text because they provide sharper resolution for numbers and letters than do color monitors. However, a color monitor is needed if you would like your computer to do color graphics. A monochrome monitor usually displays white, green, or amber characters on a black background. Different people have different preferences as to which arrangement is easiest on the eyes.

most limiting Used in traffic capacity determination, the most limiting item is the switching machine component which, based on forecasts of subscriber and traffic growth, will first be overloaded beyond its traffic capacity.

motherboard A large printed circuit board that can support a number of “plug-in” boards. It is the main circuit board of a microcomputer.

MOU (Minutes Of Use) The usage of telephone plant during a specified period, expressed in minutes either as total usage, or as a holding time per message or call.

MPU Microprocessing Unit, same as microprocessor. See microprocessor.

MR 1. Multifrequency Receiver. 2. Modem Ready.

MS Multifrequency Sender.

MS/DOS Microsoft Disk Operating System, an operating system for computers that use the 8086 or 8088 microprocessor.

2001-8.0-RFM03-0302 Glossary 156

MSERRSEQ 1. The total number of errors made during the second or later attempts to record the name, other than no response, speaking too soon or too long, abandoned calls, calls routed to an operator, or calls that cannot be identified as locality calls. This number is incremented for the relevant key each time non-speech errors such as DTMF input were detected. The number of attempts is determined by the table VSN Retry Counts parameters Name_No_Response, Name_Format_Err, and Name_Total_Retry. 2. The total number of errors made during subsequent billing acceptance attempts, other than unrecognized speech, speaking too soon, speaking too long, or calls that were routed to the operator because of too many errors. This number is incremented for the relevant key each time other errors such as DTMF input was detected instead of speech.

msg Message.

MSU Message Signal Unit

MTBF See Mean Time Between Failure.

MTC Maintenance.

MTCE Maintenance.

MTD Magnetic Tape Diagnostic.

MTG Main Traffic Group.

MTRMT Register MTRMT (mobile registers going to treatment) pegs when a call origination message is received by the serving subcell. This register is pegged only when there is a direct route from the subscriber unit to a service treatment. This register is not pegged if a call is rerouted to a treatment.

MTS 1. Message Telecommunications Service. 2. See Mobile Telephone Service.

MTSO Mobile Telephone Switching Office.

MTS/WATS-type services Services that MCI presently markets as Execunet and Network Service or any other like service that may be offered by any other common carrier.

MTXDCALL Mobile Telephone exchange Data Calls. See also OM group MTXDCALL for an extended description and field names.

MUL Two-party or Multi-party Line.

multileaf Position information used to aid the operator in determining what numbers to dial to route toll calls.

MULTOVFL (Multiblock overflow) A register for OM group CP that counts attempts at three-way calling that fail because no idle multiblock is available.

multiplexer 1. Equipment that combines a number of channels onto a single facility for transmis- sion. 2. Device that allows several communications lines to share one computer data channel.

multiplexer loading The percentage of time that the device is not idle.

multiplexing The technique of dividing one transmission channel into two or more channels.

2001-8.0-RFM03-0302 Glossary 157

multiprocessing The use of more than one CPU in a single computer system.

MULTSZ (Multiblock Seizure) A register for OM group CP that counts seizures of a multiblock. multitasking The execution of more than one program apparently at the same time on the same computer. Multitasking makes it possible to print one document while editing another, or to perform lengthy computations “in the background” while working on something else on the screen. multi-user system A system where two or more people, using different terminals, can access one computer simultaneously.

MUX Multiplexer.

MVS Multiple Virtual Storage. An operating system for IBM mainframe computers.

MWTACT (Message waiting activations) A register for OM group MWTCAR that increases when the message center activates the message waiting lamp. An activated message waiting lamp indicates that a call request or a message is waiting at the message center.

MWTATT (Message waiting attempts) A register for OM group MWTCAR that counts attempts to activate message waiting. To activate message waiting, the subscriber terminates at a message center. To reach the mesage center, a subscriber calls a line that the system forwards to the message center. To reach the message center, the subscriber can also dial the message center directory number (MCDN).

MWTDEACT (Message waiting deactivations) A register for OM group MWTCAR that increases when the message center deactivates the message center waiting lamp. A deactivated message waiting lamp indicates the number of times the subscriber retrieves mes- sages from the message center.

MWTOVFL (Message waiting overflow) A register for OM group MWTCAR that increases when the message center attendant cannot activate the message waiting lamp because of a lack of feature data blocks. Parameters NO_OF_FTR_DATA_BLKS and FTRQ2WAREAS in table OFCENG specific feature data blocks. The display of the message center attendant will show “TRY AGAIN”.

MWTQUERY (Message waiting queries) A register for OM group MWTCAR that increases when a message center attendant queries the status of a station for messages in the queue. mx Matrix.

NAK Negative Acknowledgement. In XMODEM and some other protocols, ASCII code 21 (CTRL-U) stands for “not acknowledged” (abbreviated NAK); it is sent when a data packet is received incorrectly by a receiving terminal or is not received when ex- pected.

NAM Network Access Method.

NAMACGBK (Name TCAP queries blocked by ACG) A register for OM group CNAMD that counts every time the system blocks a calling TCAP query because of an active ACG6-digit code control.

NAMACGOV (Name ACG table overflow) A register for OM group CNAMD that counts when the SCP requests that the system apply an ACG 6-digit code control. However, the

2001-8.0-RFM03-0302 Glossary 158

system can not apply the code control due to the code control table being full.

NAMISPTO (Name ISUP query timeouts) A register for OM group CNAMD that counts every time a calling name ISDN user part (ISUP) query is initiated. Also, the TNAME timer has to expire before the ISUP Pass Along Message is received. The expiry delay is an ISUP timeout condition.

NAMTCPQ (Calling name TCAP query sent) A register for OM group CNAMD that counts every time the system initiates a calling name TCAP query.

NAMTCPTO (Name TCAP query timeouts) A register for OM group CNAMD that counts every time the system initiates a calling name TCAP query. The condition is that the TNAME timer expires before the TCAP response package is received. This is a TCAP timeout condition.

NAMEREQ The total number of calls that needed to record the caller’s name. This number is the number of first attempts at name recording. This number is incremented for the relevant key each time the following conditions are met: 1) the call needs verbal billing acceptance 2) the message delivered to the billed party includes the caller’s name The parameters Record_Name_Prison_ and Record_Name_Non_Prison in table User Interaction determine if the caller’s name is used.

NAMEOP The number of calls routed to the operator by dialing zero (0) after an attempt at name recording. This number is incremented for the relevant key each time the caller dials zero (0) in response to the help prompt during name recording. If a subscriber flashes the switch hook during a collect only or prison call, this action also incre- ments the OM count.This message is delivered when one of the following parameters in table VSN Retry Counts has been reached: Name_No_Response, Name_Format_Err, and Name_Total_Retry.

NAN Network Access Node.

nanosecond One billionth of a second.

NANS (Number of answered calls) A register for OM group TRK that counts the number of answered calls for each trunk group on a DMS-100I. This register increases when the extended multiprocessor system (XMS)-based peripheral module (XPM) detects an answer line signal from the outgoing trunk. The system generates register NANS in office types OFF100, OFF200, OFFCOMB, and OFFCOMBITOPS. This register is optional for office type OFFCOMB and is only present if the system loads package NTXB22AA.

NANUMDEL (Calling name and number delivered) A register for OM group CNAMD that counts every time the calling name is available. However, the system has to send the name with a calling number or indicator to the subscriber’s customer premises equipment.

NAR Network Access Registers.

NARBLCKD (NAR blocked attempts) A register for OM group NARUSAGE that increases when the system attempts to access an NAR but units are not available.

NARTOTAL (NAR total number of access attempts) A register for OM group NARUSAGE that increases when an attempt to access an NAR occurs.

NARTRAF (NAR traffic usage count) A usage register for OM group NARUSAGE that records the amount of traffic that uses each NAR. It has a scan rate of 100 seconds.

2001-8.0-RFM03-0302 Glossary 159

NARUC National Association of Regulatory Utility Commissioners. Their efforts strongly influence regulatory policies and practices in the U.S.

NARUSAGE Network Access Registers Usage. See also OM group NARUSAGE for an extended description and field names.

National Exchange Carrier Association Membership involves all U.S. local exchange carriers.

NATTMPT Number of times routing directed an outgoing call to this trunk group. Pegged before checking for network management controls or determining whether an idle trunk and a network connection to that trunk are available.

NBH Network Busy Hour.

NBLH Network Blockage Heavy Traffic.

NBP Network Boundary Page.

NBPREQI (Network Boundary Page Request Intelligent Cellular Peripheral) A register for wireless OM group ICPCP that pegs when an ICP responds to a network boundary page (NBP) intersystem page request message from a subscriber unit.

NBPRSPI (Network Boundary Page Response Intelligent Cellular Peripheral) A register for wireless OM group ICPCP that pegs when an ICP sends a page request message to a subscriber unit for NBP and the subscriber unit sends a page response message to the ICP.

NCI No Initial Charge.

NCRT No Circuit.

NCT Network Call Transfers.

NCTFAIL (Network call transfer fail) A register for OM group TRK that counts the total number of failed network call transfers (NCT). Not available to all customers. Contact Nortel Support about NCTFAIL for your switch. Register NCTFAIL is visible in offices where OFFICETYPE is OFFCOMBLWW, OFF250, OFFMTX100I,or OFF250IBN.

NCTPASS (Network call transfer pass) A register for OM group TRK that counts the total number of completed network call transfers (NCT). Register NCTPASS is visible only in offices where OFFICETYPE is OFFCOMBLWW, OFF250, OFFMTX100I, or OFF250IBN. Register NCTPASS is not available to all customers. Contact Nortel Support about NCTPASS for your switch.

NCWV Non-Call Work Volume. The total time of operators on a particular team spent in a made-busy or calls-withheld state. Measured in tenths of seconds and reported in seconds. NCWV is measured at the end of the occurrence and is reported in the ending period.

NECA See National Exchange Carrier Association. neg Negative. nesting 1. Embedding program segments or blocks of data within other program segments or blocks of data. 2. Writing a program that has loops within loops.

2001-8.0-RFM03-0302 Glossary 160

NETWBUSY (Network_Busy Message) A register for OM group CAINMSGS that counts the number of Network_Busy messages sent to the SCP.

network 1. An array of trunk groups from a given reference office. 2. A system of intercon- nected computer systems and terminals.

network busy hour The hour for which the traffic load of all trunk groups assigned to a specific alternate route network is the greatest.

network busy season That period of a calendar year, usually of one to three months duration, during which the network busy hour load attains its maximum value.

network management To maintain the efficiency of the DDD national network during normal, peak, and overload periods, ESS central offices are provided with various software controls to enable the telephone company to cope with these conditions.

network operation center The top level of a monitoring and control management hierarchy for Lucent Tech- nologies national network.

nexus Point in a system where interconnections occur.

NEXTCNRTE A register for OM group CAINTRIG that counts the number of tims a CAIN call has NEXTCNRTE datafilled as the trigger action or encounters and EDP with NEXTCNRTE action specified in the appropriate EDP action extension parameter. Tables NETBUSY, OCLDBUSY, and ONOANSWR may have NEXTCNRTE datafilled as the trigger action in trigger tables.

NEXTRTE A register for OM group CAINTRIG that counts the number of times a CAIN call has NEXTRTE datafilled as the trigger action in the trigger table or encounters an EDP with NEXTRTE action specified in the appropriate EDP action extension parameter. Tables NETBUSY, OCLDBUSY, ONOANSWR may have NEXTRTE datafilled as the trigger action in the trigger table.

NGT Number Group Transistor.

nibble Four-bit word; half a byte.

night alarm An audible alarm circuit which can be turned on during low traffic periods to warn of incoming calls to a switchboard.

NIN (Number of Incoming Calls) A register for OM group OFZ that counts incoming calls that the CC recognizes. The intended destination of the call is a line, trunk, an- nouncement, or tone. It counts after a call control block and a call process are obtained. The register counts the calls before the inpulsing is set up.

NINC (Incoming attempts) A register for OM group OTS that counts incoming call attempts recognized by the central control. The intended destination of the call is a line, a trunk, an announcement, or a tone.

NMCERR (Network module controller errors) A register for OM group NMC that counts errors that are in in-service network module controllers.

NMCFLT (Network module controller failure) A register for OM group NMC that increases when a network module controller cannot recover from an error. The controller remains system busy, pending manual maintenance or a successful system-initiated recovery.

2001-8.0-RFM03-0302 Glossary 161

NMJRMBU (Network module junctors system busy usage) A usage register (100 s scan rate) for OM group NMC that records ifnetwork module junctors are system busy.

NMJRSBU (Network module junctors manual busy usage) A usage register (100 s scan rate) for OM group NMC that records if network module junctors are manual busy.

NMMBU (Network module manual busy usage) A usage register (100 s scan rate) for OM group NMC that records if out-of-service network modules are manual busy.

NMMSGER (Network module message link errors) A register for OM group NMC that counts errors in in-service message links between network modules and peripheral modules.

NMMSGFL (Network module message link failures) A register for OM group NMC that increases when a link between a network module and a peripheral module cannot recover from an error. The link remains system busy, pending manual maintenance or a successful system-initiated recovery attempt.

NMPTMBU (Network module ports manual busy usage) A usage register (100 s scan rate) for OM group NMC that records if network module ports are manual busy.

NMPTSBU (Network module ports system busy usage) A usage register (100 s scan rate) for OM group NMC that records if network module ports are system busy.

NMSBU (Network module system busy usage) A usage register (100 s scan rate) for OM group NMC that records if out-of-service network modules are system busy.

NMSPCHER (Network module speech connection errors) A register for OM group NMC that counts errors in speech connections located in the network.

NMSPCHFL (Network module speech connection failure) A register for OM group NMC that counts faults that in the network-resident connection memory, or in a speech path segment that is internal to the network. An accuracy failure that register NMSPCHFL recorded earlier trippers tests that detects the fault. The path segment affected is not available for call processing.

NNDUNAVL (Network name delivery unavailable) A register for OM group CND that increases is set zero. This register is not supported on the DMS 100G switch. Register NAMISPTO in OM group CNAMD increases in its place.

NNX Code A three digit code identifying a given area or central office, in which “N” is any digit from 2 through 9, and “X” is any digit. At this time, NNX codes are used only for central office codes, but in the future will also be used for numbering plan area codes. Telephone number prefix (area code).

NO_MATCH A register for OM CAINTRIG that counts the number of times a CAIN call evaluates a trigger with no match in the corresponding trigger table.

NOADJCEL (No adjacent cell) A dual mode register for wireless OM group OMMTXHO that counts when there are no adjacent calls that can receive a handoff from a subscriber unit. A large number may indicate hat no adjacent subcell is listed in table ADJCELL or that a cell is out of service (OOS).

NOC Network Operation Center.

NOCN No Coin.

2001-8.0-RFM03-0302 Glossary 162

NOCPERES The number of calls rejected because there are no call processing engines available to process the call. This number is incremented each time the ACPE-RM could not allocate an ACPE to handle the call.

node One component in a network.

noise Spurious signals that can introduce errors or undesirable sound on a communications channel.

non-conversation time additive (NCTA) 1. Toll: The portion of time during call setup that starts with the completion of customer or operator dialing and ends when the called party answers or the call is abandoned (incomplete attempt). 2. Total: The total time spent from customer off- hook until the called party answers or the call is abandoned.

nondocument mode In many word processors, the nondocument mode is used for typing files that are to be used for some purpose other than printing; for example, computer programs. Nondocument mode procedures plain-text files with no special codes for hyphen- ation, page breaks, or the like.

NOPR No Print.

NORESOP The number of calls that were routed to an operator due to too many no responses. The call is routed to an operator when the retry limit Billing_No_Response is reached (table USER INTERACTION). This count is pegged only if Billing_Acceptance_Validation is set to DTMF.

NORESP (No Response) A dual mode register for wireless OM group OMMTXHO that counts when no RSSI responses are received from adjacent subcells in the LCR response timer. This register is pegged against the serving subcell. If this number is large, it may indicate either problems in the cell, problems in message handling, or system overload.

NORESP1 1.The number of times there was no response to the first time the prompt for the caller’s name was made. This number is incremented for the relevant key each time the value for Name_Record_Wait_Time parameter in table User Interaction is reached during the first name recording attempt. 2. The number of times there was no response after the initial prompt for a yes or no response is given. This number is incremented for the relevant key each time the value no response wait time is reached during the first billing acceptance attempt.

NORESSEQ 1. The number of times there was no response to subsequent prompts for the caller’s name. This number is incremented for the relevant key each time the value for Name_Record_Wait_Time parameter in table User Interaction is reached during the subsequent name recording attempts. The number of attempts is determined by the following parameters in table VSN Retry Counts: Name_No_Response, Name_Format_Err, and Name_Total_Retry. 2. The number of times there was a no response to subsequent prompts for a yes or no response to billing acceptance. This number is incremented for the relevant key each time the value in parameter No_Response_Wait_Time is reached during the subsequent billing acceptance attempts.

NORG (Originating Attempts) A register for OM group OTS that counts originating call attempts recognized by the central control. The intended destination of the call is a line, a trunk, an announcement, or a tone. This register also counts originating call attempts that go immediately to lockout (caused by line load control). The system recognizes and counts a line involved in a call that flashes to attempt to initiate a

2001-8.0-RFM03-0302 Glossary 163

three-way call.

NORIG (Number of Originating Calls) A register for OM group OFZ that counts originating calls that the central control recognizes. This register is pegged after getting a call condense block and seizing a call process, but before starting to set up dialing. NORIG is equal to the sum over all line modules of LMD NORIGATT. It is also equal to the sum of ORIGANN, ORIGLKT, ORIGOUT, ORIGTRM, ORIGTONE, ORIGBLK, and ORIGABDN, plus the average number of calls in the process of dialing. Three-way calls are pegged upon recognition of a flash as a legitimate feature origination signal for the flashing line.

NORIGATT A register for OM group LMD that counts originate call attempts that the LM reports to the central control. It includes three-way originate call attempts.

NOSEQ The number of no responses to the billing acceptance message. This number is incremented for the relevant key each time the billed party says no to reject charges after the billing acceptance message is played more than once.

NOSFT Network Operating System File Transfer.

NOSPLCL No Special Call Found. NOSPLCL is incremented each time an application makes a special call request and no call is available in the requested queue. SPLCLREQ = GOTSPLCL + NOSPLCL

NOSPLCL2 Extension register of NOSPLCL.

NOTAUTO 1. The number of calls which required operator intervention at or before the service selection stage. This number is incremented for the relevant key under the following conditions: a) a flash hook is detected before DTMF input b) the no response retry count of the first service selection message is exceeded c) zero (0) is dialed during service selection for prison calls d) zero (0) is dialed during service selection for non-prison calls e) a hook flash is detected at front-end language selection, only before service has been selected f) the no response retry count is exceeded at front-end language selection, only before service has been selected g) zero (0) is dialed during front-end language selection, only before service has been selected 2. AUTOOPER + SSZEROOP + PRISONOP

NOTRIG A register for OM group CAINTRIG that counts the number of times a CAIN call has CONT_NOTRIG datafilled as the trigger action in the trigger table. Call processing continues, at this current TDP (Trigger Detection Point) without checking any remain- ing triggers.

NOVCERES The number of calls rejected because there are no voice resources available. This number is incremented for the relevant key each time the call is rejected before any user interaction because a needed resource is not available. The needed resource may be a T1 channel, a VI channel or an ACPE.

NOVFLATB The number of times a call, allowed to the given trunk group, overflows the group and is routed onwards, because no idle trunk is available. Calls deflected from the group by network management controls are pegged in the TRK_DEFLDCA, rather than NOVFLATB.

NOVFOP The number of calls routed to the operator during verification of a no response. This

2001-8.0-RFM03-0302 Glossary 164

number is incremented for the relevant key each time the billed party did not confirm billing rejection by hanging up.

NOVFLATB (Number of overflows, all trunks busy) A register for OM group TRK that increases when a call with access to the trunk group overflows the group. The system routes the call because an idle trunk is not available. A call can access the same group more than one time. Overflow can occur only one time. Overflow occurs if the system cannot use the first trunk because of seize fail, glare or network blockage. Register NOVFLATB increases when the system cannot find an idle trunk on the first or any of the following access attempts. This register generates for office types that are correct. For DMS-MTX switches, this register increases when an attempt to terminate on an MTX trunk group fails. This register increases when an attempt to handoff a terminat- ing mobile to an MTX trunk group fails. Failure occurs because an idle trunk is not available. The system can assign up to eight MTX trunk groups to a cell site. This register can increase up to eight times for a single termination, one time for each group.

NOVOICE (No voice) A dual mode register for wireless OM group OMMTXHO that pegs when there is not an available voice channel in a responding cell. This register is pegged against the serving subcell.

NO1ST The number of no responses to the billing acceptance message. This number is incremented for the relevant key each time the billed party says no to reject charges the first time the billing acceptance message is played.

NP No Path available.

NPA (Numbering Plan Area) code A three digit code identifying a given numbering plan area. Present NPA codes are of the form “N-0/1-X,” in which the first digit “N” is any number 2 through 9, the second digit is either 0 or 1, and the third digit “X” is any number 1 through 0. Ultimately both central office and NPA codes will be of the form NXX.

NSCALLS (Night service calls) A register for OM group IBNSG that counts when a call requires night service treatment.

NSD Network and Signaling Diagnostic.

NSPK Network Signaling Packs.

NSYS (System origination) A register for OM group OTS that counts calls that the central control (CC) recognizes as system-generated calls. System-generated calls include originations that are not included in NORG or NINC.

NTCA National Telephone Cooperative Association.

NTERMATT (Terminating Attempts) A register for OM group LMD that counts attempts to find an available speech link from the network module to a terminating line. This attempt occurs after call processing determines that the terminating line is available.

NTLP 1. Disabled Network Loop. 2. Network Loop.

NTT Badger/Noller Test Trunk.

NTWK 1. Network DMO. 2. Network Equipment. 3. Network Loop.

2001-8.0-RFM03-0302 Glossary 165

null modem A cable for connecting two computers together without a modem.

number cruncher A computer designed to perform massive amounts of complex scientific calculations.

numeric keypad A separate set of keys beside the main alphabetic keypad that contains the digits 0 to 9 and a decimal point key.

Nyquist Relationship A principle stating that the rate at which data can be transmitted prior to intersymbol interference occurring must be less than or equal to twice the bandwidth in Hz.

O_FTRREQ A register for OM group CAINMSGS that counts the number of O_Feature_Reqested messages sent to the SCP.

O_NOANSW (O_No_Answer Message) A register for OM group CAINMSGS that counts the number of O_No_Answer messages sent to the SCP.

OA Operator Assistance. A trunk group provided from a switching machine to an inward operator position. This group is accessed by operators at a distant switchboard dialing the “inward” code (121).

OAC 1. Dial Tone Seizure 2. Originating a Side Call.

OAS Office Alarm Send.

OANSWR (O_Answer Messages) A register for OM group CAINMSR that counts the number of O_Answer messages sent by the SSP.

OBH See Office Busy Hour.

object program A program that has been translated into machine language and is ready to be run on the computer.

objective CCS The busy hour CCS load which an equipment or trunk group is engineered to carry at the specified grade of service.

OBTOF Office Backward Transceiver Overflow.

OBTNP Office Backward Transceiver NPA.

OBTRQ Office Backward Transceiver Request.

OCBOF Office Conference Bridge Overflow. Scored if three-way call attempt fails due to all three-way calling conference bridges being busy.

OCBSZ Office Conference Bridge Seizure. Scored on connecting three-way calling conference bridge.

OCBUS Office Conference Bridge Usage. Usage of all three-way calling conference bridges.

occupancy The percentage of time when a circuit or facility is in use.

OCFAT Office Call Forwarding Assignment Attempt. Number of times that customers, with variable call forwarding service, attempt to transfer their calls. Scored on receipt of the variable call forwarding activation code.

OCFEX Office Call Forwarding Executed. Number of calls forwarded (using the variable call forwarding feature).

2001-8.0-RFM03-0302 Glossary 166

OCLDBUSY (O_Called_Party_Busy Message) A register for OM group CAINMSGS that counts the number of O_Called_Party_Busy messages sent to the SCP.

OCT Office Code Translator.

OCTAL Number system using 8 as a base. Octal numbers use only the digits 0, 1, 2, 3, 4, 5, 6, and 7.

OCWAT Office Call Waiting Attempt. Number of times that customers, with call waiting service, receive call waiting tones.

ODD3S Office Dial Tone Delay Over 3 Seconds. Off-hook requests for service that do not receive dial tone within three seconds.

ODISC (O_Disconnect Message) A register for OM group CAINMSGS that counts the number of O_Disconnect messages sent by the SSP.

ODQ Office Data Query.

ODTNP Office Dial Tone No Path Available. Count made if the first try to connect dial tone fails due to path blockage in the DCO network. Not scored for successive retries.

OEM Original Equipment Manufacturer.

OF Overflow.

OFCDLOOK (Office Code Lookup) A register for OM group CAINLNP that is pegged when a call subscribes to the OFFCODE trigger and the OFFCODE table is referenced to deter- mine whether a match is made.

offered traffic That portion of traffic directed toward a trunk group. Also, see carried traffic and overflow traffic.

off-hook 1. The active condition of a switched access or telephone exchange service line. 2. The condition existing when the receiver or handset is removed from its switch.

office, crossbar central An automatic central office which uses electromechanical crossbar switches.

office, local central An end office serving local telephone subscribers.

office, rotary central A central office using rotary switches and selectors.

office, step-by-step central An automatic office where switching is done by step-by-step electromechanical selectors.

office, tandem An automatic switching center which switches calls between other offices and normally has no subscribers’ loops directly terminated.

office busy hour That hour in a given 24-hour period during which the total originating and/or terminating traffic in a central office is greater than during any other hour.

off-line Pertaining to equipment, devices, or persons not in direct communication with the central processing unit of a computer.

off season The four to six months that rarely or never are among the three high busy season months.

2001-8.0-RFM03-0302 Glossary 167

OFTNP Office Forward Transceiver NPA.

OFTOF Office Forward Transceiver Overflow.

OFTRQ Office Forward Transceiver Request.

OFZNCBN Register OFZNCBN (no circuit business network trunks) counts calls the system routes to generalized no circuit treatment (GNCT). The system routes the calls to GNCT because Meridian Digital Centrex (MDC) trunk is not available.

OFZNCID Office circuit inward dial trunks register that counts calls the system routes to general- ized no circuit treatment (GNCT). The system routes a call to GNCT when a direct inward dial or direct outward dial trunk is not available.

OFZNCIM Register OFZNCIM (no circuit intermachine trunks) counts calls that the system routes to generalized no circuit treatment (GNCT). The system routes the calls to GNCT because a circuit intermachine trunk is not available.

OFZNCIT Register OFZNCIT (no circuit intertoll trunks) counts calls that the system routes to generalized no circuit treatment (GNCT) because an intertoll trunk is not available.

OFZNCLT Register OFZNCLT (no circuit local tandem trunks) counts calls that the system routes to generalized no circuit treatment (GNCT) because a local tandem trunk is not available.

OFZNCOF Register OFZNCOF (no circuit offnet trunks) counts calls that the system routes to generalized no circuit treatment (GNCT) because circuit offnet access or direct dial trunk is not available.

OFZNCON Register OFZNCON (no circuit connect trunks) counts calls that the system routes to generalized no circuit treatment (GNCT) because dedicated access or mobile telephone exchange trunk is not available.

OFZNCOT Register OFZNCOT (no circuit other trunk) counts calls that the system routes to generalized no circuit treatment (GNCT). The system routes the calls to GNCT because one of the following types of trunk is not available: test line, test desk, maintenance trunks and AV101.

OFZNCRT Register OFZNCRT (no circuit trunks) counts calls that the system routes to GNCT. The system routes a call to GNCT because one of the following types of trunk is not available: 0+/0- tandem to TOPS, outgoing to AMR2 or CAMA, outgoing local, recording completing outgoing and TOPS outgoing.

OFZNCTC Register OFZNCTC (no circuit toll completing trunks) counts calls that the system routes to generalized no circuit treatment (GNCT) because toll completing trunk is not available.

OFZNOSC Register OFZNOSC (no service circuit trunks) counts calls the system routes to general- ized no circuit treatment (GNCT). The system routes the call because automatic number announcement or automatic intercept trunk is not available. o/g Outgoing.

OGP Outgoing Group Peg register. Usage begins on trunk seizure and ends when the trunk has been released. A specific OGP register is assigned for each trunk group. In addition to the usual outgoing trunk type traffic, an OGP register is assigned to each

2001-8.0-RFM03-0302 Glossary 168

recorded announcement such as changed number, vacant level, revert call, etc. The usage collected on these registers would measure all traffic originated by subscribers of the host or remote(s) to any of the points for which an OGP register has been assigned as well as through switched usage which may be routed over these trunks.

OGP EAS Outgoing Group Peg Count Extended Area Service.

OGP EAS OFL Outgoing Group Peg Count Extended Area Service Overflow.

OGP OFL Outgoing Group Peg Count Trunk Group Number Overflow.

OGT Outgoing Trunk.

OGTR Outgoing Terminating.

OH See off-hook.

OHACCPT Operator-Handled Directory Assistance Call Completions (DACC). OHACCPT counts operator-handled DACC offers that are accepted by subscribers. OHACCPT includes calls that are completed manually and semi-automatically by an operator. In a manual call completion, an operator enters the digits for the requested number. In a semi- automatic call completion, an operator selects the requested number from the DAS databases and presses the TA key to transmit the digits.

ohm The unit of measure of electric resistance. If an object has a resistance of one ohm, then an applied voltage of one volt will cause a current of one ampere to flow through the device.

Ohm’s Law Ohm’s Law states that the current that will flow through a circuit element is equal to the voltage applied across that element divided by the resistance of that element: I=V/R, where I = current, in amperes; V = voltage, in volts; and R = resistance, in ohms.

OHP Operator Handled Print.

OHREJECT The number of times billing is denied because the billed party hangs up. This number is incremented for the relevant key each time the billed party goes on-hook. This number is not incremented when the billed party goes on hook to confirm one of the speech responses yes or no.

OJ Operator Junctor: A trunk group provided from a switchboard to a crossbar unit in the same building, over which the operator gains access to the outgoing trunk layout of the crossbar office. (Toll only or a combination of toll and local.)

OLDENTR (Number of times entering overload) A register for OM group ISGOVLD that counts the number of times an ISG enters an overloaded state.

OLDEXIT (Number of times leaving overload) A register for OM group ISGOVLD that counts the times an ISG leaves an overloaded state.

OLLEC Office Line-to-Line Effective Call. Scored on ringing called line. Excludes revertive calls.

OLLNP Office Line-to-Line No Path Available. Count made on failure to connect to a free called line due to path blockage in the digital central office network.

OLMAT Office Line Termination Attempt. A call that terminates to a line. Call may have

2001-8.0-RFM03-0302 Glossary 169

originated from a line or trunk. Count made on ringing called line.

OLMBY Office Line Termination Busy. The number of lines found busy on intra-office and incoming call attempts.

OLMDS Office Line Termination Denied Service. Line class of service check indicates denial of terminating service.

OLOAB Office Line Origination Abandoned Before Dialing. Originating line disconnects after connection to digit receiver and no digits received.

OLOAD Office Line Origination Abandoned Before Dial Tone. Originating line discon- nects before receiving dial tone.

OLOAP Office Line Origination Abandoned Partial Dial. Originating line disconnects with one or more digits dialed.

OLOCR Office Line Origination Custom Route. Count of all line originations that terminate to nonmeasured custom route treatments such as speed-calling write-in. Excludes line origination custom route treatments that are measured, such as call forwarding activation.

OLODS Office Line Origination Denied Service. Line class of service check indicates denial of originating service.

OLOPG Office Line Origination Purged. Count of the number of times line purge is initial- ized. This occurs when recognition of an invalid event during the processing of a line origination results in the call being automatically purged from the system (i.e., free matrix path and restore line to idle state).

OLOSZ Office Line Origination Seizure. An off-hook request for service. Counted when starting the attempt to connect dial tone.

OLOTB Office Line Origination Timeout Before Dialing. Originating line timed out after connection to digit receiver and no digits received.

OLOTL Office Line Origination Timeout to Lockout. Scored when system places line in lockout.

OLOTP Office Line Origination Timeout Partial Dial. Digit receiver has timed out with one or more digits received.

OLTEC Office Line-to-Trunk Effective Call. Scored effective on establishing connection to the outgoing trunk.

OLTNP Office Line-to-Trunk No Path Available. Count made if the attempt to connect to the first free trunk in the primary outgoing trunk group fails due to path blockage in the DCO network. Not scored for successive attempts.

Om Operational Measurements

OM group AABS AABS records Automated Alternate Billing Service call attempts and dispositions for 0+ TOPS calls in a DMS-200 TOPS office. Feature AABS provides automated handling of 0+ dialed collct, third number billed, and calling card calls through communica- tion between the DMS swtich and a voice services nose (VSN).The AABS reports are: 21211, 22211, 23211, 24211, 27211. 21212, 22212, 23212, 24212, 27212. Fields required for group AABS:

2001-8.0-RFM03-0302 Glossary 170

ACABSCCSC ACABSTHSAIABSCOSASTOMCCSASTOMCCSAABSACB

ARABSACBFACABSRCVALRCRSUADRCRVRFAABSSTP

OM group ACB ACB (Automatic Call Back) provides information on the use of the ACB feature for an office. You can obtain this feature alone or as part of the common access group of features. The ACB reports are: 21212, 22212, 23212, 24212, 27212. Fields required for group ACB:

ANCBATT ALCBFDEAACBOVFAACBLTDATCBSTDADCBSTDACBIME

AECBDLAYANCBTIMARCBRSCATCBSCATCBDATATCBABACBRAC

ANCBSTRANCBTSCANCBOSCADCBACBAVCBNIMEAYCBUNIACBDEN

OM group ACDGRP ACDGRP monitors the traffic for an Automatic Call Distribution Group. The ACDGRP reports are: 21213, 22213, 23213, 24213, 27213. Fields required for group ACDGRP:

ARCDOFFR ATCDANSANCDDFLCACDABND

ATCDNSAKCDPRMPALCDBLOCACDTMOF

ASCDTMINFAFCDTMANARCDCIACDXFE

AECDCPKADCDUSAGADCDICQACDREQ

ANCDDMCTAECDQABACDRQRT

OM group AMA AMA (Automatic Message Accounting summary) records: the total number of AMA record entries that the system generates for downstream processing; the number of occurrences of emergency transfer between AMA tape units; the number of times the system routes an AMA call to a Traffic Operators Position System (TOPS). The AMA reports are: 21214, 22214, 23214, 24214, 27214. Fields required for group AMA:

A2MAENT ARMAENTAEMAEMTAEMAFREANMAROUTAMASCR

OM group ANN ANN provides information on traffic for recorded announcement machines. This group has two peg registers (ANNATT and ANNOVFL) and three usage registers (ANNTRU, ANNSBU, and ANNMBU). The usage register has a scan rate of 100. The ANN reports are: 21215, 22215, 23215, 24215, 27215. Fields required for group ANN:

ALNNATT AUNNOVFAUNNTRAUNNSBANNMB

OM group AR AR (Automatic Recall) monitors the use of the AR feature for an office. You can obtain this feature alone or as part of the universal access group. The AR reports are: 21216, 22216, 23216, 24216, 27216. Fields required for group AR:

ANRATT ALRFDEAAROVFAARLTDATRSTDADRSTDARIME

AERDLAYANRTIMARRRSCATRSCADRDATAORPRCAROPT

ATRBDINATRABARRRACANRSTANRTSCANROSCARAR

AVRNIMEDAYRUNIAKRDENAWRPVTBLADRPVTALARDSBLI

OM group AUTHCAV AUTHCAV counts the transaction of the cellular authentication and voice privacy unit (CAVU), which is the off-board-processing unit used to execute the cellular authentica- tion and voice encryption (CAVE) algorithm. This group’s registers peg in the comput- ing module (CM) even though CAVU is a peripheral unit. The AUTHCAV reports are: 21217, 22217, 23217, 24217, 27217. Fields required for group AUTHCAV:

2001-8.0-RFM03-0302 Glossary 171

CCAVATTS CCAVSUCCEAVFRCAVFTIM

CCAVFRSCCAVREQUCDAVRQBSCAVRQSS

CGVRQORIGCMVRQRECKVRQTERCVAKEYC

OM group AUTHCTR AUTHCTR provides information the following transactions: authentications performed at the authentication center (AC), shared secret data (SSD) updates, Unique Challenges (performed for SSD updates, and requested by the AC), failed authentications and authentication result (AUTHR) mismatches reported by the serving system. The AUTHCTR reports are: 21218, 22218, 23218, 24218, 27218. Fields required for group AUTHCTR:

ACCAUTHRQ AHCAUTHSAMCNOAUTALCAUTHRACOFAI

AQCORIGRQAQCREGRAQCFLSHRAQCTERMRACUNSPR

ACCSSDURQALCSSDUSACCSSDUFAACSSDUNACSSDUN

AQCSSDERRACCUCREALCUCSUCARCUCFAIACUCN

AYCUCNAALCDENARCMUCFAMCMUCNACMARM

AMCMRCMMACCMAPRALCMUNBSACMOFAI

OM group BRSTAT BRSTAT (BRISC Occupancy Status) uses the Bell-Northern Research reduced instruction set computer (BRISC) to provide data on CPU usage (occupancy) for Super Node Offices. BRSTAT generates data when it creates a value representing the ratio of real time spent on a CPU function to the time allocated for that function. The system updates the usage registers this group every minute to reflect this ratio. The BRSTAT reports are: 21221, 22221, 23221, 24221, 27221. Fields required for group BRSTAT:

BXRSCAP BDRSCMPLBERSSCHEBTRSFORBRSMAIN

BMRSDNCBMRSOBGRSGTERBERSBKBRSIDL

BMRSAUXCPBPRSNETBRSSNI

OM group C7LINK1 C7LINK1 (CCS7 link group 1) provides information on the failures and recoveries of a Common Channel Signaling 7 (CCS7) link. A CCS7 link is a communication path that moves voice or signaling messages between two signaling points in a CCS7 network. The C7LINK1 reports are: 21222, 22222, 23222, 24222, and 27222. Fields required for group C7LINK1:

CL7LKSYNU CB7LKFAICY7ABNRFCR7EXDLAC7EXER

CF7EXCONGCR7ALIGNCX7SUERCL7NACKRC7STALF

CN7TLALFLCL7NETCOCL7SLTFCV7NUCFC7CO

CU7CBKCB7LKUNACN7MANCF7BSYOC7BSYOF

CH7LINHCH7LUNINCH7RINCO7RUNINC7LP

CO7RPOCC7AUTOCCB7ERRSEC7CL

OM group C7LINK2 C7LINK2 (CCS7 link group 2) provides information on calls and congestion for Com- mon Channel Signaling 7 (CCS7). A CCS7 link is a communication path. This path moves voice or signaling messages between two signaling transfer points (STP) in a CCS7 network system. The C7LINK2 reports are: 21223, 22223, 23223, 24223, and 27223. Fields required for group C7LINK2:

C27MSUTX CX7MSUTXC27MSURCX7MSURXC7BYTT

CX7BYTTX2C27BYTRCT7BYTRXC27BYTRC7BYTRT

CV7MSUDSCCV7ONSETC27ABATECT7MSUDCC7STRE

CS7MSDRETCQ7MSGLOCR7MSGMSC27MSUOC7MSUOR

C27MSUTECS7MSUTEC27MSUTC7MSUTS

2001-8.0-RFM03-0302 Glossary 172

OM group C7LINK3 C7LINK3 (Common Channel Signaling 7 link group 3) monitors the traffic and perfor- mance of a message signal unit (MSU) for a Common Channel Signaling 7 (CCS7) link. Message signal units are a part of a signal. The C7LINK3 reports are: 21224, 22224, 23224, 24224, and 27224. Fields required for group C7LINK3:

C27MSOR CE7MSORC27MSTCS7MSTEC27MSTCV7MSTSC7MSUBO

CU7LV1CGUCU7LV2CGCU7LV3CGCU7LPOCP7RPOCS7HWLLC7HWMT

CT7HWSTCD7HWTOCL7RTOVLCU7BFOVFCK7CLBVXALIDLLSCCPR

LXSCCPRX2L2SCCPTLXSCCPTXL2UPARLXUPARXL2UPATLUPATX

OM group C7LKSET C7LKSET (CCS7) provides information on the performance and use of a CCS7 linkset. The CCS7 affects the performance and use of routesets.The C7LKSET reports are: 21225, 22225, 23225, 24225, and 27225. Fields required for group C7LKSET:

CL7LSUNAU CU7LSFAIC7LSEMR

OM group C7MTP C7MTP counts message signal units (MSU) that a Common Channel Signaling 7 (CCS7) message transfer part (MTP) discards. This OM group is part of a signal transfer point (STP). Two registers count discarded MSUs. The system discards MSUs because the system cannot determine the type of message. The system also discards MSUs because the destination point code is not in the routing tables of that office. The C7MTP reports are: 21226, 22226, 23226, 24226, 27226. Fields required for group C7MTP:

CO7MSIDPC CT7MSISICT7XSDYWCT7XSDYNCT7PHDYWC7PHDYN

C57GTT95C17NGTT9C27SMPWTC17SMPWTC27SMPNTC7SMPNT

OM group C7ROUTE C7ROUTE (CCS7 route) describes the performance and use of Common Channel Signaling 7 (CCS7) routes. The C7ROUTE reports are: 21227, 22227, 23227, 24227, and 27227. Fields required for group C7ROUTE:

CA7RTUNAU CR7TFCP7TFCR7TFC7CNTRE

CA7FRCRERCR7XTFCP7XTFC7XTF

OM group C7SCCP C7SCCP registers report the performance and use of the CCS7 signaling connection control part (SCCP). The C7SCCP reports are: 21229, 22229, 23229, 24229, 27229. Fields required for group C7SCCP:

CN7RTFALL CA7RTFNTCF7RTFNTCC7RTFNWCF7RTFNWC7RTFSS

CQ7RTFSSCCX7RTFUEC27UDTTCX7UDTTXC27UDTRC7UDTRX

CX7UDTSTXCL7UDTSRC27MSGHDCT7MSGHDC27MSGGC7MSGGT

C27CLS0TXCX7CLS0TC27CLS0RCX7CLSORC27CLS1TC7CLS1T

C27CLS1RXCR7CLS1RCS7SYNERCS7RTBKSC27LOCSC7LOCSS

OM group C7SCCPCO C7SCCPCO measures the volume of traffic and failures on the class 2 signaling connection control part (SCCP). Specifically, this OM group counts the total number of messages received and sent over the DMS-300 switch. This OM group produces separate counts for each type of message. It also counts the number of times a connection is rejected or fails and has to be taken down. The C7SCCPCO reports are: 21230, 22230, 23230, 24230, 27230. Fields required for group C7SCCPCO:

2001-8.0-RFM03-0302 Glossary 173

C27CLS2TX CX7CLS2TC27CLS2RCX7CLS2RC27DT1TC7DT1T

C27DT1RXCX7DT1RCX7ITTCX7ITRC27CRTC7CRT

C27CRRXCX7CRRC27CCTCX7CCTC27CCRC7CCR

C27RLSDTXCX7RLSDTC27RLSDRCX7RLSDRC27RLCTC7RLCT

C27RLCRXCX7RLCRCX7CREFRCL7CREFTCJ7COFAIC7COMRE

OM group CAINAGOM CAINAGOM (Carrier Advanced Intelligent Network Per-Agency Operational Measure- ments) group provides threshold reporting of OMs on a per agency basis. The CAINAGOM reports are: 21390, 22390, 23390, 24390, 27390. Fields required for group CAINAGOM:

ARGQUERY ARGRESPADGERROAVGEDPRCARGSTRCNAQGRSCLAGEDPRE

AQGEDPNOTAPGIVPREARGVIPRSARGCITAVGCIFARGCTRCNAGCTRCL

TRQUERYTRRESPTVERROTRSTRCNTQRSCLTPVIPRETVIPRS

OM group CAINIP CAINIP (Carrier AIN 1129-styple IP Interactions) provides OMs for ClearCause values in a Resource_Clear message. This group also tracks the number of times the TSTRC and TDISC timers expired at the local SSP. The CAINIP reports are: 21391, 22391, 23391, 24391, 27391. Fields required for group CAINIP:

IOPNORMAL INPTMIGPRESCAIGPAUNLEINPINVLEIPUABND

ILPINVCODIYPFAIIVPCHBSIOPRESNAISPISDNTIPRESTN

ISPTSKRFSILPINVCRIRPCAPFITPPROTEIVPABORIPSUPIN

ILPSTRCANIOPTMPFINPIPTMICPCTRCAICPTSTRIPTDIS

OM group CAINLNP CAINLNP (Carrier AIN Local Number Portability) provides OMs to track Local Number Portability functionality on a Carrier Advanced Intelligent Network. The CAINLNP reports are: 21392, 22392, 23392, 24392, 27392. Fields required for group CAINLNP:

BLLKBYSTS DFESTFAIINLNPIN

LYNPDISCDLPNPQUERLRNONLN

ONFCDLOOKTPERMLRBADGA

OM group CAINMSGR CAINMSGR (Carrier AIN Messages Received) reports the number of CAIN TCAP messages received from the Service Control Point (SCP) related to call processing. The CAINMSGR reports are: 21393, 22393, 23393, 24393, 27393. Fields required for group CAINMSGR:

AENLZRTE CNONTINUDCISCOSRND2RSRFRAILREPREPERR

CRLOSERACPPLERRCTANCRSRRCRBCMEVCMITRSAUTHTER

CCOLLINFOCTON2RSRSGENDNOARCARCGRESTTR533

OM group CAINMSGS CAINMSGS (Carrier AIN Messages Sent) provides OMs for TCAP messages sent to the Service Control Point (SCP) for CAIN processing. The CAINMSGS reports are: 21394, 22394, 23394, 24394, 27394. Fields required for group CAINMSGS:

OQRIGATT OL_FTRREIZNFOCOLIYNFOANLNYETWBUSOWCLDBUSO_NOANS

FSAILREPSRSEPERRCSOLSEARPPLERRRZSRCCLORTERMSOANSW

TCIMEOUTSOCDISCTIFRSTLERMATORMIDCALCSTRCLTR533

2001-8.0-RFM03-0302 Glossary 174

OM group CAINCRS CAINCRS provides reporting information for each Carrier AIN0.2 non-call related message that is sent by the switch. The CAINCRS reports are: 21395, 22395, 23395, 24395, 27395. Fields required for group CAINCRS:

TWERMNOT ASCGOVFLACGRSCS

OM group CAINOM CAINOM (Carrier AIN OM) provides threshold reporting of OMs for the Carrier Advanced Intelligent Network (CAIN). The CAINOM reports are: 21396, 22396, 23396, 24396, 27396. Fields required for group CAINOM:

AAINTIMO ATINTRDNANINSBOUAINABND

ATINTOVFLTKERMGNCAQINACGBAINACGR

OM group CAINTRIG CAINTRIG (Carrier AIN Trigger) provides OMs for each Carrier Advanced Intelligent Network (CAIN) Trigger and Event Detection Point. The CAINTRIG reports are: 21397, 22397, 23397, 24397, 27397. Fields required for group CAINTRIG:

QDUERY RDESPRCVBELOCKEIGGNORNOTRI

LREAVETDPEHRRONUO_MATCQVUERYSCSTRCON

RDCLRCONVEQDPSRCVEFDPREERDPNOTIFEATADD

FDEATAUTHFEEATCARNEEXTRTNQEXTCNRTVIPRE

VRIPRESPCRITCVIFCVTRCONCCLRCON

OM group CAINUIF CAINUIF (Carrier AIN User Interface Framework) provides OMs for TCAP Send_To_Resrouce and Connect_To_Resrouce messages. The CAINUIF reports are: 21398, 22398, 23398, 24398, 27398. Fields required for group CAINUIF:

ANINTOTDC ABINTOTAAAINUSRAAIINRSCNAINRSCN

ARINTOTTNAVINBUFFANINBUFOALINPSIGAINPDIA

OM group CALLWAIT CALLWAIT (Call Waiting) is used for both RES and IBN lines. The CALLWAIT reports are: 21231, 22231, 23231, 24231, 27231. Fields required for group CALLWAIT:

CNWTTATT CLWTABDCLWTFAICTWRCCNWDATCWDABD

CTWDFAILCTWDEXMPCNWOATCLWOABDCTWOFAICWOEXMP

CLWTTOVFLCTWOOVFCWCWGRANDTNYBYCCMNBSCATMBSCABD

MTBSCFAILMTBSEXMPCFWTCATCUWTCCONCVWTCPPCWTCIN

OM group CAUCPSCT CAUCPSCT (CDMA application unit) measures sector-based call processing resources and messages. The CAUPCPSCT reports are: 21232, 22232, 23232, 24232, 27232. Fields required for group CAUPCPSCT:

CSAUPGRES CCAUPGRRCSAUTSUCCTAUTBLKCSAUEDLOCSAUTRLCAUOATT

CSAUOSUCCCRAUOBLKCSAUORODCLAUORLCLAUERSFCSAUERLFSLTPGRE

SSLTPGRRSCSAUHATTCLAUHBLKCCAUHRLFCSAUHSUCCRAUHRLCAUDROP

CLAUDROPNCFAUESWFMOCTAHRQMUCTALLTMFCTALLFMPCTAREQCAUFWCA

CEAURECAPCDAUNOTCCAUNOWC

OM group CAUCPSYS CAUCPSYS (CAU call processing system) tracks events on a per-CAU basis and is used to measure CAU call processing performance as well as to record the number of various call processing events for CDMA test calls (Markov and Loopback), such as test call attempts. The CAUCPSYS reports are: 21233, 22233, 23233, 24233,

2001-8.0-RFM03-0302 Glossary 175

27233. Fields required for group CAUCPSYS :

CYAUPGREQ COAUPGRTCGAUPGTCGAUDUPPCSAUUNXPCAUORIG

CCAUREGNSCGAUHOSRCTAUHOTRCDAUHSOFCTAUVDSCCAUVRJC

CVLARTRIGCRAUCNICCAAUCNITCCAUPMWNCRAUPMWNCAUPMWN

CCAUTMWNACRAUTMWNCQAUTMWNSYLTPGRESOLTPGRTSLTPGT

CHAUCPSY1CSAUFLASCSTCATTCOTCCOMPCLTCPGTCTCOTHF

CSAUMRLSCAULRL

OM group CBK CBK (Code Block Group) counts call attempts that are blocked or passed by the network management (NWM) CBK control. The group counts each call attempt made under NWM CBK. The CBK reports are: 21234, 22234, 23234, 24234, 27234. Fields required for group CBK:

CSBKCNT CBKPAS

OM group CDACTS CDACTS (Customer Dialed Automatic Coin Toll Service) provides information about calls that can receive automatic coin toll service (ACTS). Calls may be routed to ACTS for the following reasons: Initial coin charges, coin charges due collection, initial coin period notification, nonstandard notification, or time and charges information. The CDACTS reports are: 21235, 22235, 23235, 24235, 27235. Fields required for group CDACTS:

AGCTSINI AYCTSCHAYCTSCNFACCTSNFALCTSTAACTSFAI

ANCTSWALKACCTSABAICTSSUCRACTSOPRATCTSOPRACTSTES

OM group CDMCCS CDMCCS (Customer-dialed mechanized calling card service) counts mechanized calling card services (MCCS) call attempts and failures caused by hardware problems with MCCS recievers (RCVRMCCS). The failures with the digital recorded announce- ment machine (DRAM) are also counted. Registers in this group also count attempts to make MCCS sequence calls and queries sent to the billing validation database on sequence calls. Registers in this group also count sequence call failures caused by hardware problems wth either MCCS receivers or DRAMS. The CDMCCS reports are: 21236, 22236, 23236, 24236, 27236. Fields required for group CDMCCS:

MLCCSATT MTCCSFAISLEQATSREQFAIMCCSOP

MCCCSABNMYCCSSUCSSEQQRMFCCSACBMCCSACB

OM group CF3P Lines that use the Three-way Calling (3WC) feature request three-port conference circuits (CF3P). Calls that go to service analysis position after the activation of the position request three-port conference circuits. Trunk test positions request three-port conference circuits when a request to monitor talking is issued. The CF3P reports are: 21237, 22237, 23237, 24237, and 27237. Fields required for group CF3P:

CLNFSZRS CCNFOVFCLNFQOCCNNFQOVFCNFQABA

CUNFTRUCUNFSBCSNFMBASVAIL-_CKTUNAVAIL_CKT

OM group CF3P for TOPS CF3P for TOPS is a variant of CF3P and applies to TOPS offices with toll and combined local/toll. The CF3P for TOPS reports are: 21238, 22238, 23238, 24238, and 27238. Fields required for group CF3P for TOPS:

CTNFSZRST CTNFOVFLCTNFQOCCCTNFQOVFCTNFQABNCNFTRU

CTNFSBUTCSNFMBUTLOPSZRTUOPSOVFTSOPSTRAVAIL_CKT

2001-8.0-RFM03-0302 Glossary 176

OM group CF6P CF6P (Six Port Conference Bridge) provides information on the use of a six-port conference circuit. Registers increase when the system seizes a circuit, the system makes a circuit not available, a quque overflows, or the system abandons a queue. The CF6P reports are: 21239, 22239, 23239, 24239, 27239. Fields required for group CF6P:

CLF6SZRS CCF6OVFCLF6QOCCF6QOVF

CUF6QABANCYF6TRSSEQQRMCCSACB

OM group CFRA CFRA (Call Forward Remote Access) measures the use of the call forward remote access (CFRA) feature and failures. Separate registers count attempts to use CFRA and failures caused by: not enough hardware or software resources, missing entries, or subscriber dialing that is not correct. The CFRA reports are: 21240, 22240, 23240, 24240, 27240. Fields required for group CFRA:

CVFRAATT CVFRASWOCTFRAHWOCYFRALIMCLFRADENCFRAFAI

OM group CNAB CNAB (calling name delivery blocking) provides a record of the activity of the CNAB feature for Residential Enhanced Services (RES). It also provides a record of the activity of the CNAB feature for Meridian Digital Centrex (MDC) lines. The CNAB feature is Caller ID Delivery and Suppression-Delivery (CiDSDLV) for Integrated Services Digital Network (IDSN) lines. The CNAB feature also uses this group. You can obtain the CNAB feature alone or as part of the universal access group of features. The CNAB reports are: 21241, 22241, 23241, 24241, 27241. Fields required for group CNAB:

CNNABATT CTNABFDECLNABSACCVNNDSDECYNABUNICYNABDENCNNDDEN

OM group CNAMD CNAMD (Calling Name Delivery) measures the display activity for the CNAMD feature for both intra- and inter-switched calls. The CNAMD reports are: 21242, 22242, 23242, 24242, 27242. Fields required for group CNAMD:

CLNAMDEL CLNAMPDECLNAMODENQANUMDENOAMTCPNAMTCPT

TKRIDUAVLNVAMACGBNOAMACGONPAMISPTLOCLKU

OM group CND CND (Calling Number Delivery) provides information on the office-wide use of Custom Local Area Signaling Service (CLASS) display features. These features include: Dialable Directory Number (DDN), Calling Number Delivery (CND), Calling Name Delivery (CNAMD), and Redirecting Number and Reason Delivery (RND). This OM applies to Residential Enhanced Services (RES), Meridian Digital Centrex (MDC), and Integrated Services Digital Network (ISDN) lines. The CND reports are: 21243, 22243, 23243, 24243, 27243. Fields required for group CND:

CTNDACT CANDDACCDNDFDNCLNDFDNCLNDOVFCNDDNDE

CLNDDDEL2C2NDPDECLNDPDELC2NDODECLNDODELCNDUNAV

D2DNDELDLDNDELDQDNUNAVDCDNNUNIDLDNTRUNLDIDE

LLDIDEL2LLDIOVFC2NMDECLNMDELC2NMNDECNMNDEL

C2NMUNAVLCLNMUNAVNLNDUNAVSTCWIDDECSSCWDACSCWDNYD

CLNMDODELCLNMDPDEC2NDCDECLNDCDELC2NDSDECNDSDEL

OM group CNDXPM CNDXPM (CND info for XPMs) increases when CND SUSP and CND automatic message accounting (AMA) are activated or deactivated. The OM group OTS register ORGFSET appears only in DMS-100 switch offices without TOPS. The CNDXPM reports are: 21245, 22245, 23245, 24245, 27245. Fields required for group CNDXPM:

2001-8.0-RFM03-0302 Glossary 177

CMNDNOMON CSNDNOMDCDNDEANCGNDOABNCSNDMSSCWDATT

SLCWDCOMPSRCWDFAISACWDNUTSRCWDNAKSPCWDNAKSCWDOVL

CPNDATTSCSNDCOMAPDSIATTADDSICOMCMMRRINGCMRMODE

CRMRCNDRQCRMRBCLDCQMRADSICQMRFASTCMMRTIMRCMRSHRA

OM group CNDB CNDB (Calling Number Delivery Blocking) provides information on office-wide use of the following: CNDB feature for Residential Enhanced Services (RES), Meridian Digital Centrex (MDC), Integrated Services Digital Network (ISDN) lines, Resource shortages or denials that result form use of the CNDB, MDC and ISDN. The CNDB reports are: 21244, 22244, 23244, 24244, 27244. Fields required for group CNDB:

CPNDBATT CPNDBSUCNNDBUSUCLNDBFDECNDBOVF

CVNNBSUPCYNDBUNICYNDBDENCYNBDENCNNBDEN

OM group COT COT (Customer-Originated Trace) measures the use of the Customer-originated Trace feature for an office. You can obtain this feature alone or as part of the common access group of features. Registers in the OM group COT count attempts, successful completions, not finished completions, and reasons for failures. The COT reports are: 21246, 22246, 23246, 24246, 27246. Fields required for group COT:

CNOTATT CLOTFDECLOTOVFCMOTCMPCDOTINCCOTPRC

CNOTOPTOCROTBDICVOTPFLCYOTUNICOTDEN

OM group CP CP provides information on the use of call processing software resources such as call condense blocks, call processes, multi-blocks, wakeup blocks, and long buffers. CP contains 27 peg registers. The CP reports are: 21247, 22247, 23247, 24247, and 27247. Fields required for group CP:

CLCBSZ CZCBOVFCPPSCCPTRACYPSUIORIGDEN

WZAITDENYCLPLSCLPLOOVFCZPLPOVFCZPLOSOUTBS

OZUTBOVFLMLULTSMZULTOVFWLAKESWCAKEOVFCINIT

WYINITCIZNITDENILNLBSIFNLBOVFCPLBOOV

OM group CPUSTAT CPUSTAT (Central Processing Unit Status) provides information on CPU occupancy. The CPU occupancy is the percentage of total CPU time that the CPU spends on one function CPU STAT shows the CPU percentage assigned to the scheduler and the percentage available for call processing at capacity. You can use this OM group to check capacity.The CPUSTAT reports are: 21250, 22250, 23250, 24250, 27250. Fields required for group CPUSTAT:

CLPSCPOCC CDCPAVAICEPSSCHECTPSFORCCPSMAINCMPSDNCPSO

CGPSGTERMCEPSBKCPPSIDLCMPSAUXCCPPSNETCPSSNI

OM group DCCICPCP DCCICPCP (Digital Control Channel ICP Call Processing) contains OMs that are collected and pegged in the Intelligent Cellular Peripheral (ICP) and are used for call processing activities. The registers in this group provide useful information to aid in system DCCH performance problems. The DCCICPCP reports are: 21251, 22251, 23251, 24251, and 27251. Fields required for group DCCICPCP:

DSPAGEREQ DGCCPGREDCCCMBORDCMBLORGDMBLTER

DECCHMSGDRINCPGRDAUNEXPGD1CCHMWODCCMWOC

DYCCMWOCRDSDIRETRDASBITMIDAPRADPDPREXP

DAPGREXPADFPGRADPDSCCRMHODCRGATT

2001-8.0-RFM03-0302 Glossary 178

OM group DRCW DRCW (Distinctive Ringing/Call Waiting) monitors use of the Distinctive Ringing/Call Waiting (DR/CW) feature. You can obtain this feature alone or as part of the common access group of features. The DRCW reports are: 21252, 22252, 23252, 24252, 27252. Fields required for group DRCW:

DNRCWEATT DFRCWEDEDTRCWEOVDTRCWACDGRCWDACDRCWEUS

D2RCWSATDNRCWSATDKRCWSDEDGRCWSBLDTRCWRINDRCWTAT

DVRCWTOVFDYRCWUNIDVRCWDENDVRCWAUNDRCWDUN

OM group DS1CARR DS1CARR (DS1 digital carrier maintenance summary) provides information about maintenance thresholds and out-of-service (OOS) thresholds. This OM group provides this information for digital trunks on digiatl peripheral modules (PM). When the SD-1 exceeds OOS thresholds, the system removes the DS-1 from service until the DS-1 is manually returned to service. Trunks on the DS-1 carrier are set to the carrier fail state. You can set each DS-1 carrier to NOT TO BE REMOVED or leave the DS-1 carrier alone. You perform this procedure when the DS-1 carrier reaches the DS-1 threshold. If you set the DS-1 carrier to NOT TO BE REMOVED, the system only generates a log. The CARRIER level of the MAP terminal displays this informaiton on the DS-1 carrier. The DS1CARR reports are: 21253, 22253, 23253, 24253, 27253. Fields required for group DS1CARR:

DAS1LCGA DFS1RCGDPS1LODUS1SLDUS1SBDUS1MBDS1PB

DRS1CBUDSS1BEDSS1EDSS1SEDSS1UADFS1AIDS1EC

OM group DSPRMAN DSPRMAN (Digital Signal Processor Resource Module (RM) Resource Management (RMAN) contains measures for continuity test (COT), dual tone multifrequency (DTMF), and tone synthesizer (TONESYN) resource events and usage statistics on the DMS-Spectrum PERIPHERAL Module (SPM) in the trunking application. These resources exist only on SDSP RMs on a SPM node. The DSPRMAN reports are: 21380, 22380, 23380, 24380, 27380. Fields required for group DSPRMAN:

CTOTLOW CYOTLOSCLOTDENCIOTUTICLOTHCWOTFAIDTMFLO

DYTMFLOSTDLTMFDENDITMFUTIDWTMFHMTFLOMYFLOSMFDEN

MIFUTILMWFHTTONELOTYONELOSTLONEDENTIONEUTITONEH

OM group DTSR DTSR (Dial Tone Speed Recording) provides information for the host site register. The DTSR provides information on the ability of the switch to return a dial tone for a host site in 3’s. The OM group SITE records results for remote sites. The DTSR reports are: 21254, 22254, 23254, 24254, and 27254. Fields required for group DTSR:

TYOTAL DELA

OM group DTSRPM DTSRPM (Dial Tone Speed Recording on a peripheral module base) provides informa- tion on dial tone speed recording (DTSR). This group provides information on DTSR for each peripheral module (PM) and for all line concentrating devices (LCD) in the switch. The DTSRPM reports are: 21255, 22255, 23255, 24255, and 27255. Fields required for group DTSRPM:

DYPLTOT DTPLDLDYGTTODTGTDLKYSTOKSDL

OM group EACARR EACARR (Equal Access Carrier Measurements) provides information on equal access measurements for each carrier that connects to the access tandem (AT). It makes measurements for each InterLATA carrier (IC) or international carrier (INC). The

2001-8.0-RFM03-0302 Glossary 179

EACARR reports are: 21256, 22256, 23256, 24256, 27256. Fields required for group EACARR:

ESAWNKFL ELADOMEEMAINTELAINTREAACKF

EXADOMPICECADOMXXEXAINTPIEAINTXX

OM group EASHRTRK (U.S. only) EASHRTRK (equal access charged trunk group traffic measurements) counts outgoing calls and overflows on trunk groups from end offices. It counts access tandems that carry calls for multiple interexchange carriers (IEC). The EASHRTRK reports are: 21257, 22257, 23257, 24257, 27257. Fields required for group EASHRTRK:

SGTGOPEG SLTGUSSTGOVF

OM group ENETMAT ENETMAT (Enhanced Network Matrix Card) monitors the performance of enhanced network (ENET) matrix cards. OMs for ENET matrix cards are divided into two sets: crosspoint (XPT) cards (like NT9X35) and link paddle boards (PB) (like NT9X40 & NT9X41). The ENETMAT reports are: 21258, 22258, 23258, 24258, 27258. Fields required for group ENETMAT:

ETNCDERR EUNCDFLEUNSBCDEUNMBCDEUNOFCDERNCDPARENSCDPA

EUNMCDPAREONCDISOEONSCDISERNMCDISETNPBEREUNPBFLENSBPB

EUNMBPBUERNPBPARERNSPBPAEUNMPBPAEONPBISOEONSPBISENMPBIS

OM group ENETOCC ENETOCC (Enhanced Network Occupancy) monitors the CPU occupancy of in-service enhanced network (ENET). The OM group ENETOCC provides information on each ENET in a DMS-100 family switch. Each ENET CPU sends occupancy information to the computing module (CM) every 60 s. The CM copies this information in to the OM registers. The ENETOCC reports are: 21259, 22259, 23259, 24259, 27259. Fields required for group ENETOCC:

EDNCPOCC EENSCHEETNFOREGNMAINEENBKENIDL

OM group ENETPLNK ENETPLNK (Enhaned Network Peripheral-side links) monitors the performance of ENET P-side links. All SuperNode offices with ENET have OM group ENETPLNK. The ENETPLNK reports are: 21260, 22260, 23260, 24260, 27260. Fields required for group ENETPLNK:

ERNSPCHER ETNLKEREUNLKFLEUNSBLKEUNMBLKENLKPAR

ERNSLKPAREUNMLKPAEONLKISOEONSLKISENMLKIS

OM group ESP ESP (Essential Service Protection) counts calls on essential service lines and failures to process essential line calls because of resource shortages. The ESP reports are: 21262, 22262, 23262, 24262, 27262. Fields required for OM group ESP:

EDSPORIG EYSPOVREGSPDELAELSPPMOREKSPPMSTEOSPPMBLESPPMCC

OM group EXT EXT (Extension Block OM) monitors the use of extension blocks. Extension blocks are auxiliary software resources allocated to calls for purposes like: special billing records, data extensions for operator services and custom calling features. The EXT reports are: 21263, 22263, 23263, 24263, 27263. Fields required for OM group EXT:

ELXTSEIZ EIXTOVFEXTH

OM group FTRQ FTRQ (Feature Queue Software Resources) counts the number of successful and unsuccessful requests for feature queue blocks made in an OM transfer period. The high-water mark (register FTRQHI) records the maximum number of feature queue blocks to date that were in simultaneous use during a transfer period. The FTRQ

2001-8.0-RFM03-0302 Glossary 180

reports are: 21264, 22264, 23264, 24264, 27264. Fields required for OM group FTRQ:

F2TRQSEIZ FLTRQSZF2TRQOVFFITRQOFLF2TRQHFTRQHI

OM group HPCBASIC HPCBASIC (HIgh Probability Completion - Basic) monitors HPC call traffic. Registers count the number of HPC call attempts on lines and trunks, and keep track of how these calls are handled. The HPCBASIC reports are: 21385, 22385, 23385, 24385, 27385. Fields required for OM group HPCBASIC:

LTINEATT TERKATTKERMLINTCERMTRTCERMNTERMIE

TLERMIECNETXNMCTRTLQQATTNQQOVFTXQQABDTQQTMRE

ELQQATTENQQOVFEXQQABDETQQTMREAKCGEXMPACGBLOC

OM group HPCTRKGP HPCTRKGP (High Probability Completion Trunk Group) measures HPC call traffic on a trunk group basis. Registers count the number of HPC call attempts on a trunk group, the number of HPC calls that overflowed due to all members of a trunk group being busy, the number of trunk group queue overflows, and the number of queued calls encountering a timeout treatment. The HPCTRKGP reports are: 21386, 22386, 23386, 24386, 27386. Fields required for OM group HPCTRKGP:

HLPCATT HXPCOVFQLUETMREQUEOVF

OM group HUNT HUNT provides information on the performance of each hunt group in the DMS switch. The OM group HUNT counts: attempts to terminate calls on lines in the hunt group, attempts that fail to find an available line and overflow, and calls attempted again that terminate on a line and fail. The HUNT reports are: 21265, 22265, 23265, 24265, and 27265. Fields required for group HUNT:

HLUNTATT HTUNTOVFHFUNTRHNHTUNTTRHUNTMN

OM group IBNAC IBNAC (Integrated Business Network attendant console) provides information on the number and types of calls handled by individual attendant consoles. The types of calls counted include listed directory number, O type, intercepted, transferred, forwarded, recalled, and a misc. category for any other calls. This DM group also counts the number of times attendants hold, originate, and extend calls.The IBNAC reports are: 21266, 22266, 23266, 24266, 27266. Fields required for OM group IBNAC:

IPACLDN I0ACINTRITACDIALILACXFRAIACRECA

ILACCFWILACSPCIYACQTOTIGACPOSBIACORI

IDACEXTDIHACHLIRACAUTIRACTOTDIACORGD

IRACCTVTUI1ACBSYDI2ACLDNI3ACLDNIACLDN

I5ACLDN4I6ACLDNI7ACLDNIRACLDNIACLDN

OM group IBNSG IBNSG (integrated Business Network Subgroup) provides information about the activities of customer group attendant consoles by the subgroup. A customer group is a set of lines which belong to a group of individuals that request special service. Subgroups allow customers to have attendatnt-type calls that the subgroups answer locally during the day or busy hours. Subgroups centralize this function. A customer group can have up to seven subgroups. A subgroup can have up to 32 consoles. The IBNSG reports are: 21268, 22268, 23268, 24268, 27268. Fields required for OM group IBNSG:

2001-8.0-RFM03-0302 Glossary 181

WURKTMU LUPCUWINQALCTVTLLPOVFATQDF

ASBNDNNNSCALLAPNSLDA0NSINTRATNSDIALANSXFRA

CLWRECALLCLORECALDSARECALRTECALLSWPCLCCANSCF

LYPHLDRECALNSDELAQLTOTAOLRIGCALELXTDCALHLDCAL

ARUTHCALLTROTDOYRIGDARCPOSBACCBSYSDSERIALR

OM group ICPCP ICPCP (Intelligent Cellular Peripheral Call Processing) peg intelligent cellular peripheral (ICP) call processing events. This information is used to update the appropriate OM tables in the control module (CM) for a cell site. Also, appropriate CM OMs are pegged when maintenance actions are performed (either system or manually invoked). The ICPCP reports are: 21269, 22269, 23269, 24269, 27269. Fields required for group ICPCP:

MOBLORG MQBLORGCPPAGEREPOAGERESMRBLTERCMTBLREGMBLINCP

MGBLREORDCYCHMSDSIRETRSTATTOISNVSATDISNCPGRESBITMI

EHBITMISPOGHASPIGHASHTUINEXPGNIBPREQNQBPRSPRSPLSHR

RYSPLSHSCSYFAILQRSDPASSQRSAIGNOREC1CHMWOCRCHMWOCCCHMWOC

V1HCMWOAVRCHMWOCVCHMWOC

OM group ICPDCP ICPDCP (Intelligent Cellular Peripheral Dynamic Call Processing) pegs digital call processing events that occur on an intelligent cellular peripheral (ICP). The ICPDCP reports are: 21270, 22270, 23270, 24270, and 27270. Fields required for group ICPDCP:

DOMBLORG DOMBORACDPMBORDCDOPAGRESDMBTRAC

DGMBTRDCODSICCHMSDCVCCTOINVDVC

OM group ICPDFA ICPDFA (Intelligent Cellular Peripheral Dynamic Frequency Association) provides the operation measurements to evaluate the performance of the Dynamic Frequency Association (DFA) feature. The ICPDFA reports are: 21271, 22271, 23271, 24271, and 27271. Fields required for group ICPDFA:

CCALLATT CRALLSUCCPALLCIBCQALLDROCHHANRENOCLRC

NKOUSECHNKOCHBLNTODFABLSSCANEVNSLCANPASSCANFAI

NROMPICLFNTOLPICLNHOMACARMISMATC

OM group ISDD ISDD (Incoming start-to-dial delay) provides information on the grade of service given to incoming trunk calls to a DMS switch. The incoming trunk calls to a DMS switch go through three types of XMS-based peripheral modules (XPM). When the length of time required to complete a call exceeds a defined threshold, the register for each XPM increases. The ISDD reports are: 21280, 22280, 23280, 24280, 27280. Fields required for group ISDD:

DTPSEIZ DYPATMPDNPTDLDZPABDDTTSEIDTATMP

DNTTDLYDZTABDMTFSEIMYFATMPMNFTDLMFABD

OTTHSEIZOYTHATMPONTHTDLOGTHABDISDDMS

OM group ISGCPU ISGCPU (ISDN services group CPU occupancy) measures ISDN services group (ISG) occupancy of the D-channel handler (DCH) CPU. It contains a count of the CPU occupancy that lies in each of ten percentage ranges. For example, 0-10%, 10-20%, and so on.The ISGCPU reports are: 21281, 22281, 23281, 24281, 27281. Fields required for group ISGCPU:

2001-8.0-RFM03-0302 Glossary 182

D0CPU10 D0CPU2D0CPU3D0CPU4D0CPU5DCPU6

D0CPU70D0CPU8D0CPU9DTCPU10DRCPUTODCPURT

OM group ISGOVLD ISGOVLD (ISDN services group overload) measures the degree of overload of an ISDN services group (ISG). It provides information on the three levels of overload control for an ISG: congestion, overload, and frame discard. The ISGOVLD reports are: 21282, 22282, 23282, 24282, 27282. Fields required for group ISGOVLD:

CTONGENTR CEONGEXICRONGTIOVLDENT

OELDEXITOCVLDTIMO2V16DSOV16DSC

OM group ISUPCONN ISUPCONN (Integrated Services Digital Network User Part Connection) provides information on circuit availability and successful call attempts. This information is used to determine the effects of the surrounding network on integrated services digital network (ISDN) user part (ISUP) performance. The ISUPCONN reports are: 21284, 22284, 23284, 24284, and 27284. Fields required for group ISUPCONN:

IESCONBAD ICSCONUCIASCONUCIFSCONUCINSCONUCIBSCONUCISCONUC

IOSCONUCSITSCONUCICSCONCOIRSCONICIRSCONFAISCONIN

OM group ISUPERRS ISUPERRS (Integrated Services Digital Network User Part Errors) counts abnormal conditions, unexpected messages, and the absence of acknowledgment messages during call setup, call take down, and maintenance procedures on the switch. These counts are used by maintenance personnel to track integrated services digital network user part (ISUP) stability. The ISUPERRS reports are: 21285, 22285, 23285, 24285, and 27285. Fields required for group ISUPERRS:

ISSERRRSC IOSERRGRIDSERRBLICSERRBAILSERRRLISERRRE

OM group ISUPUSAG ISUPUSAG (Integrated Services Digital Network User Part Usage) counts incoming and outgoing integrated services digital network user part (ISUP) messages. The ISUPUSAG reports are: 21286, 22286, 23286, 24286, and 27286. Fields required for group ISUPUSAG:

I2SMSGOUT INSMSGOTI2SMSGIISMSGIN

OM group LINAC LINAC (Line access measurements) monitors grade of service for line access. The LINAC indicates the problems which customers’ experience in an attempt to access a telephone network through an XMS-based peripheral module (XPM). Counts are made for each line-concentrating module (LCM). Four registers count call attempts, failures, abandons, and tone delays. The LINAC reports are: 21387, 22387, 23387, 24387, 27387. Fields required for group LM:

LFINCAT LNINCATLLINABALINTDE

OM group LM LM (Line module maintenance summary) provides maintenance measurements for line modules and remote line modules. The LM reports are: 21287, 22287, 23287, 24287, and 27287. Fields required for group LM:

LTMERR LUMFLLUMSBLGMMBLLMCCTDLMCCTF

LPMMBPLOMSBLOMMBTCLPMSBTCLMCCTO

OM group LMD LMD (Line Traffic) provides traffic information for the following peripheral modules (PM): remote line modules (RLM), line concentrating modules (LCM), virtual line concentrating modules (VLCM), remote concentrator terminals (RCT), remote concen- trator subscribers (RCS), integrated services line modules (ISLM), digital line modules (DLM), very small remotes (VSR), enhanced line concentrating modules (ELCM),

2001-8.0-RFM03-0302 Glossary 183

integrated services digital network (ISDN) line concentrating modules (LCMI), intelli- gent peripheral equipment (IPE) line modules (LM). The LMD reports are: 21288, 22288, 23288, 24288, and 27288. Fields required for group LMD:

NTTERMATT NUORIGATLKMTRTLERMBLOLRIGFAIPERCLF

STTKCOINSRTEVERMKADNTATONRIGBLORIGAB

OM group LNP LNP (Local Number Portability) allows subscribers to change service providers. This also allows subscribers to retain a directory number (DN). To access a ported DN, the DMS switch sends a query to a database at a Service Control Point (SCP). If the dialed DN ports, the SCP returns a location routing number (LRN) that identifies teh DN switch. If the dialed DN does not port, the SCP returns the dialed DN. The LNP reports are: 21289, 22289, 23289, 24289, 27289. Fields required for group LNP:

L1NPQRY L1NPQRYLRNPQFTLENPRFERLCNPQFRTLNPQES

LGNPQESC1LPNPQFACLPNPQFSCLTNPQFSSLCNPRFCNLNPRFDS

LTNPRFSTRL1NPPORLLNPPORTLRNPRELMNPUADNLNPUAHO

LRNPQLRNQLVNPQLRNLANPQLRNLNPQLRN

OM group MTXDCALL MTXDCALL (Mobile telephone exchange data calls) counts the usage of each of the four types of data call: CDMA_ASYNC_96--CDMA asynchronous data (rate 9.6), CDMA_ASYNC_144--CDMA asynchronous data (rate 14.4), CDMA_G3FAX_96-- CDMA group 3 fax (rate 9.6), and CDMA_G3FAX_144--CDMA group 3 fax (rate 14.4). The MTXDCALL reports are: 21290, 22290, 23290, 24290, 27290. Fields required for group MTXDCALL:

DMCMOATT DTCMOCODMCMTATDLCMTCODCIWFRE

OM group MWTCAR MWTCAR (Message waiting call request) provides information on feature use and traffic measurements. This OM also provides information on failures that result from a lack of software and hardware resources for the following features: Integrated Business Network (IBN), Message Waiting (MWT), Call Request (CAR), Call Memory (CM), Call Covering (CCV), or CLASS Message Waiting Indicator (CMWI). The MWTCAR reports are: 21291, 22291, 23291, 24291, 27291. Fields required for OM group MWTCAR:

MTWTATT MTWTACMLWTDEACMYWTOVFMTWTQUERCARAT

CLARFAILCTAROVFCTARODACCLARTDACCVARDOVFCARRETR

CLARRFAILCTARROVFCLMATCLMFAICTMOVFCCVAT

CLCVFAILCTCVOVFCTMWIACCKMWIDACCSMWINACCMWITRM

CWMWIUNAVCTMWISCTMWRACCCMWRDACCAMWRDNACMWRDND

OM group NARUSAGE NARUSAGE (Network access registers usage) provides information on the use of network access registers (NAR). It counts attempts to use NARs and counts blocked NAR attempts. This OM group also provides a traffic use count for each NAR. The NARUSAGE reports are: 21292, 22292, 23292, 24292, 27292. Fields required for OM group NARUSAGE:

NDARTOTAL NFARBLCKNARTRA

OM group NMC NMC (Network Module Controller Maintenance Summary) counts errors and failures to recover from errors in the following: in service message links between network modules and peripheral modules, speech connections, and in-service network module controllers. The NMC reports are: 21362, 22362, 23362, 24362, 27362. Fields required for OM group NMC:

2001-8.0-RFM03-0302 Glossary 184

NRMMSGER NRMSPCHENLMCERNLMMSGFNTMSPCHFNMCFL

NUMSBUNUMMBNUMPTSBNUMPTMBNUMJRSBNMJRMB

OM group OAINQMS OAINQMS (Operator Service System Advanced Intelligent Network Queue Management System) provides peg counts for OSSAIN calls on a per queue basis. It provides counts for calls that request an OSSAIN session from the QMS call agent and manager (CAM) and also counts on the action taken by the CAM in response to the request. The OAINQMS reports are: 21293, 22293, 23293, 24293, and 27293. Fields required for group OAINQMS:

SCESRQSTD QMUEUEDGQOTSESIDEFLCTC

OPVFLMXCQOQVFLMXADCENIEDCABANDON

OM group OAPCALP3 OAPCALP3 (Open Automated Protocol Call Processing 3) contains a register for each call processing and non-call processing operation and response message defined in the OAP protocol. The purpose of the registers in this OM group is to track usage of the operations and responses. These OM registers are pegged on a per session pool basis for call processing and session pool operations and are pegged on a per node basis for node maintenance operations. The OAPCALP3 reports are: 21294, 22294, 23294, 24294, and 27294. Fields required for group OAPCALP3:

STESNBEG TIRGEVSSESNINSEESNINISHESNINSSPCHPTSPCHPT

SRPCHPTETSXTOPTEXTOPRTLXTOPRXSFRCTRXEFRCTRXFRCTR

OM group OFZ OFZ (Office Traffic Summary) provides information for traffic analysis. The OM group OFZ uses a primary route scoring philosophy. This OM group differs from OTS because OFZ counts calls for the intended destination, not the destination where the call terminates. The OFZ reports are: 21295, 22295, 23295, 24295, and 27295. Fields required for group OFZ:

NMORIG OTRIGTRONRIGLKOERIGABDORIGTON

OTRIGANNONRIGOUNTIITNOUINLK

ICNABNMIENABNINNTONIMNANINTR

OTUTNWATTLRMNWATKRMMFTCRMBLLNMBP

OM group OFZ2 OFZ2 is an extension of the OM group OFZ. The OFZ2 reports are 21296, 22296, 23296, 24296 and 25296. Fields required for group OFZ2:

OCFZNCIT OTFZNCTONFZNCLODFZNCBOCFZNCIOTFZNOSOFZNCO

OMFZNCRTONFZNCIOFFZNCOOMFZNCOPMSGPDL

OM group OMMTX OMMTX (Operational Measurement Mobile Telephone Exchange) pegs the events that apply specifically to a subscriber unit. The OMMTX reports are: 21971, 22971, 23971, 24971, and 27971. Fields required for group OMMTX:

MSLATTS MSLCOMPLSMATTLSMCOMPMSMATTMSMCOMPMOATT

MSOCOMPSOSMATTOSMCOMPHSOATTHSOCOMPPSGREQPGRESP

MTBORIGSMLTRMDOROPCALDSROPHRSEGATTRSEGCOMPEXSPATT

ETXSPCOMPSSTIMEOUDPMBORIGDSPGRESDSHOATTDSHOCOMPDDRPCAL

DSDROPHOMOOBAND1VCCTOMMTXSP

OM group OMMTX3 OMMTX3 (Operational Measurement Mobile Telephone Exchange 3) is pegged to record the mobile call processing events such as the number of mobile registrations. The registers n this group are used to engineer the load balancing among the cells. The

2001-8.0-RFM03-0302 Glossary 185

OMMTX3 reports are: 21298, 22298, 23298, 24298, and 27298. Fields required for group OMMTX3:

PGWRUPREG PGARMCHRTGIMBSREZGONEBREDISTBRE

OM group OMMTXHO OMMTXHO (Operational Measurement Mobile Telephone Exchange Handoff) pegs the events that apply to handoff-related information including attempted and completed handoffs. The OMMTXHO reports are: 21299, 22299, 23299, 24299, and 27299. Fields required for group OMMTXHO:

HROSENTCP CPALLOVENLORESNHOADJCEAEBOVETNQOVOICHOFFRE

HQOFFRTRYHYINREHQINRTRHYOUTREHQOUTRTRHYOVRREHOVRRTR

HSOVRHOTLLSCRREQLFCRRESPAQDHOFHYDIRREHQDIRRTYRHMTCRE

HFMTCRTRYDFAHOFDTDHOFMPAHOATMBAHOCMHOACKSW

OM group ONI ONI (Operator number identification) provides information about centralized auto- matic message accounting (CAMA) calls that use ONI. The ONI allows a CAMA operator on the line to receive the calling number. The CAMA operator enters the calling number in the CAMA equipment for billing purposes. The ONI reports are: 21300, 22300, 23300, 24300, 27300. Fields required for OM group ONI:

OSNIATT OLNISZROUNIOVFOUNIOCCONICHDL

OLNIQOCCONNIQOVFOTNIQABAOTNIQTOUONIDELG

OCNIFDISCOANIMTCHOUNIWRGCOUNISBONIMB

OM group OTS OTS (Office Traffic Summary) counts calls by source and destination. Sources can be trunk, line, or system generated. The OTS reports are: 21301, 22301, 23301, 24301, and 27301. Fields required for group OTS:

NMORG OTRGTROTRGOUONRGTRMOTRGABDORGLK

OCRGFSETNMINITNCTRITNCOUIMNCTRMINCABN

ITNCABNCITNCLKISNCFSENMSYSTYSTRSYSOU

SNYSTRMTSTYSABDSTYSLKSYSFSE

OM group PM PM (Peripheral Module Maintenance Summary) counts errors, faults, and mainte- nance state changes for DMS peripheral modules (PM) with node numbers. This group performs separate counts for each PM that associates with a DMS switch. The data shows the performance of PMs.The PM reports are: 21304, 22304, 23304, 24304, 27304. Fields required for OM group PM:

PTMERR PUMFLPUMMSBPUMUSBPUMMMBPPMUMBPMSB

PRMMBPPRMSWXFPRMMWXFPRMSCXFPGMMCSFPLMCCTDPMCCTF

PTMPSERRPRMPSFLPTMRGERPOMRGFLPOMSBTCPPMMBTCPMCCTO

PTMINTEGPRMDFLPUMDRERPUMDRMBPMDRSB

OM group PM1 PM1 (Peripheral module single-unit maintenance summary) provides information on the following: errors, faults, and system- and manual-busy use for single-unit peripheral modules (PM without node numbers). This group supplies the data that shows the performance of PM groups. The PM1 reports: 21305, 22305, 23305, 24305, 27305. Fields required for OM group PM1:

PTM1ERR PSM1FLPDM1NITPUM1LOAPM1MB

PUM1SBUPUM1PSMBPRM1PSSBPTM1PSERPM1PSFL

2001-8.0-RFM03-0302 Glossary 186

OM group PM2 PM2 (Dual-unit peripheral module maintenance summary) provides information on the performance of dual-unit peripheral modeuls (PM) of type IPML (without node numbers). The PM2 also collects data for the single-unit very small remote (VSR) PMs. The PM2 reports are: 21306, 22306, 23306, 24306, 27306. Fields required for OM group PM2:

PTM2ERR PSM2FLPDM2INITPUM2LOAPUM2USBPM2UMB

PUM2MSBUPRM2MMBPRM2CXFPBM2ECXFPBM2CCTSPM2CCTM

PRMECCTFLPRM2CCTEPRM2MWXFPRM2SWXFPRM2MCXFPM2SCXF

POM2MBTCOPRM2BTCPTM2PSERPRM2PSFLPTM2RGEPM2RGFL

OM group PRADCHL2 PRADCHL2 (PRA D-channel layer 2 performance summary) monitors the layer 2 (Q.921) traffic that travels over the primary access (PRA) D cahnnels in the integrated services digital network (ISDN) peripherals (i.e., ISDN digital trunk controller - DTCI, the line trunk controller - LTC, or the Spectrum Peripheral Module - SPM). The PRADCHL2 reports are: 21307, 22307, 23307, 24307, 27307. Fields required for Om group PRADCHL2:

PXRDS0TX PXRDS0RPDRDRNRTPRFLSHE

OM group PRAFAC PRAFAC (Primary rate access facility) measures message traffic that is generated by network ring again (NRAG) on pirmary rate access (PRA) D channels. NRAG on PRA uses connectionless signaling on PRA, that is, no call is present. The PRAFAC reports are: 21308, 22308, 23308, 24308, 27308. Fields required for OM group PRAFAC:

FMACMSGOR FRACMSGTFXACMSGTDTISNORTDAISCNGSDRISRTUNREJMSGO

RREJMSGTMRSEJMSGTRXEJMSGDRTENORTRAEJCNGSREJRTUN

OM group PRP PRP (Preroute Peg) counts call attetmps to specific codes. It provides network man- agement statistics that are used for traffic studies. The registers of PRP indicate when code block (CBK) controls should be implemented. The PRP reports are: 21309, 22309, 23309, 24309, 27309. Fields required for OM group PRP: PRPCNT.

OM group QMSACT QMSACT (Queue Management System Activity) records events that occur in the Queue Management System call and agent manager (QMS CAM) when the QMS CAM interacts with other applications. The QMSACT reports are: 21310, 22310, 23310, 24310, and 27310. Fields required for group QMSACT:

CDALLARIV CLALLQCXALLDEFOEVLMAOQVLNOCQSLPLCLRENOSPLC

OM group QMSDATA QMSDATA records events in the Queue Management System call and agent manager (QMS CAM). The system searches call and agent queues in response to requests from QMS applications. The QMSDATA reports are: 21311, 22311, 23311, 24311, and 27311. Fields required for group QMSDATA:

CTQELHIGH CTTAQATCTTAQDEPCTQAQATCQAQDEP

CTQAQSRCHPTRAQATPTRAQDEPCSQSRCATCQSCON

OM group RADR RADR (Receiver Attachment Delay Recorder) provides information about receiver attachment delay recorder tests. It generates test call originations to determine the interval between a request and a connection for attachment to a receiver. The RADR reports are: 21312, 22312, 23312, 24312, 27312. Fields required for OM group RADR:

RPADTESTC RPADLDLYRADUDLY

OM group RCF RCF (Remote Call Forwarding) counts remote call forwarded calls to toll offices with

2001-8.0-RFM03-0302 Glossary 187

centralized automatic message accounting (CAMA) billing systems. It also counts remote call forwarded calls to intertoll trunks in local automatic message accounting (LAMA) offices. The RCF reports are: 21313, 22313, 23313, 24313, 27313. Fields required for OM group RCF:

RGCFOFFRD RDCFUSARCFDFL

OM group RCLCDIS RCLCDIS (Remote line concentrating module intraswitched calls) provides information on traffic for intraswitched calls in a remote line concentrating module (RLCM) or an intraswitch remote line concentrating module (IRLCM). Intraswitching enables an RLCM or IRLCM to switch calls internally when RLCM or IRLCM service the calling and called parties. The RCLCDIS reports are: 21315, 22315, 23315, 24315, 27315. Fields required for OM group RCLCDIS:

IKSTOTATT IUSTOTBLITSTOTTRIKSUN0ATISUN0BL

ITSUN0TRUIKSUN1ATIUSUN1BLISUN1TR

OM group RCVR RCVR counts successful and failed attempts to obtain receiver circuits in the DMS. The RCVR reports are: 21314, 22314, 23314, 24314, 27314. Fields required for group RCVR:

RLCVRSZRS RCSVOVFRLCVQOCRCVQOVF

RUCVQABANRUCVTRRUCVCSBRCVMB

OM group RSCIR RSCIR (Remote Switching Center Inter-Switching Channel Traffic) evaluates traffic loads on inter-switching channels. Inter-switching channels are channels on the DS-1 links that connect two remote switching centers (RSC) located at a remote site. The RCVR reports are: 21316, 22316, 23316, 24316, and 27316. Fields required for group RSCIR:

RLSCIRALL RTSCIRBLRTSCIRALRLSCIRBLRSCIRAT

RTSCIRBTLRTSCIRATRUSCIRBTRSCIRCB

OM group RSCIS RSCIS (Remote Switching Center Intra-Switching Traffic) evaluates traffic loads on intra- switching channels in a remote switching center. The RSCIS reports are: 21317, 22317, 23317, 24317, and 27317. Fields required for group RSCIS:

RLSCISALL RTSCISBLRTSCISALRLSCISBLRSCISAT

RTSCISBTLRTSCISATRUSCISBTRSCISCB

OM group SCA SCA (Selective Call Acceptance) monitors the use of the SCA feature. You can obtain this feature alone or as part of the universal access group. The SCA reports are: 21318, 22318, 23318, 24318, 27318. Fields required for group SCA:

SNCAEATT SFCAEDESTCAEOVSTCAACSGCADACSCAEUS

S2CASATSNCASATSKCASDESTCASBLS2CASRUSCASRUT

SVCASTRMSYCAUNISVCADENSVCAAUNSCADUN

OM group SCF SCF (Selective Call Forwarding) monitors the use of the SCF feature. This feature can be obtained alone or as part of the universal access group of features. The SCF reports are: 21319, 22319, 23319, 24319, 27319. Fields required for group SCF:

SFCFEATT SNCFEOVSGCFEDESTCFEUSSTCFACSDCFDACSCFFW

STCFFWD2S2CFSASLCFSATSLCFFAISLCFOVFSNCFSOVFSCFSDE

SVCFSBLKSYCFUNISVCFDENSVCFAUNSCFDUN

2001-8.0-RFM03-0302 Glossary 188

OM group SCRJ SCRJ (Selective Call Rejection) provides information on the SCRJ feature. This feature can be obtained alone or as part of the universal access group of features. The SCRJ reports are: 21320, 22320, 23320, 24320, 27320. Fields required for group SCRJ:

SNCRJEATT SFCRJEDESTCRJEOVSTCRJACSCRJDAC

STCRJEUSGS2CRJSASNCRJSATSKCRJSDESCRJSBL

SVCRJSRJTSYCRJUNISVCRJDENSVCRJAUNSCRJDUN

OM group SITE for RLM SITE for RLM (Traffic and dial-tone speed recording for remote sites) provides information on traffic-related counts and dial-tone speed recording (DTSR) for remote sites. The operation company uses DTSR to measure the ability of the switch to return dial-tone within 3 s. The SITE for RLM reports are: 21321, 22321, 23321, 24321, 27321. Fields required for OM group SITE for RLM:

ITNTRASIT ITNTERSIRMORIGOUINRTER

DYPTESTCDCPDELADYTTESTDTDELA

OM group SITE for RPM SITE for RPM (Traffic and dial-tone speed recording for remote sites) provides infor- mation on traffic-related counts and dial-tone speed recording (DTSR) for remote sites. The operation company uses DTSR to measure the ability of the switch to return dial-tone within 3 s. The SITE for RPM reports are: 21322, 22322, 23322, 24322, 27322. Fields required for OM group SITE for RPM:

ITNTRASIT ITNTERSIRMORIGOUITNRTERLDMDP_LTMDP_LMDT_

LTMDT_DL2CMDP_LDCMDP_TL2CMDP_LTCMDP_DL2CMDT_LCMDT_T

L2CMDT_DLTCMDT_DL2CMKS_LDCMKS_TL2CMKS_LTCMKS_DRCTDP_

RDCTDP_T2R2CTDP_RTCTDP_DR2CTDT_RDCTDT_TR2CTDT_RCTDT_D

D2LMKS_TDDLMKS_TD2LMKS_DLMKS_D

OM group SITE2 SITE2 (Traffic and tone speed recording, remote site 2) provides information on traffic-related counts and dial-tone speed recording (DTSR) for offices with lines connected to the following types of sites: remote concentrator SLC-96 (RCS), and remote carrier urban (RCU), remote digital terminal (RDT). The SITE2 reports are: 21323, 22323, 23323, 24323, 27323. Fields required for OM group SITE2:

R2CSDP_T RDCSDP_TR2CSDP_RTCSDP_DR2CSDT_RDCSDT_TR2CSDT_RCSDT_D

R2CUDP_TRDCUDP_TR2CUDP_RTCUDP_DR2CUDT_RDUCDT_TR2CUDT_RCUDT_D

R2DTDP_TRDDTDP_TR2DTDP_RTDTDP_DR2DTDT_RDDTDT_TR2DTDT_RDTDT_D

R2DTKS_TRDDTKS_TR2DTKS_RTDTKS_DR2CUKS_RDCUKS_TR2CUKS_RCUKS_D

OM group SLLNK SLLNK (SL-100 link) provides information about the status of the outgoing datalink and the number of messages it can handle. The SLLNK reports are: 21324, 22324, 23324, 24324, 27324. Fields required for OM group SLLNK:

SKLLNKOVF SULLNKOSLLNKQ

OM group SLLNKINC SLLNKINC (SL-100 incoming link) provides information on the status of the incoming data link and the number of messages it can handle. The SLLNKINC reports are: 21370, 22370, 23370, 24370, 27370. Fields required for OM group SLLNKINC:

SKLLNKIOV SULLNKIOSDLLNKIQSFLLNKBASLLNKIO

OM group SOTS SOTS (Supplementary office traffic summary) counts calls the system routes to general- ized no-circuit treatment (GNCT). These registers provide information on outgoing and terminating network performance. The SOTS reports are: 21325, 22325, 23325, 24325, and 27325. Fields required for group SOTS:

2001-8.0-RFM03-0302 Glossary 189

SDOTSNCBN SMOTSNCISTOTSNCISTOTSNCISFOTSNCLSOTSNCO

STOTSNCONSTOTSNCOSCOTSNCRSCOTSNCTSMOTSNOSSOTSPDL

STOTSPSGMSLOUTNWSLOUTMFSFOUTRMFSFOUTOSSOUTROS

SLTRMNWTSKTRMMFSKTRMBLSLTRMRBLSTRMGSG

OM group STN STN (Special Tones) provides information about special tones broadcast from trunk cards in the maintenance trunk modules. The STN reports are: 21326, 22326, 23326, 24326, and 27326. Fields required for group STN:

SFTNATTS SLTNMTCHSUTNOVFSUTNMBSUTNSBSTNTR

OM group SVCT SVCT (Service Circuits) provides information on service circuits. The SVCT reports are: 21371, 22371, 23371, 24371, 27371. Fields required for group SVCT:

S2VCSZRS SLVCSZSCVCOVFSLVCQOCSVCQOVF

SUVCQABANS2VCTRSUVCTRUSUVCSBSVCMB

OM group TCAPUSAG TCAPUSAG (Transaction Capabilities Application Part Usage Measurements) records the use of transaction capabilities application part (TCAP) for each subsystem. Examples of transaction capabilities are: messages, transaction and components. The TCAPUSAG reports are: 21327, 22327, 23327, 24327, and 27327. Fields required for group TCAPUSAG:

T2CMSGOUT TNCMSGOUT2CMSGITRCMSGINTMCUNIDITCQWPER

TMCQNPERMTMCCWPERTSCCNPERTLCRESPNTLCINVKTCINVKN

TLCRSLTLTRCRSLTNTTCRTERTTCREJECTECABORTCDPUS

OM group TFCANA TFCANA (Traffic separation/traffic analysis) provides information on call attempts, call setup time, and call connect time. The information occurs at source-traffic-separation and destination-traffic-separation intersections. The TFCANA reports are: 21328, 22328, 23328, 24328, 27328. Fields required for group TFCANA:

TUFANPEG TUFANSTFANC

OM group TLDNPOM TLDNPOM (temporary local directory number pools for each operational measure- ment) The TLDNPOM reports are: 21360, 22360, 23360, 24360, 27360. Fields required for group TLDNPOM:

TSLDNMAX TPLDNATTTOLDNCOMTLLDNTMTLDNOVF

OM group TONE TONE provides information on traffic for tone generators. The OM group TONE contains two peg registers, TONEATT and TONEOVFL. The TONE reports are: 21329, 22329, 23329, 24329, and 27329. Fields required for group TONE:

TLONEATT TONEOVF

OM group TM TM (trunk modules) counts errors, faults, and maintenance state transitions for trunk modules, maintenance trunk modules, and remote service modules. The TM reports: 21363, 22363, 23363, 24363, and 27363. Fields required for group TM:

TTMERR TUMFLTUMSBTMMB

TLMCCTDGTPMCCTFTPMMBTMSB

TOMMBTCOTPMSBTCTMCCTO

OM group TOPSDACC TOPSDACC (Traffic Operator Position System Directory Assistance Call Completion) counts call completions that are handled by an operator and by Automatic Directory

2001-8.0-RFM03-0302 Glossary 190

Assistance Call Completion (ADACC). ADACC allows a subscriber making directory assistance (DA) call to be connected to the requested number without originating a new call. The subscriber can be connected to the requested number manually by an operator, or automatically by an audio response unit (ARU). The TOPSDACC reports are: 21330, 22330, 23330, 24330, and 27330. Fields required for group TOPSDACC:

OTHACCPT AYREQSARDENATOFFEAACCP

OM group TOPSQMS TOPSQMS (TOPS queue management system) records queuing events for TOPS calls that request an operator position from the queue management system (QMS) call and agent manager (CAM). TOPSQMS also records the action taken by the QMS CAM, in response to these requests. The queuing events are counted for each call queue. The TOPSQMS reports are: 21331, 22331, 23331, 24331, and 27331. Fields required for group TOPSQMS:

PDOSRQSTD CMQUEUEGTOTPOSICXDEFLECCOVFLMA

CDOVFLNCQCNQDENIECEABANDOCREQUEU

OM group TRA125M1 TRA125M1 (Traffic Route Analysis 125 measurements 1) provides information about line use, and counts originations and terminations on selected subscriber lines or groups of lines. The TRA125M1 reports are: 21332, 22332, 23332, 24332, 27332. Fields required for group TRA125M1:

T2BU2 O2RIGT2ERMBUSY

OM group TRA125M2 TRA125M2 (Traffic Route Analysis 125 measurements 2) provides information about line use and counts originations and terminations on selected or groups of subscriber lines. The TRA125M2 reports are: 21333, 22333, 23333, 24333, 27333. Fields required for group TRA125M2:

T3BU3 O3RIGT3ERMBUSY

OM group TRA250M1 TRA250M1 (Traffic Route Analysis 250 measurements 1) provides information about line use and count originations and terminations on selected subscriber lines or groups of lines. The TRA250M1 reports are: 21334, 22334, 23334, 24334, 27334. Fields required for group TRA250M1:

T1BU1 O1RIGT1ERMBUSY

OM group TRA640M1 TRA640M1 (Traffic Route Analysis 640 measurements 1) provides information about line use and count originations and terminations on selected subscriber lines or groups of lines. The TRA640M1 reports are: 21361, 22361, 23361, 24361, 27361. Fields required for group TRA640M1:

T0BU0 O0RIGT0ERMBUSY

OM group TRK TRK (Trunk Group) provides information on trunk traffic for each trunk group. The TRK reports are: 21335, 22335, 23335, 24335, and 27335. Fields required for group TRK:

IBNCATOT PLRERTEAITNFAINBATTMPNEOVFLATGLLAROUTFAI

DUEFLDCADUREPURETURSUBMFBOUTMTCH

CMONNECTTFANDEAFOAUNTROTAHNSWEINVAUT

BULKCTRKMNAXBTSRU2WINLCTPASNGCTFAIARCCCONNOANSWE

IUNANSWEROUUTANSIUNANSASNSNTANCONGES

OM group TRMTCM TRMTCM (Customer Miscellaneous Treatment) counts calls that the system routes to a treatment. The treatment is a result of a customer action, but does not relate to authorization. The TRMTCM reports are: 21336, 22336, 23336, 24336, and 27336.

2001-8.0-RFM03-0302 Glossary 191

Fields required for group TRMTCM:

TLCMUNDT TGCMPDITTCMPSITNCMVACTNCMUNDTTCMBLDTCMOPR

TTCMTRBLTCCMANCTSCMDISTRCMATBTSCMTDBTOCMVACTCMANT

TTCMCFWVTTCMVCCTNCMATDTNCMCBTTFCMCHATRCMCHATCMOSV

TSCMNC8FTJCMNTRTBCMNCRETDCMUPATXCMCNATFCMVPFTCMN9D

TSCMN9OBTGCMN9NTCMRIN

OM group TRMTCU TRMTCU (Customer Unauthorized Treatment) counts calls that the system routes to a treatment. The treatment notifies the subscriber that the action of the subscriber is not correct for reasons of authorization. These treatments normally indicate that the subscriber dials a sequence of digits that is not correct or follows a procedure that is not correct. The TRMTCU reports are: 21337, 22337, 23337, 24337, and 27337. Fields required for group TRMTCU:

TTCUINAC TACUCNDTCCUMSCTACUMSLTICUUNCTWCUHNPTCUUNO

TNCUTDNDTSCUUNITSCUORSTRCUTESTNCUDNTTUCUNOCTCUINA

TTCUTINVTCCUCNOTTCUDCFTTCUDODTLCURSDTBCUFNATCUUMO

TKCUANIATECUNACT0CUCACT0CUD95TSCUN95TDCUILRTCUNAC

TFCUDACDTZCUADBTCUFDN

OM group TRMTCU2 TRMTCU2 (Customer Not Authorized Treatment Extension) is an extension of group TRMTCU. The OM group TRMTCU2 counts calls that the system routes to a treatment. The treatment notifies the subscriber that an action is not correct for reasons of authorization. The TRMTCU2 reports are: 21338, 22338, 23338, 24338, and 27338. Fields required for group TRMTCU2:

TACUCCNV TBCUCCNTCCULCATBCUINCTCCUANBTNCUIVCTCUSCU

TRCUINPDTBCUNPATCCUIDPTBCUCNATXCUN00TBCUCOSTCUCAC

TRCUBBFSTNCUCCITFCUUCCTVCUCCCTLCULCNTLCUCGFTCUVPF

TICUPTFLTKCUBCNTFCUJACTDCUITCTVCUAARTRCUGFNTCUERO

TOCUERTRTFCUERTTNCUESNITCUITD

OM group TRMTER TRMTER (Equipment-related Treatment Group) counts calls that the system routes to a treatment. The system routes the calls to a treatment because of a failure caused by a switching equipment failure. The TRMTER reports are: 21339, 22339, 23339, 24339, and 27339. Fields required for group TRMTER:

TOERSYFL TRERSSTTHERRODTFERPNOTNERPTOTSERNMZTERERD

TCERSTOBTCERSTOTLERINOTRERAIFTPERFDETLERCONTERSCF

TNERNONTTLERNCUTCERANFTTERMTOTPERINBTLERC7ATERDTF

TMERPERRTIERINVTAERSONTBERQ33TERQ33

OM group TRMTFR TRMTFR (Feature-Related Treatment) counts calls that the system routes to a treatment that is a normal progression of a call. The TRMTFR reports are: 21340, 22340, 23340, 24340, and 27340. Fields required for group TRMTFR:

TLFRBUSY TCRFMANTFRFORMTAFRCONTFFRRRPTFFRORATFRTRR

TFFRORACTRFRORMTCFRSRRTDFRPRSTOFRMHLTOFRPGTTFRCCT

TXFRNINTTIFRNCITFFRNCITVFRNCTTRFRCFOTTFRILRTFRSIN

TRFRIWUCTEFRFRDTPFRSORTRFRCCATAFRACPTTFRADPTFRCCD

TJFRCBDNTFFRSCRTFRICN

2001-8.0-RFM03-0302 Glossary 192

OM group TRMTRS TRMTRS (Resource Shortage Treatment) counts calls the system routes to a treatment because a shortage of software or hardware resources causes a failure. The TRMTRS reports are: 21341, 22341, 23341, 24341, and 27341. Fields required for group TRMTRS:

THRSNOSC TNRSNBLTVRSNBLTTRSCQOTGRSNCRTGRSNECTRSFEC

TDRSTOVDTTRSSORTRRSGNCTORSNOSTFRSCGRTRRSCHNTRSOTA

OM group TS TS (Time Switch) records the use of the peripheral-side (P-side) time switches. Eight usage registers for each network module record the use of a separate time switch within the network module. New network modules have data in fields TS0 through TS3. Registers TS4 through TS7 apply to offices equipped with NT0X48 networks. The TS reports are: 21342, 22342, 23342, 24342, and 27342. Fields required for group TS:

T1S0 T2ST3ST4ST5ST6ST7STS

OM group UCDGRP UCDGRP (Uniform Call Distribution) registers provide information on the use of the integrated business network (BN) feature Uniform Call Distribution (UCD). The OM group UCD permits calls in IBN systems to distribute evenly to a number of specified 500/2500 stations acting as UCD agents. The UCDGRP reports are: 21343, 22343, 23343, 24343, and 27343. Fields required for group UCDGRP:

URCDOFFR UTCDANSUNCDDFLCUSCDABNDUTCDNUKCDPRMPUCDBLOC

UCDUSAGE

OM group UTR UTR (Universal Tone Receiver) counts and records call processing requests from lines and trunks to UTRs. The registers of this OM group also record the activities in request- wait queues. The UTR reports are: 21334, 22334, 23334, 24334, and 27334. Fields required for group UTR:

ULTRSZRS UCTROVFULTRQOCUNTRQOVFUUTRQABAULTRTRUTRSAMP

UPTRRADAUPTRLDLYUTRUDLY

OM group VFGUSAGE VFGUSAGE (Virtual facility group usage) provides information on the use of virtual facility groups. The VFGUSAGE reports are: 21346, 22346, 23346, 24346, 27346. Fields required for group VFGUSAGE:

VDFGTOTAL VLFGBLCKVUFGLSCBVFGTR

OM group VSNCOM VSNCOM (Voice Services Node) measures call attempts and dispositions for voice services node (VSN)-related calls on an application base. The VSNCOM reports are: 21347, 22347, 23347, 24347, and 27347. Fields required for group VSNCOM:

VLSNATT VLSNIDFVLSNNOVVFSNIVFVBSNOPRVNSNOPRVSNVAB

VTSNVABAVTSNDABVSNVAB

OM group XASTAT XASTAT measures CPU usage and call processing on an XA-Core. It is also used to provision an XA-Core. The XASTAT reports are: 21348, 22348, 23348, 24348, 27348. Fields required for group XASTAT:

XLASUTIL XXASPUTIXDASCMPLXEASSCHEXTASFORXASMAIN

XMASDNCXMASOXGASGTERXPASBKXMASAUXCXASNET

XCASSNIPXRASPESXRASNXFXDASOVEXASOTHL

OM group XPMLNK XPMLNK (Voice Services Node) records one-way and two-way link blockage and use for all extended multiprocessor system (XMS)-based peripheral modules (XPM) with

2001-8.0-RFM03-0302 Glossary 193

switched lines. The XPMLNK reports are: 21349, 22349, 23349, 24349, and 27349. Fields required for group XPMLNK:

CUSLCBU PASLCBCASLAPKSLACKSLBLPUSLBLCSLM

PSLMU

OMATTS Register OMATTS (operator to mobile call attempts) is a register that is not in current use.

OMC Operational Measurements Control.

OMCOMPS Register OMCOMPS (operator to mobile call completions) is a register that is not in current use.

OMIDCALL A register for OM group CAINMSGS that counts the number of O_Mid_Call query messages sent by the SSP.

OMMTXSP1 Spare registers for wireless OM group OMMTX that are not in use.

OMRNP Office Multifrequency Receiver No Path Available. Scored if first try to connect an MFR fails due to path blockage in the DCO network. Not scored for successive retries.

OMROF Office Multifrequency Receiver Overflow. Scored if the first try to connect an MFR fails due to all MFRs busy. Not scored for successive retries.

OMRRQ Office Multifrequency Receiver Required. Count of calls requiring an MFR.

OMRSZ Office Multifrequency Receiver Seizure. Scored on connecting an MFR.

OMRUS Office Multifrequency Receiver Usage. Total usage of all MFRs.

OMS Operator Mark Sense. A method of marking a toll ticket so a sensing machine can interpret the data for processing the toll statements.

OMSNP Office Multifrequency Sender No Path Available. Scored if the first try to connect an MFS fails due to path blockage in the DCO network. Not scored for successive retries.

OMSOF Office Multifrequency Sender Overflow. Scored if the first try to connect an MFS fails due to all MFSs busy. Not scored for successive retries.

OMSRQ Office Multifrequency Sender Required. Count of calls requiring an MFS.

OMSSK Office Multifrequency Sender Stuck Release. MFS time out because the proceed-to- send signal was not received from the distant office within the specified time interval.

OMSSZ Office Multifrequency Sender Seizure. Scored on connecting an MFS.

OMSUS Office Multifrequency Sender Usage. Total usage of all MFSs. on-hook 1. The idle condition of a switched access or telephone exchange service line. 2. The condition existing when the receiver or handset is resting on the switch.

ONI Operator Number Identification.

2001-8.0-RFM03-0302 Glossary 194

ONIATT (Operator number identification attempts) A register for OM group ONI that counts calls the system routes to CAMA positions that use ONI and RONI (remote operator number identification).

ONICHDLU (Operator number identification calls handled use) A usage register for OM group ONI that records if CAMA positions that use ONI are assigned to calls and has a scan rate of 10 s.

ONIDELGT (Operator number identification delegation) A register for OM group ONI that counts calls that wait in the CAMA call waiting queue for enough time for a register to increase. Field MAZQ_BEFORE_OM in table CPOSTIME contains the maximum amount of time a call can wait in queue before a register increases.

ONIFDISC (Operator number identification forced disconnect) A register for OM group ONI that increases when a CAMA operator disconnects a call from the CAMA position. The system routes disconnected calls to disconnect time-out (DISC) treatment.

ONIMBU (Operator number identification manual busy use) A usage register for OM group ONI that records if CAMA positions that use ONI or RONI are manual busy or seized. The scan rate is 10 s.

ONIMTCHC (Operator number identification match check ) A register for OM group ONI that increases when a CAMA operator enters a called number in place of the calling number.

ONIOCCU (Operator number identification occupied) A usage register for OM group ONI that records if CAMA positions that use ONI or RONI are assigned to or are available to handle calls. The scan rate is 10 s.

ONIOVFL (Operator number identification overflow) A register for OM group ONI that counts when a call attempts to enter the CAMA call waiting queue when CAMA position is not available.

ONIQABAN (Operator number identification queue abandon) A register for OM group ONI that counts calls abandoned in the CAMA call waiting queue.

ONIQOCC (Operator number identification queue occupied) A usage register for OM group ONI that records if calls waiting for assignment to CAMA positions use ONI or RONI. The scan rate is 10 s.

ONIQOVFL (Operator number identification queue overflow) A register for OM group ONI that counts CAMA calls that route to no service circuit (NOSC) treatment (when the CAMA call waiting queue maximum length exceeds the limit). Field DEFLECT in table CAMACSW contains the maximum CAMA call waiting queue length.

ONIQTOUT (Operator number identification queue timed out) A register for OM group ONI that counts calls that wait in the CAMA. The system routes calls to a NOSC treatment after a specified time. Field MAXQ_BEFORE_TRTMT in table CPOSTIME contains the time- out period.

ONISBU (Operator number identification system busy) A usage register for OM group ONI that records if CAMA positions that use ONI or RONI are system busy or peripheral module busy. The scan rate is 10 s.

ONISZRS (Operator number identification seizures) A register for OM group ONI that counts calls that connect to a CAMA position. The operator at the position acknowledges the calls.

2001-8.0-RFM03-0302 Glossary 195

ONIWRGCA (Operator number identification wrong code added) A register for OM group ONI that increases when the system rejects the entry that the CAMA operator makes. The CAMA operator can enter NXX codes, trouble codes, or digits. The DMS-100 system rejects the following:

- NXX codes that are not correct - trouble codes that are not correct - digits that the system does not recognize (the system will begin automatic testing procedures) on-line Pertaining to equipment, devices and persons who are in direct communication with the central processing unit of a computer.

ONUP Print On Updating.

OO Operator Offices: A two-way trunk group between community dial tributary offices and their operator offices which are used to complete outward and inward toll traffic. They generally constitute the sole means the CDO customer has of reaching an operator for any kind of assistance or emergency calls. (Outward traffic is operator handled, inward traffic can be machine and/or operator handled.) operands The items on which a mathematical operation is performed. For example, in the expression 2+3, the plus sign is the operator, and 2 and 3 are the operands. operating system Software that controls the management and execution of computer programs. It may also provide scheduling, debugging, input/output control, accounting, compila- tion, storage assignment, data management, and related services. operator 1. A person who operates a telephone switchboard. 2. A person who operates a computer.

OPH Operator Handled.

OPM Operational Measurements (DMS-10).

OPM001 Traffic (DMS-10).

OPM002 Originating Service (DMS-10).

OPM003 Incoming Service (DMS-10).

OPM004 Trunk Groups (DMS-10).

OPM005 Service Circuits (DMS-10).

OPM006 Network Loop (DMS-10).

OPM007 Study Registers (DMS-10).

OPM008 Maintenance (DMS-10).

OPM009 Centralized Automatic Message Accounting (CAMA)(DMS-10).

OPM010 Hunt Groups (DMS-10).

OPM011 Custom Calling Features (DMS-10).

2001-8.0-RFM03-0302 Glossary 196

opr Operator.

OPREQ The number of calls during which an operator was requested after a DTMF billing acceptance request was entered. This count is pegged only if Billing_Acceptance_Validation is set to DTMF.

OPRO Operator Routed.

optical disk A high-density storage device that uses lasers to create patterns to represent the information.

ORGABDN (Originating, Abandoned) A register for OM group OTS that counts originating call attempts that the subscriber abandons before they route to a terminating line, outgoing trunk, tone, announcement, lockout status, or feature activation or deacti- vation. If the line is on a line module, the system counts the flash of the switch hook that occurs when the caller dials.

ORGFSET (Originating to custom calling feature) A register for OM group OTS that counts originating call attempts that activate or deactivate a custom calling feature.

ORGLKT (Originating to lockout) A register for OM group OTS that counts originating call attempts that fail, route to lockout without connecting or going to treatment.

ORGOUT (Originating to outgoing connections) A register for OM group OTS that counts originating call attempts that connect to an outgoing trunk.

ORGTRM (Originating to terminating connections) A register for OM group OTS that counts originating call attempts that connect to terminating traffic and connection to busy tone terminations.

ORGTRMT (Originating to treatment connections) A register for OM group OTS that counts originating call attempts that connect to a tone or an announcement because of an error condition. It also counts tones that are applied to indicate error conditions and are not determined to be a DMS treatment (for example, a three-way call activation error resulting in an error tone to a line).

Orig Originated.

ORIG0 A register for OM group TRA640M1 that increases when a subscriber with the SLU option attempts to originate a call and a dial tone connects. If the switch can identify which party of two- and four-party lines made the call attempt, the register increases once. If the switch cannot identify which party of two- and four-party lines made the call attempt, the register counts each directory number on the line.

ORIG1 A register for OM group TRA250M1 that increases when a subscriber with the SLU option attempts to originate a call and a dial tone connects. If the switch can identify which party of two- and four-party lines made the call attempt, the register increases once. If the switch cannot identify which party of two- and four-party lines made the call attempt, the register counts each directory number on the line.

ORIG2 A register for OM group TRA125M1 that increases when a subscriber with the SLU option attempts to originate a call and a dial tone connects. If the switch can identify which party of two- and four-party lines made the call attempt, the register increases once. If the switch cannot identify which party of two- and four-party lines made the call attempt, the register counts each directory number on the line.

2001-8.0-RFM03-0302 Glossary 197

ORIG3 A register for OM group TRA125M2 that increases when a subscriber with the SLU option attempts to originate a call and a dial tone connects. If the switch can identify which party of two- and four-party lines made the call attempt, the register increases once. If the switch cannot identify which party of two- and four-party lines made the call attempt, the register counts each directory number on the line.

ORIGANN The number of calls originating from lines which are initially routed to an announce- ment.

ORIGABN (Originating Abandons Before Connection) A register for OM group LMD that counts originating call attempts that the subscriber abandons before call set up completes. Large counts in this register indicate line or PM problems.

ORIGABDN (Originating Calls Abandoned) A register for OM group OFZ that counts originating calls that the system abandons before the system routes the calls to a trunk, line, or treatment.

ORIGANN (Originating Call to Announcement) A register for OM group OFZ that counts originating calls system routed to an announcement. This can be the result of a treatment during inpulsing, or the intended result of the call. The call is counted in ORIGANN before a network connection is attempted.

ORIGATT (Origination_Attempt Message) A register for OM group CAINMSGS that counts the number of Origination_Attempt messages sent to the SCP.

ORIGBLK (Originating Failures) A register for OM group LMD that counts originating call attempts that fail. The attempts fail because the idle speech path from the original LM to the network module is not present. The PM originates the call for as long as the caller stays off-hook. A high count in this register could indicate a fault condi- tion. Any RLM links that are manual busy or system busy are examples of a fault condition. Lower counts indicated a need to supply more links or reduce load.

ORIGCALL (Originated calls) A register for OM group IBNSG that counts calls that an attendant in a customer subgroup originates. This register increases when an attendant presses an idle loop key and starts to dial.

ORIGDENY (Origination Denial) A register for OM group CP that counts originations that are ignored by the CC because they were not services within 3 seconds of arrival.

ORIGDR (Originated duration) A usage register (10 s scan rate) for OM group IBNSG that counts when a call that an attendant originates is in the talking state.

ORIGFAIL (Origination Attempt Failures) A register for OM group LMD that counts originating call attempts that fail for one of the following reasons: - the system does not send enough digits before a timeout occurs (partial dial) - the system sends no digits before a timeout occurs (permanent signal) - additional pulses or bad tones are sent - the system generates two Digitone (DT) frequencies that have more than a 6 dB spread between both of the frequencies - the system receives a message type that was not planned from a PM during automatic number identification tests on recordable calls. A test failure is an example of a message type that was not planned.

The register does not increase in GL04 for the following reasons: - The system receives two Digitone (DT) frequencies that have more than a 6 dB spread between the frequencies.

2001-8.0-RFM03-0302 Glossary 198

- The system receives a message type that is not planned from a PM during automatic number identification test on recordable calls.

originate/answer Pertaining to a modem that can both originate and answer messages.

originating call A call initiated by a subscriber line in the office being considered.

originating direction The use of access service for the origination of calls from an end user premises to a customer premises.

originating office The switching center which serves the telephone station originating the call.

originating traffic Traffic generated by sources located within the network under consideration regard- less of the final destination.

ORIGLKT (Originating Call to lock-out) A register for OM group OFZ that counts originating calls that fail on the intended destination that the system routes to lock out. The register counts these calls when the calls do not connect. This register also counts the calls when the system doesn’t route the call to a treatment. The calls fail because the line is dead, a speech link isn’t available, or a digitone receiver (or a network connection to a DT receiver) isn’t available.

ORIGOUT (Originating Call to Tone) A register for OM group OFZ that counts originating calls system routed to a trunk or a test facility.

ORIGTONE (Originating Call to Tone) A register for OM group OFZ that counts originating calls system routed to a tone.

ORIGTRM (Originating to Terminating) A register for OM group OFZ that counts originating calls that the system routes to a line. It counts the call if a line is or isn’t available.

ORNC Originating Noncompleting.

ORNC ADJ Originating Noncompleting Adjustment.

OROG Originating Outgoing. (Outgoing trunks).

OROG BLK Originating Outgoing Blocked.

ORTM Originating Terminating. Ringing and conversation or busy tone usage on calls to valid directory numbers. Usage starts when ringing or busy tone begins and ends when the call disconnects. This register includes total office IAO usage for all line-to- line traffic including PBX and centrex CU trunks if terminated on a line appearing at either a host or remote location.

ORTM BLK Originating Terminating Blocked.

ORVEC Office Revertive Effective Call. Scored on ringing called line. Revertive calls only.

OS See Operating System.

OSI Open Systems Interconnection.

OSLEN Office Subscriber Line Transfer Enabled. Number of times that customers, with fixed call forwarding service, transfer their calls. Scored on receipt of the activate transfer code.

2001-8.0-RFM03-0302 Glossary 199

OSLEX Office Subscriber Line Transfer Executed. Number of calls forwarded (using the fixed call forwarding feature).

OSP Outside Plant.

OSVC Originating Service.

OS1AT Office Single Digit Speed Call Attempt. Number of single digit speed calls. Scored on recognition of valid abbreviated dialing code.

OS2AT Office Two Digit Speed Call Attempt. Number of two digit speed calls. Scored on recognition of valid abbreviated dialing code.

OT Outward Toll.

OTC Originating Toll Center.

OTDNP Office Tone-Dial Receiver No Path Available. Scored if first try to connect a tone-dial receiver fails due to path blockage in the digital central office network. Not scored for successive retries.

OTDOF Office Tone-Dial Receiver Overflow. Scored if the first try to connect a tone-dial receiver fails due to all tone-dial receivers busy. Not scored for successive retries.

OTDRQ Office Tone-Dial Receiver Required. Count of calls requiring a tone-dial receiver.

OTDSZ Office Tone-Dial Receiver Seizure. Scored on connecting a tone-dial receiver.

OTDUS Office Tone-Dial Receiver Usage. Total usage of all tone-dial receivers.

OTERMSZ (O_Term_Seized Message) A register for OM group CAINMSGS that counts the number of O_Term_Seized messages sent by the SSP.

OTHABDN (Other Abandon) A register for OM group ISDD that increases when an XPM detects an on-hook condition on an incoming OTH trunk. The XPM detects the on-hook condition before the XPM returns a start-to-dial signal. The system abandons the call.

OTHAMPT (Other Attempt) A register for OM group ISDD that increases when the XPM attempts a SEIZ of an incoming OTH trunk of an XPM for further processing. OTH trunks include all trunk types except DP, DT, MF, ISDN, CCS7, nailed up, FX, and mainte- nance trunks.

OTHSEIZ (Other Seizure) A register for OM group ISDD that increases when the system seizes an OTHtrunk of an XPM for an incoming call. All trunk types except DP, DT, MF, ISDN, CCS7, nailed up, FX, and maintenance trunks. The system detects a SEIZ when an XPM detects an off-hook condition. The off-hook condition lasts 6 to 9 ms on an idle incoming trunk.

OTHTDLY (Other Trunk Delay) A register for OM group ISDD that increases when one of the following intervals exceeds a preset TDLY threshold:the interval between the SEIZ of an incoming OTH call and the return of a start-to-dial signal; the interval between call SEIZ and call ABDN, exceeds a preset TDLY threshold (default TDLY threshold is 3 s).

OTIAB Office Trunk Incoming Abandoned Before Dialing. Incoming trunk releases after connection to digit receiver and no digits received.

OTIAD Office Trunk Incoming Abandoned Before Dial Tone. Incoming trunk releases before

2001-8.0-RFM03-0302 Glossary 200

dial tone is returned.

OTIAP Office Trunk Incoming Abandoned Partial Dial. Incoming trunk that releases with one or more digits dialed.

OTICR Office Trunk Incoming Custom Route. Count of all incoming trunk calls that termi- nate to custom route treatments, such as verification.

OTIPG Office Trunk Incoming Purged. Count of the number of times trunk purge is initial- ized. This occurs when recognition of an invalid event during the processing of an incoming trunk call results in the call being automatically purged from the system (i.e., free matrix path and restore trunk to idle state).

OTIRD Office Trunk Incoming Requiring Dial Tone. Incoming trunk class of service indicates the need to return dial tone.

OTISZ Office Trunk Incoming Seizure. A call originating from a trunk. The call may ulti- mately be destined for a line or trunk. Count made on detecting trunk incoming seizure.

OTITB Office Trunk Incoming Timeout Before Dialing. Incoming trunk has timed out after connection to a digit receiver and no digits received.

OTITP Office Trunk Incoming Timeout Partial Dial. Digit receiver timed out with one or more digits received from trunk.

OTLEC Office Trunk-to-Line Effective Call. Scored on ringing called line.

OTLNP Office Trunk-to-Line No Path Available. (See OLLNP).

OTOAT Office Trunk Outgoing Attempt. A call that the system is attempting to terminate to a trunk. The call may have originated from a line or trunk. Count made after code translation.

OTOOF Office Trunk Outgoing Overflow. Scored if outgoing call fails to find a free trunk in trunk group used for primary route.

OTTEC Office Trunk-to-Trunk Effective Call. (See OLTEC).

OTTNP Office Trunk-to-Trunk No Path Available. (See OLTNP).

OUTANSU (Answer message received and sent usage on an outgoing trunk) A usage register (100 s scan rate) for OM group TRK that counts the number of answered calls on outgoing trunk calls. This register measures traffic in the answered state for each outgoing or two-way trunk. The register measures the occupancy in Erlangs.

OUTBOVFL (Outgoing Buffer Overflow) A register for OM group CP that counts outgoing messages that are lost because no idle outgoing buffer was available.

OUTBSZ (Outgoing Buffer Seizures) A register for OM group CP that counts messages going to peripheral modules that are placed in an outgoing buffer because the CMC through which they are routed is busy.

OUTFAIL (Outgoing failures) A register for OM group TRK that counts attempts to seize an outgoing trunk in the trunk group that fail because of following: - signaling problems - loss of accuracy

2001-8.0-RFM03-0302 Glossary 201

- outgoing failures - seizure failures The system releases the trunk. The system performs a maximum of two attempts to seize a trunk. The system counts each failed attempt in OUTFAIL. If a second attempt to seize a trunk fails, the system routes the call to treatment. The system can generate a log message. Generation of a log message depends on the cause of the failure. The system generates register OUTFAIL for office types that are correct. outgoing call A call routed to another office. Trunks serving this type traffic are known as outgo- ing trunks.

Outgoing EAS Overflow Outgoing Extended Area Service Overflow.

OUTNMTCHF (Outgoing matching failure) A register for OM group TRK that counts attempts to find a path from an incoming trunk or originating line to a selected trunk that fail. Failure occurs as a result of network blockage. If the system blocks an outgoing call, the call again attempts to select a trunk. If the system blocks this attempt, OUTMTCHF counts the call again. The system routes the call to NBLH treatment. The system generates this register for office types that are correct.

OUTNWAT (Outgoing Network Attempts) A register for OM group OFZ that counts incoming and originating calls that are intended for an exact outgoing or test trunk. A single call can use two or more network paths to different ports of the service circuit. for example, connection by a conference circuit or digital echo suppressor requires more than one network path. output Information generated by the computer as a result of its calculations. Computer output may be either printed on paper, displayed on a terminal, punched on cards, or stored on magnetic tapes or disks.

OUTWATS Outgoing Wide Area Telephone Service.

OV16DSC (SAPI 16 frames discarded) A register for OM group ISGOVLD that counts the services access point identifier 16 (SAPI 16) frames the system discards caused by overload controls.

OV16DSC2 An extension register of OV16DSC. overall balance index (OBI) A unit of measurement used to express the effect of dial tone delay or incoming matching loss results when compared to the degree of imbalance within a loading division. overflow 1. Describes the amount of traffic which is lost when the traffic load exceeds the capacity of regular equipment. 2. The number of call attempts that were unable to secure a switching path because all switching paths within an equipment or trunk group were busy. 3. In an arithmetic operation, the generation of a quantity beyond the capacity of the register or storage location that is to receive the result. overflow traffic Traffic which must be directed to additional resources because the original resources are unable to handle it.

OVERSEAC The number of overseas calls for which the collect service was selected or restricted to. This number is incremented for the relevant key each time 11 is selected for an overseas call or if a call is restricted to collect and is an overseas or a prison call.

OVFL Overflow All Resources Busy. A count of the number of times a request for a particular resource is denied due to an all-items-busy condition.

2001-8.0-RFM03-0302 Glossary 202

OVLDTIME (Period of time in overload) A register for OM group ISGOVLD that counts the seconds an ISG is in an overloaded state.

OVLMAX Call Overflowed, MAXSIZE Exceeded. OVLMAX is incremented each time a call is deflected from the call queue because no agent is immediately available, and the number of calls in the queue exceeds the maximum value for the application’s queue in table QMSCQDEF. CALLARIV = IMEDQAG + IMEDTAG + IMEDPAG + CALLQD + CALLDEFL + OVLMAX + OVLNOCQE

OVLNOCQE Call Queue Elements Overflowed. OVLNOCQE is incremented each time an applica- tion presents a call to the CAM and the call is deflected because no agent is immedi- ately available to serve the call, and the call queuing elements are exhausted for the entire application. CALLARIV = IMEDQAG + IMEDTAG + IMEDPAG + CALLQD + CALLDEFL + OVLMAX + OVLNOCQE

OWE Other Working Equipment.

OXCNP Office Transceiver NPA.

OXCOF Office Transceiver Overflow.

OXCSZ Office Transceiver Seizure.

OXCUS Office Transceiver Usage.

O3WAT Office Three-Way Call Attempt. Number of times that customers, with three-way calling service, attempt to add on a third party.

APABN Partial Dial Abandon.

PABX Private Automatic Branch Exchange.

pack To store data in a compressed form in such a way that the original form of the data can be recovered.

packet A group of consecutive characters sent from one computer to another over a net- work.

packet radio The transmission of data (in packets) by radio. It is a fast-growing hobby among radio amateurs (“hams”) and also has commercial applications as a way of linking computers without wires. Commercial packet systems involve portable computer terminals carried by delivery or service personnel. The terminals are linked by radio to a main computer many miles away.

PAD Packet Assembler/Dissembler.

PAGEREQ A register for wireless OM group ICPCP that pegs when an intelligent cellular periph- eral (ICP) sends a page request message to the control channels (CCHs).

PAGERESP A register for wireless OM group ICPCP that pegs when an ICP receives a page response message from the CCHs.

pagination The process of numbering pages.

palette A set of colors chosen from a much larger set. For instance, the IBM VGA can display

2001-8.0-RFM03-0302 Glossary 203

more than 250,000 different colors, but the programmer or user must choose a palette of no more than 256 to use at a time.

parallel A type of interface in which all bits of data in a given byte are transferred simulta- neously, using a separate data line for each bit. In connecting a printer to a micro- computer, it is important to know whether the printer requires parallel or serial (RS- 232) data.

parallel processing What a computer does when it carries out more than one computation at the same time on different CPUs.

parameter 1. A parameter in a procedure is a symbol that will be replaced by a supplied value when the procedure is called. The use of parameters allows you to make your instructions much more general. 2. The settings selected by a computer user, and/ or included in a program, used as established values or defaults in program instruc- tions or functions. parity Pertaining to the use of a self-checking code employing binary digits in which the total number of 1’s (or 0’s) in each permissible code expression is always odd or even. Often, when groups of bits (1’s and 0’s) are being transmitted or stored, an extra bit is added so that the total number of 1’s is always odd (or, alternatively, always even). This is called the parity of the data. parity checking A method of data transmission error checking in which the transmitting computer adds a bit to each character transmitted. If the received total is incorrect, an auto- matic request is made for retransmission. park To park the head of a hard disk drive means to disengage it so that the disk will be protected from possible damage if the computer is moved.

PARMCHRG (Parameter Change Registration) A register for wireless OM group OMMTX3 that counts when the mobile registration type is parameter change registration.

PARTAUTO 1. The number of calls which required operator assistance after the caller successfully selected a service using the automated service selection. This number is incremented for the relevant key under the following conditions: a) the caller wants to make an overseas collect call b) the database query indicates the call should be handled by an operator c) the caller dialed zero (0) during the name recording after a retry count is exceeded d) the call is routed to an operator as a result of an office parameter e) the call is routed to the operator during billing acceptance f) overseas prison calls g) the caller hook flashes to request the operator during the front-end or back-end language selection, only after service has been selected h) the call is routed to an operator because the caller exceeds the retry counts at front-end or back-end language selection, only after service has been selected i) the call is routed to an operator because the caller dialed 0 during front-end or back-end language selection, only after service has been selected Collect third party calls handed off from the operator to the VSN for call completion will be counted under Partauto if any of the above conditions apply. 2. NAMEOP + RTYEXDOP + YESVFOP + NOVFOP + calls transferred to operator because of table parameters or database response after service selection + calls transferred to operator because retry count is exceeded in back-end language selec- tion or front-end language selection, Name Recording + calls transferred to operator because of 0 in response to back-end or front-end language selection only after services selection + calls transferred to operator because of hook flash in response to back-end or front-end language selection only after service selection.

2001-8.0-RFM03-0302 Glossary 204

party line A line on which more than one subscriber receives service.

pass 1. Single execution of a loop. 2. A complete input, processing, and output cycle in the execution of a computer program.

pass band A contiguous portion of an area in the frequency spectrum that permits a predefined range of frequencies to pass.

password A secret character string that is required to log onto a computer system, thus preventing unauthorized persons from obtaining access to the computer. Each user is assigned a specified set of alphanumeric characters to gain entrance to the entire computer system or to parts of the system. See access code.

patch cord A flexible electrical cord having one or more conductors terminated on each end on a plug, used for making temporary connections between circuits terminated on jacks.

patch panel (C lead) A panel arranged so that the “sleeve” or “control lead” of various circuits may be grouped for traffic analysis.

path Specifies how to find a particular file on a disk that has more than one directory.

PBX Private Branch Exchange.

PC 1. Peg Count. 2. Personal Computer.

P-CB Person Callback Message.

PCHK Parity Check.

PCI Peg Count In.

PCKT Peripheral Circuit.

PCM 1. Peg Count Monitor. A solid state electronic traffic measuring device produced by Digital Products. The PCM receives count information from a number of inputs, and at preset intervals, spills this information serially to an output device such as a paper tape punch or a magnetic tape recorder. 2. Pulse Code Modulation.

PCNT See Peg Count.

PCO Peg Count Out.

PDIL Partial Dial Timeout.

PDIS CAMA Position Disconnects.

PDTO Partial Dial Time Out.

PDLM Register PDLM (machine dialed partial dials) counts the machine-dialed calls that the system routes to partial dial treatment.

peakedness A measure of the non-randomness of offered traffic within an hour. Statistically, it is the ratio of the variance to the mean of the offered traffic within the hour.

PED Peripheral Equipment Diagnostic.

2001-8.0-RFM03-0302 Glossary 205

PEG Peg Count. peg count A count of the seizure, or attempts at seizure, of telephone trunks, circuits, or switching equipment or of calls handled by an operator during a specified time interval. peg count concentrator A method of totaling the peg count from a number of sources into one source, such as providing one common output from two or more connector groups.

PEQP Peripheral Equipment.

PERCLF (Terminating Call Attempt Failures) A register for OM group LMD that counts calls that cannot terminated on a line because of problems in ringing the terminating line. A ringing failure on an emergency service line does not cause the call to fail and does not increase PERCLFL. The system attempts ringing until the system is successful. perfs Perforations in paper to facilitate removing pin-feed edges and tearing continuous paper into separate pages. peripheral Any hardware device that connects to a computer (printer, monitor, drive, etc.). perm See permanent. permanent Condition of a subscriber’s line which is shorted or grounded or has the handset off the hook switch. Common control offices consider a line to be permanent if no digits are received within 30 seconds of the off-hook signal. permanent signal Permanent line seizure.

PERM SIGNAL When the phone is off-hook.

PESH Peripheral Loop.

PG Purged.

PGHASH (Paging Hash) A register for wireless OM group ICPCP that pegs when a paging data block hashing algorithm fails to choose the paging data block equal to the least significant byte of the MIN on the first try.

PGHASHTO (Paging Hash Total) A register for wireless OM group ICPCP that pegs when a collision occurs for paging data block hashing algorithms.

PGREQS (Page Requests) A dual mode register for wireless OM group OMMTX that pegs when a page request message is sent to a target subcell. This register is pegged against every cell site that receives this page request message.

PGRESPS (Page Responses) A dual mode register for wireless OM group OMMTX that pegs when a page response message is received from a target subcell. This register is pegged against the cell site that responds to this page request message. phase hit A sudden, uncontrolled change in the phase of a received signal. phase jitter The unwanted change in phase or frequency of a signal. philoxenic Friendly to uninformed users; user friendly. phosphor A rare earth material used to coat the inside face of cathode-ray tubes (CRTs).

2001-8.0-RFM03-0302 Glossary 206

physical record The unit of data for input or output, such as a record on a disk.

pica A type size that fits ten characters into each inch of type.

pico Prefix meaning one trillionth. One picosecond is one trillionth of a second.

pin The pins in a dot-matrix printer press on the ribbon to make dots on the paper. A 9- pin printer produces readable but inelegant type. Printers with 24 pins produce very sharp letter quality text.

piracy The unauthorized copying of software, which is forbidden by law.

pitch 1. The density of a character on a printed line. 2. The pitch of a printer is the number of characters per inch (most commonly 10).

pixel Short for “picture element.” The visual display screen is divided into rows and columns of tiny dots, squares, or cells, each of which is a pixel. The resolution (sharpness) of a picture is expressed by the number of pixels in the display.

PL Private Line.

platen The roller in a typewriter or printer against which the keys strike.

plotter A device that draws pictures on paper by moving pens according to directions from a computer.

PM 1. Pulse or Phase Modulation. 2. Port Termination. 3. Peripheral Module.

PM1ERR (PM single-unit errors) A register for OM group PM1 that counts system-detected errors that an in-service PM reports. The PM1 increases when one of the following events occurs: a PM sends an unsolicited message that indicates a correct fault condition, or system-requested diagnostics remove the PM from service.

PM1FLT (PM single-unit fault) A register for OM group PM1 that increases when the system removes a PM from service because of a continuing fault that system-initiated diagnostics detect. Register PM1FLT counts the faults for all PM cards except P-side and C-side interface cards. The register counts each fault one time.

PM1INITS (PM single-unit initializations) The system does not support PM1INITS. The value is always zero.

PM1LOAD (PM single-unit reload required) The system does not support PM1LOAD. The value is always zero.

PM1MBU (PM single-unit manual-busy usage) A usage register (10 s scan rate) for OM group PM1 that records manual-busy PMs.

PM1PSERR (PM single-unit P-side errors) Register PM1PSERR is inactive.

PM1PSFLT (PM single-unit P-side faults) Register PM1PSFLT is inactive.

PM1PSMBU (PM single-unit P-side manual-busy usage) Register PM1PSMBU is inactive.

PM1PSSBU (PM single-unit P-side system-busy usage) Register PM1PSSBU is inactive.

PM1SBU (PM single-unit system-busy usage) A usage register (10 s scan rate) for OM group

2001-8.0-RFM03-0302 Glossary 207

PM1 that records system-busy PMs.

PM2CCTER (Peripheral module dual-unit circuit error) A register for OM group PM2 that increases when an error appears in a PM terminal (line card).

PM2CCTFL (Peripheral module dual-unit circuit fault) A register for OM group PM2 that increases when a fault appears in a PM terminal (line card).

PM2CCTMB (Peripheral module dual-unit circuit manual busy) A register for OM group PM2 that increases when a PMterminal (line card) becomes manual busy.

PM2CCTSB (Peripheral module dual-unit circuit system busy) A register for OM group PM2 that increases when a PM terminal (line card) becomes system busy.

PM2CXFR (Peripheral module dual-unit control transfer) A register for OM group PM2 that increases when a PMunit changes activity from active to inactive for any reason. The mate unit takes control of the lines for the complete PM.

PM2ECXFR (Peripheral module dual-unit emergency control transfer) A register for OM group PM2 that increases when a PM unit changes activity from active to inactive because of a fault or a manual uncontrolled transfer. The mate unit takes control of the lines for the complete PM.

PM2ERR (Peripheral module dual-unit errors) A register for OM group PM2 that increases when an error occurs in either unit of an in-service PM. The error can cause addi- tional maintenance action for the register to increase. Register PM2ERR counts the following events: errors that only result in the generation of a log, errors that result in additional maintenance action, accuracy failures for PMs (except the line concentrat- ing module), errors resulting in who-am-I (WAI) messages, state changes from in- service to central-side (C-side) busy or in-service to system busy, restart reports from the central control, or any event that causes a fault and increments PM2FLT.

PM2FLT (Peripheral module dual-unit faults) A register for OM group PM2 that increases when a fault in either unit of an in-service PM makes the unit or the PM system busy. Register PM2FLT increases when: a PM or PM unit becomes system busy, or a central-side (C-side) node or link becomes manual busy and returns to service. The result is a change from C-side busy to system busy.

PM2INITS (Peripheral module dual-unit initializations) A register for OM group PM2 that increases when an in-service PM unit resets without a warning.

PM2LOAD (Peripheral module dual-unit load) A register for OM group PM2 that increases when an in-service PM unit requires a reload that the central control did not request.

PM2MBTCO (Peripheral module dual-unit manual-busy terminals cut off) A register for OM group PM2 that counts the subscriber calls (terminals) cut off when a PM becomes manual busy. The register only counts subscriber calls that associate with a line or trunk that is call-processing-busy or call-processing-deloading. Register PM2MBTCO increases one time for two-port calls.

PM2MCXFR (Peripheral module dual-unit manual cold transfers) A register for OM group PM2 that counts when a manual request causes an extended multiprocessor system (XMS)-based peripheral module (XPM) to perform a cold switch of activity (SWACT). This action results from either of the following events: execution of the SWACT command at the MAP terminal or the active unit becomes manual busy when the inactive unit is in service.

2001-8.0-RFM03-0302 Glossary 208

PM2MMBU (Peripheral module dual-unit module manual-busy use) A usage register (10s scan rate) for OM group PM2 that records manual-busy PMs. Register PM2UMBU can detect a PM that is manually- busy, because of the sampling rate.

PM2MSBU (Peripheral module dual-unit module system-busy usage) A usage register (10s scan rate) for OM group PM2 that records when both units of the PM are system busy. It also records when one unit is system busy while the mate unit is out of service. Register PM2UMBU can detect a PM that is system busy, because of the sampling rate.

PM2MWXFR (Peripheral module dual-unit manual warm transfers) A register for OM group PM2 that increases when manual interruption causes either an XPM to perform a warm SWACT, or an LCM to perform a takeover. The following manual activities cause an XPM to perform a warm SWACT: execution of the SWACT command, the active unit becomes manual busy while the mate is in service, or if one unit of an LCM be- comes manual busy while the mate is in service, a takeover occurs. Register PM2MWXFR does not increase if an LCM takeback of activity occurs.

PM2PSERR (Peripheral module dual-unit peripheral-side errors) A register for OM group PM2 that counts errors detected on the P-side interface of a PM. Register PM2PSERR increases when one of the following errors occurs: errors that originate in interface cards that terminate P-side lines, trunks, or links, or P-side line, trunk, or link errors.

PM2PSFLT (Peripheral module dual-unit peripheral-side faults) A register for OM group PM2 that counts errors detected on the P-side interface of a PM. It increases when one of the following faults occur: faults that originate in P-side interface cards that termi- nate lines, trunks, or links, OR P-side line, trunk, or link faults.

PM2RGERR (Peripheral module dual-unit ringing generator errors) A register for OM group PM2 that counts errors that the system detects in ringing generators. Ringing generators supply ringing and automatic number identification (ANI) coin functions to an in- service PM. The state of the ringing generator is not important. A single ringing generator can service two line concentrating modules (LCM) in the same frame. Register PM2RGERR counts one ringing generator error four times if the operator services two modules. The register counts one time for each of the two line concen- trating arrays in each LCM.

PM2RGFLT (Peripheral module dual-unit ringing generator fault) A register for OM group PM2 that counts faults in ringing generators that supply ringing and ANI coin functions to a PM. Register PM2RGFLT only counts faults in in-service ringing generators.

PM2SBTCO (Peripheral module dual-unit system-busy terminals cut off) A register for OM group PM2 that counts subscriber calls (terminals) cut off when a PM becomes system busy. The register counts subscriber calls that associate with a line or trunk that is call processing busy or call processing deloading. Register PM2MBTCO increases one time for two-port calls.

PM2SCXFR (Peripheral module dual-unit system cold transfers) A register for OM group PM2 that counts when a system request causes an XPM to perform a cold SWACT through any of the following activities: the system requests a SWACT, the active unit becomes system busy when the inactive unit is in service, or central-side (C-side) links to the active unit close while the inactive unit is in service

PM2SWXFR (Peripheral module dual-unit system warm transfer) A register for OM group PM2 that increases when system maintenance causes an XPM to perform a warm SWACT or an LCM to perform a takeover. The system causes a warm SWACT in an XPMby one of the following actions: the system requests a warm SWACT, the active unit

2001-8.0-RFM03-0302 Glossary 209

becomes system busy, central side (C-side) links to the active unit close while the inactive unit is in service. The system causes a takeover of a unit in an LCM in two ways. One unit becomes system busy while the mate is in service. A unit can become busy while C-side links to one unit close while the mate is in service. Register PM2SWXFR does not increase if an LCM takeback of activity occurs.

PM2UMBU (Peripheral module dual-unit manual-busy usage) A usage register (10 s scan rate) for OM group PM2 that records manual-busy PM units. Register PM2UMBU increases twice if both units of a PM are manual busy. Register PM2UMBU can detect a unit that is manual busy, because of the sampling rate.

PM2USBU (Peripheral module dual-unit system-busy usage) A usage register (10s scan rate) for OM group PM2 that increases records system-busy PM units. Problems that make a PM unit system busy include: test failure, too many unsolicited messages, and auto unit resets. Register PM2USBU increases twice if both units of a PM are system busy. Register PM2USBU can detect a unit that is system busy because of the sampling rate.

PMCCTDG (PM circuit diagnostics run) A register for OM group PM that increases counts system-initiated diagnostic tests of a line card or trunk card. The tests examine problems that repeat during call processing. The maintenance conditions that cause an increase are different for each PM type. For the digital carrier module, this register counts the tests of any trunk interface card. The tests look for removal of a DS-1 interface card. The tests also look for a frame loss that causes a local or remote- carrier-group alarm state. For the line module or the digital line module, it counts system-initiated tests of a line card. For the trunk module (TM), it counts tests of any trunk interface card or service circuit. The TM tests include: check that cards of the right type are present on the shelf, operation of the test relay, operation and release of signal distribution points and analysis of scan results, or checks of transmission loss in looparound mode For the extended multiprocessor system (XMS)-based peripheral modules (XPM), PMCCTDG increases when a system-initiated test runs on a line or trunk. The test runs because of repeated problems during call processing.

PMCCFTL (PM circuit tests failed) A register for OM group PM that increases when a system- initiated test finds a PM maintenance problem caused by a fault condition. The faults that increase the register differ for each type of PM. For the digital carrier module, PMCCTFL increases when tests reveal a fault caused by the removal of a card. A fault can also be caused by a transmission error that results in a carrier group alarm. For the line module, PMCCTFL increases when tests reveal a maintenance problem caused by one of the following: a PM, card, or facility fault, or a missing or wrong card. For the trunk module, the digital carrier module, and XPM, PMCCTFL increases when tests detect a wrong card, or a missing or card that has faults.

PMCCTOP (PM circuit test outside plant) A register for OM group PM that increases when system tests detect a fault on a line or trunk circuit located outside the switching office. The conditions that increase PMCCTOP vary with the different PM types. Register PMCCTOP increases the first time the fault appears, with all PM types. The register does not increase if the fault appears after new tests. For the digital carrier module and the trunk module, PMCCTOP increases under the following condition. The signaling-test system at a switching office detects a fault on a trunk circuit. This trunk circuit is between the circuit and a far-end office. For example, PMCCTOP increases when an originating office does not receive a start-dial or wink signal. The far-end office sends these signals to the originating office in response to an off-hook signal. For the line module, PMCCTOP increases when system tests detect a fault on a line circuit located outside the switching office. For extended multiprocessor system (XMS)-based peripheral modules (XPM), PMCCTOP is incremented when system tests detect a fault on a line or trunk that is located outside the switching office.

2001-8.0-RFM03-0302 Glossary 210

PMDRERR (PPM drawer error) A register for OM group PM that counts errors in a line drawer that cause the drawer to have in-service trouble.

PMDRFLT (PM drawer faults) A register for OM group PM that counts faults in a line drawer that cause the drawer to become system busy.

PMDRMBU (PM drawer manual busy use) A usage register for OM group PM that, every 100 seconds, scans the line drawers in a PM and PMDRMBU records manual busy line drawers.

PMDRSBU (PM drawer system busy usage) A usage register for OM group PM that, every 100 seconds, scans line drawers in the PM, and PMDRSBU records system-busy line drawers.

PMERR (PM error) A register for OM group PM that counts errors in an in-service PM. The error conditions that cause PMERR to increase vary by PM type. For Series-1 PMs, like line modules, digital carrier modules, and trunk modules, PMERR counts the following errors: command protocol violations, RAM parity failures, firmware errors, controller message congestion, test failures during a routine or initialization audit, or failures to respond to a message over either plane. For extended multiprocessor system (XMS)- based peripheral modules (for example, line concentrating modules, line group controllers, and line trunk controllers), PMERR counts the following errors: errors that only result in the generation of a log, errors that result in additional maintenance action, accuracy failures, errors that result in who-am-I (WAI) messages, changes from in-service to central-side (C-side) busy or system busy, restart reports, an event that causes a fault and increases register PMFLT.

PMFLT (PM fault) A register for OM group PM that counts faults that make the complete PM or one of its units system busy. Register PMFLT does not count the same fault again when repeated system tests attempt to clear the fault. The conditions that increase PMFLT differ between PMs and XPM.

PMINTEG (PM accuracy failures) A register for OM group PM that counts when the PM detects an accuracy failure and reports it to the central control.

PMMBP (PM changes to manual busy) A register for OM group PM that increases when a PM becomes manual busy from an in-service or in-service trouble state. For line modules (LM), PMMBP increases when the LM becomes manual busy during manually requested warm and cold takeovers.

PMMBTCO (PM manual-busy terminals cut off) A register for OM group PM that counts sub- scriber calls (terminals) that the system cuts off when a PM becomes manual busy. These calls associate with lines or trunks that are either call processing busy or call processing deloading.

PMMCXFR (PM manual cold transfers) A register for OM group PM that increases when a manual action causes an XPM to perform a cold switch of activity (SWACT). Execution of the SWACT command at the MAP terminal can trigger a cold SWACT. A manual request that makes the active unit manually-busy (while the inactive unit is in service) can also trigger a cold SWACT.

PMMMBU (PPM manual busy usage) A usage register for OM group PM that scans the PMs every 100 seconds and records manual-busy PMs.

PMMSBU (PPM system busy usage) A usage register for OM group PM that scans the PMs every 100 seconds and records system-busy PMs. For dual-unit PMs, PMMSBU

2001-8.0-RFM03-0302 Glossary 211

increases one time if both units are system busy. Register PMMSBU also increases if one unit is system busy and the other unit is not in service. The hardware or software problems that make the PM system busy vary by PM type. For a digital carrier module (DCM) or trunk module (TM), the following problems make the PM system busy: the DCM or TM fails a routine audit, message paths are not available to the DCM or TM, the DCM or TM sends more than 200 not requested trouble reports within one 10- min audit period..

PMMWXFR (PM manual warm transfers) A register for OM group PM that increases if manual maintenance forces a dual-unit PM to perform a transfer of activity. A transfer that consists of either a warm SWACT or a unit takeover increases this register. The type of activity transfer depends on the type of PM that the manual request acts upon. Register PMMWXFR increases if: a manual request forces an XPM, like a line group controller or a line trunk controller, to perform a warm SWACT, or a manual request forces a line concentrating module (LCM) to perform a takeover of one unit by the other.

PMPSERR (PM peripheral-side errors) A register for OM group PM that counts errors on the P- side interface of an XPM, or on a link interface module (LIM) frame transport bus (F- bus). The PMPSERR increases if the error affects service or if it results in additional maintenance action. The XPMs include the line concentrating module (LCM). The PMPSERR counts: errors in interface cards that terminate lines, trunks, or links, errors in lines trunks or links, or F-bus errors.

PMPSFLT (PM peripheral-side faults) A register for OM group PM that counts faults on the P- side interface of an XPM or on the LIM frame transport bus (F-bus). These faults affect service and require more maintenance. The XPMs include the line concentrat- ing module (LCM). Register PMPSFLT counts: faults in P-side interface cards that terminate trunks, lines, or links, faults in lines, trunks, and links serviced by the interface cards, or faults in the F-bus.

PMSG Permanent Signal.

PMRGERR (PM ringing generator errors while in service) A register for OM group PM that counts errors in the ringing generators that supply ringing and automatic number identification (ANI) coin functions to the line concentrating module (LCM). Register PMRGERR counts all ringing generator errors, even if the ringing generator is not in service at the time of the error. The LCM must be in service at the time of the error. A single ringing generator can service both LCMs in the same frame. The register can count one ringing generator error four times. The count notes each of the two line concentrating arrays in each of the two LCMs.

PMRGFLT (PM ringing generator faults while in service) A register for OM group PM that counts service-affecting faults detected in the ringing generators that supply ringing and ANI coin functions to the LCM. The ringing generator must be in service for PMRGFLT to increase. On Meridian SL-100 switches, the Intelligent Peripheral Equipment (IPE) counts analog phone ring failures that are due to an overloaded ring generator.

PMSBP (PM changes to system busy) A register for OM group PM that increases when the PM becomes system busy from an in-service or in-service trouble state. Normally, the PM becomes central side (C-side) busy before system busy. If the PM returns to service from the C-side busy state and does not become system busy, PMSBP does not increase. For line modules (LM), PMSBP increases when the LM becomes system busy during both warm and cold takeovers.

PMSBTCO (PM system-busy terminals cut off) A register for OM group PM that counts sub- scriber calls (terminals) cut off when the PM becomes system busy. The conditions

2001-8.0-RFM03-0302 Glossary 212

that increase PMSBTCO vary with the different PMs. The register counts subscriber calls for lines or trunks that are call-processing busy or call-processing deloading. Register PMSBTCO counts subscriber calls cut off when the PM state changes to central side (C-side) busy. The PM state changes to c-side busy from in-service or in- service trouble. Register PMSBTCO counts the calls for the digital carrier module and the trunk module. C-side busy is an intermediate state that occurs before the PM becomes system busy. PMSCXFR (PM system cold transfers) A register for OM group PM that increases when a system action causes an XPM to perform a cold SWACT. The following are examples of system actions that can trigger a cold SWACT in an XPM: an XPM forced to perform a cold SWACT, when the active unit of an XPM becomes system busy, when the central side (C-side) links to the active unit of an XPM becomes system busy.

PMSWXFR (PM system warm transfers) A register for OM group PM that increases if system maintenance forces a dual-unit PM to perform a transfer of activity. The transfer of activity can be a warm SWACT or a unit takeover. The activity transfer depends on the type of PM that the system request acts on. Register PMSWXFR increases when one of the following actions occurs: the system forces an XPM, such as a line group controller or line trunk controller, to perform a warm SWACT, the system forces an LCM to perform a takeover of one unit by the other. It counts a takeover of one unit of the LCM by the other unit. The register does not count a takeback of activity in the LCM.

PMUMBU (Peripheral module unit manual-busy use) A usage register (100 s scan rate) for OM group PM that scans the PMs and PMUMBU records the number of times a PM unit is manual busy. This register increases when a PMunit is first set to manual busy. The register also increases in each of the next scan intervals when the unit remains manually-busy.

PMUSBU (Peripheral module unit system-busy use) A usage register (100 s scan rate) for OM group PM that scans the PMs and PMUSBU records the number of times a PM unit is system busy. This register increases when a PM unit is set to system busy. The register also increases in each of the next scan intervals when the unit remains system busy.

PO Port Origination.

POI Point Of Interface.

point of termination The point of demarcation within a customer-designated premises at which the telephone company’s responsibility for the provision of access service ends.

pointer A data item consisting of an address that tells where to find a desired item.

point-to-point Describing communications between two fixed stations.

Poisson theory A mathematical method for estimating the number of lines needed to handle a given amount of data communications traffic.

polling A communications control method used by some computer/terminal systems whereby a computer asks many devices attached to a common transmission me- dium, in turn, whether they have information to send.

POP Point Of Presence.

port The physical communication line between the central processor and a peripheral. A port consists of a special kind of connector within or on the case of a computer into

2001-8.0-RFM03-0302 Glossary 213

which a connecting cable may be plugged. A port can be either parallel or serial, and may perform a number of functions in addition to routing data.

portable A program that is machine independent; that is, it can be used on more then one type of machine.

portrait Portrait orientation refers to paper oriented so that it is higher than it is wide, like a portrait painting. If the paper can be turned sideways, the result is called landscape orientation.

position That portion of a switchboard designed to be controlled by one operator.

POSRQSTD Incremented each time the QMS CAM receives a request for an operator position to serve a call. POSRQSTD = CQUEUED + GOTPOSIM + CDEFLECT + COVFLMAX + COVFLNCQ + CQDENIED

POSRQST2 Extension register of POSRQSTD post pay coin telephone Coin telephone in which coins are deposited after connection has been made. The coins deposited cannot be returned on the instrument.

POTS Plain Old Telephone Service. power line protection Several things can go wrong with the AC power supplied to a computer from the wall outlet: 1. Brief bursts (“spikes”) of excessive voltage can damage the computer. These spikes come from lightning or from large electric motors switching off. They are easily absorbed by a surge protector. See surge protector. 2. Power failures caus e the computer to shut down or restart suddenly, losing the data you are working on. A surge protector cannot prevent this; if the problem is frequent, you may want to invest in an uninterruptable power supply (UPS). See uninterruptable power supply. 3. The computer can emit radio or TV interference through the power line. This usually can be eliminated with a surge protector or high quality shielded cable. power ratio The ratio of power received to power transmitted.

PPCS Person-to-Person: Collect and special instruction.

PPMUS Port Group Termination Usage. Terminating usage of all ports served by port group. Includes the following circuit types: DCO lines, LS port group highway/timeslot (PGH/TS), DSU channels, outgoing trunks, tone-dial receivers, multifrequency receivers, conference bridges.

PPOUS Port Group Origination Usage. Originating usage of all ports served by port group. Includes the following circuit types: DCO lines, LS port group highway/timeslot (PG11/TS), DSU channels, incoming trunks, multifrequency senders.

P/R Payroll.

PRADCHL2 PRA D-channel layer 2 performance summary. See also OM group PRADCHL2 for an extended description and field names.

PRAFAC Primary rate access facility. See also OM group PRAFAC for an extended description and field names.

PRAQATT Call Queue Profile Priority Agent Queue Search Attempts. PRAQATT is incremented

2001-8.0-RFM03-0302 Glossary 214

each time the call queue profile priority agent queue is searchd for an idle agent to serve the call. The priority agent queue is datafilled in table QMSCQDEF. PRAQDEPT / PRAQATT = average depth to which call queue profile priority queues are searched

PRAQATT2 Extension register of PRAQATT.

PRAQDEPT Call Queue Profile Priority Agent Queue Search Depth. PRAQDEPT records the depth to which an application’s call queue profile priority agent queue is searched before either an idle agent is found to serve the call, or the end of the queue is reached. PRAQDEPT / PRAQATT = average depth to which call queue profile priority queues are searched

PRAQDEP2 Extension register of PRAQDEPT.

PRCL TTY Class. Specifies what class of TTY is used for outputting OPM data.

PRDRNRTX (Receiver not ready (RNR) frames transmitted) A register for OM group PRADCHL2 that is the 1-minute collection of the number of RNR frames the ISDN signaling processor transmits.

PRDS0RX (Correctly received service access point identifier (SAPI) 0 frames) A register for OM group PRADCHL2 that is the 1-minute collection of the number of SAPI 0 frames the system correctly receives.

PRDS0TX (Correctly transmitted service access point identifier (SAPI) 0 frames) A register for OM group PRADCHL2 that counts is the 1-minute collection of the number of SAPI 0 frames that transmit correctly.

PRERTEAB (Preroute abandon) A register for OM group TRK that counts incoming attempts the system abandons before the system can complete routing. The system generates this register for all office types that are correct.

PREU (Protective reservation (PRE) usage) A usage register (100 s scan rate) for OM group TRK that records if the system turns the PRE on for a two-way trunk group. The system generates this register for office types that are correct.

PRFLSHED (Primary rate access (PRA) flow shed) A register for OM group PRADCHL2 that is the 1-minute collection of the number of PRA Q.931 messages the PRA flow control system discards. The system discards a PRA Q.931 message when PRA overload controls are turned on. The system also discards a message when the peripheral module has excessive numbers of messages that queue in the PRA flow control system.

primary busy season The one to two months during which an area, entity, group or network has been, over five or six years, at or close to peak month levels.

printed reports Reports which are printed by printers attached to the computer system.

printer Device for putting computer output on paper.

printer, traffic The portion of an automated traffic data unit that will print stored information on command.

PRISON The number of calls received from a prison by the TOPS VSN. This number is incremented for the relevant key each time a call with a prison screening code is received by the TOPS VSN regardless of whether the subscriber dials 0 for operator

2001-8.0-RFM03-0302 Glossary 215

assistance.

PRISONOP The number of prison calls routed to operator via 0 after the first voice prompt. This number is incremented for the relevant key each time a prison call is routed to the operator after the first voice prompt by dialing 0.

PRNT Printout Schedule. procedure A miniature program that is part of a main program. The procedure is executed when the main program calls for it. processor unit The unit which stores the data and contains the electronic circuitry necessary to carry out the processing of the stored data. It consists of the central processing unit (CPU) and main computer storage.

PROFS Professional Office System (IBM). program A set of instructions that tells a computer how to perform a defined task or tasks, and that processes commands and input in accordance with these instructions. program maintenance The process of keeping programs up to date by correcting errors, making changes as requirements change, and altering the programs to take advantage of equipment changes. programmer A person whose job is to design, write, and test programs and the instructions that cause a computer to do a specific job. progressive control The process of controlling the progress of a call through a switching system using a programmed logic device.

PROM Programmable Read-Only Memory. This is computer memory which does not forget what it knows, even when the power is shut off. Some kinds of PROM can be erased and reused: EPROMs, or Erasable PROMs. PROMs are a convenient way for the user to design their own operating system software and other tailor-made monitor routines. prompt A character or message from the computer to indicate that it is ready to accept keyboard input. Often it takes the form of an on-screen question or instruction that tells the user which data to enter or what action to take, such as “Enter Name:”. propagation To transmit or transport through a medium. proprietary software A software program that is owned by a business or an individual because it is either copyrighted or not yet released to the public. One cannot legally use or copy this software without permission. protector An assembly of protector elements mounted on the main frame to which all outside plant cables terminate as it enters the office. It provides protection from high voltages or currents as well as a place to test each cable pair. protocol A set of rules or conventions regulating data transfer between two computers. protocol analyzer A device designed to both monitor and test data transmission and that normally includes decoding and emulation capability. provisioning A process that represents an interface between the Sun Solaris Teleservcies platform and an installed telephone device, such as a telephone line or a fax machine. Mul-

2001-8.0-RFM03-0302 Glossary 216

tiple instances of a provider can be configured, each based on the same information. Each configuration is identified by a unique primary alias. A primary alias is the primary label used to prefer to a provider configuration. The primary alias is a provider’s default and primary name. This definition courtesy Sun.

PRP Pre-route Peg. See also OM group PRP for an extended description and field names.

PRPCNT Pre-route Peg Count. The only register in OM group PRP that counts calls that originated in the SNPA and were directed to the destination code to which PRPCNT applies.

PS Permanent Signal.

PSGM Register PSGM (machine dialed permanent signal) counts machine-dialed calls that the system routes to permanent signal treatment.

PSH Permanent Signal Hold.

PSHF Peripheral Shelf.

PSIG Permanent Signal Timeout.

PSLBLK (P-side link blockage) A register for OM group XPMLINK that increases for each attempt that fails to allocate a channel between the XPM and one of the subtending nodes.

PSLCAA (P-side link allocation attempts) A register for OM group XPMLINK that increases when the network attempts to allocate a channel between the XPM and the subtend- ing nodes.

PSLCBU (P-side link call busy use) A register for OM group XPMLINK that records the time (in CCS) that P-side links are busy because of call processing.

PSLMU (P-side link maintenance busy use) A register for OM group XPMLINK that records the time ( in CCS) that the links between the XPM and subtending nodes are not avail- able for call processing.

PTM (Portable Traffic Monitor) A solid state traffic measuring device used to accumulate usage information on equipment and trunks.

PTT Post Telephone and Telegraph Administration.

P-type A P-type semiconductor region is formed by doping a silicon crystal with an impurity that contains three outer-level electrons.

public domain A computer program is in the public domain if it is not covered by any kind of copyright.

PUC Public Utility Commission. Has appointed or elected commissioners to monitor and regulate utility activities.

pwr Power.

PWRUPREG (Power-up registration) A register for wireless OM group OMMTX3 that pegs when the mobile registration type is power-up registration.

2001-8.0-RFM03-0302 Glossary 217

PX Private Exchange.

QAM Quadrature Amplitude Modulation.

QMS Queue Management System.

QMSACT Queue Management System Activity. Records events occurring in the queue manage- ment call and agent manager (QMS CAM) as it interacts with other applications. QMSACT registers are: CALLARIV, CALLARV2, IMEDQAG, IMEDQAG2, IMEDTAG, IMEDTAG2, IMEDPAG, IMEDPAG2, CALLQD, CALLQD2, CALLDEFL, CALLDEF2, OVLMAX, OVLNOCQE, GOTAVAG, GOTAVAG2, GOTSPLCL, GOTSPCL2, AGREQCAN, AGREQCN2, SPLCLREQ, SPLCLRQ2, NOSPLCL, and NOSPLCL2. Associated OM Group: QMSDATA

QMSDATA Queue Management System Data. Records events occurring in the queue manage- ment system call and agent manager (QMS CAM) as call and agent queues are searched in response to requests by QMS applications. QMSDATA registers are: CQELHIGH, CTAQATT, CTAQATT2, CTAQDEPT, CTAQDEP2, CQAQATT, CQAQATT2, CQAQDEPT, CQAQDEP2, CQAQSRCH, CQAQSRC2, PRAQATT, PRAQATT2, PRAQDEPT, PRAQDEP2, CQSRCATT, CQSRCAT2, CQSCONS, and CQSCONS2. Associated OM Group: QMSACT

QRTR Quarter Hour.

QTOTAL (Queue total) A register for OM group IBNSG that counts calls the enqueue calls of attendant consoles in a subgroup.

QTRN Query Translator DMO.

qty Quantity.

quad A group of four wires composed of two pairs twisted together.

quad-density Quad-density systems can store up to four times the data that can be stored on single-density disks. Double- sided double-density disks are quad-density disks.

quadded cable Cable with conductors made up in sets of four wires in square formation; diagonally opposite wires are pairs.

quan Quantity.

quarter mileage The charge applied to a customer when their residence lies outside of the base rate area. They pay a fee based on a quarter mile increment over and above the normal exchange rate.

QUERY A register for OM group CAINTRIG that counts the number of times a call queries the SCP.

QUERYSCU (Query Service Control Unit) A register for OM group CAINTRIG that counts the number of times a CAIN call queries the SCP.

queue 1. A series of calls waiting for service. 2. A group of items waiting to be acted upon by the computer. The arrangement of items determines the processing priority. queuing 1. To hold calls in order of their arrival and present them automatically, in the same order, to an operator or a subsystem for attention. 2. A method of controlling the information processing sequence

2001-8.0-RFM03-0302 Glossary 218

RADR Receiver Attachment Delay Recorder. See also OM group RADR for extended description and field names.

radix Base of a number system.

RADLDLYP (RAD lower delay threshold) A register for OM group RADR that counts when:

a. A test request for attachment to a receiver takes longer to satisfy than the lower delay threshold (specified in field RADLDLYT in table RADR )

b. When no receivers are available to satisfy a test request for attachment to a receiver.

c. When the receiver queue overflows.

RADTESTC (RAD test calls) A register for OM group RADR that counts test call originations, which are used to determine the interval between a request for an attachment to a receiver and the time of connection.

RADUDLYP (RAD upper delay threshold) A register for OM group RADR that counts when a test request for attachment to a receiver takes longer to satisfy than the upper delay threshold (specified in the field RADUDLYT in table RADR), when no receivers are available to satisfy a test request for attachment to a receiver, and when the receiver queue overflows.

RAM Random Access Memory, sometimes called read/write memory. It is the main memory of the computer. Information can be written into and read out of this memory and can be changed at any time by a new write operation. The contents of RAM are lost when power to the computer is shut off.

random access The ability to retrieve records without serially searching a file. Also called direct access.

random access memory A memory whose contents can be read or written on directly without regard to any other memory location.

rank In step-by-step switching systems, an array of switches identified according to their position in the switching train of the office.

rank busy hour The hour for which the traffic load of equipment or trunk groups assigned to a specific equipment rank is the greatest.

RAO Revenue Accounting Office. This office is affiliated with the processing of calls from each exchange. Each RAO has a number.

RAT Recorded Announcement Trunk.

rate The price of a toll call for an initial period.

rate point A location of a central office as to where quarter mile charges apply to all subscrib- ers who are served from that exchange. There is no base rate area established due to the remote location of the subscribers.

rate & route The designated toll information positions that enable a toll operator to obtain routing information to complete a call to places not covered by the multileaf.

2001-8.0-RFM03-0302 Glossary 219 raw data Unprocessed data.

RBOC Regional Bell Operating Company.

RC 1. Recording Completing: A trunk group from end offices (Class 5) or TWX switch- ing plan offices to outward toll and/or assistance positions. These groups carry traffic to the world which requires the operator to complete the call. 2. Routing Call (Stromberg-Carlson).

RCF Remote call forwarding. See also OM group RCF for and extended description and field names.

RCFDFLD (Remote call forward calls deflected) A register for OM group RCF that counts calls that the system does not forward for the following reasons: - originator is a test facility - the system reaches the max. number of calls allowed (MAXCALLS in table CFW) - toll call blocking is occurring - service circuit does not exist (CFW_EXT_BLOCKS in table OFCENG) - the system reaches max. CFW chain size (5) - call is operator busy verification call - the system suspends the remote call forward directory number

RCFOFFRD (Call forward attempts) A register for OM group RCF that counts remote call forward- ing attempts, including calls the system later blocks because of network blockage or because the remote station is busy. RCFUSAG (Calls forwarded use count) A usage register for OM group RCF that counts if forwarded calls are in progress. It has a scan rate of 10 s.

RCLCDIS Remote line concentrating module intraswitched calls. See also OM group RCLCDIS for an extended description and field names.

RCLRCONV (Resource Clear Conversation) A register for OM group CAINTRIG that counts the number of times the switch sends a Resource Clear message in a conversation package.

RCMAT DSURLG Channel Termination Attempts. See SCMAT.

RCMOF DSURLG Channel Termination Overflow. See SCMOF.

RCMUS DSURLG Channel Termination Usage. See SCMUS.

RCOOF DSURLG Channel Origination Overflow. See SCOOF.

RCOSZ DSURLG Channel Origination Seizure. See SCOSZ.

RCOUS DSURLG Channel Origination Usage. See SCOUS.

RCSDP_D (RCS dial pulse delay) A register for OM group SITE2 that counts test calls on RCS lines for a dial tone delay greater than 3 s. A high number of delayed calls means high switch use, RCS trouble, or a blocked channel.

RCSDP_D2 An extended register of RCSDP_D of OM group SITE2.

RCSDP_T (RCS dial pulse total) A register for OM group SITE2 that counts test calls on RCS lines. The system updates this register every 15 min, before the OM transfer period.

RCSDP_T2 An extended register of RCSDP_T of OM group SITE2.

2001-8.0-RFM03-0302 Glossary 220

RCSDT_D (RCS digitone delay) A register for OM group SITE2 that counts test calls on RCS Digitone lines that have one of the following conditions: dial tone delay exceeds 3 s, DTMF receiver queue overflow, or DTMF receivers that are not available.

RCSDT_D2 An extended register of RCSDT_D of OM group SITE2.

RCSDT_T (RCS digitone total) A register for OM group SITE2 that counts test calls on RCS Digitone lines. The system updates this register every 15 min before the OM transfer process.

RCSDT_T2 An extended register of RCSDT_T of OM group SITE2.

RCTDP_D (Remote concentrating terminal dial pulse delay) A register for OM group SITE that counts calls for dial pulse lines on RCTs that experience a dial tone that exceeds 3 s. A high count in this register indicates high switch use, RCT trouble, or a channel blockage.

RCTDP_D2 An extended register of RCTDP_D of OM group SITE.

RCTDP_T (Remote concentrating terminal dial pulse total) A register for OM group SITE that counts calls that are on dial pulse lines on RCTs. The system updates this register every 15 min, before the OM transfer period.

RCTDP_T2 An extended register of RCTDP_T of OM group SITE.

RCTDT_D (Remote concentrating terminal digitone delay) A register for OM group SITE that counts calls for Digitone lines on RCT that experience one of the following condi- tions: - dial tone delay that exceeds 3 s - DTMF receiver queue overflow A high count in this register indicates high switch use, RCT trouble, a channel block- age, or not enough available receivers.

RCTDT_D2 An extended register of RCTDT_D of OM group SITE.

RCTDT_T (Remote concentrating terminal digitone total) A register for OM group SITE that counts calls on Digitone lines on RCTs. The system updates this register every 15 min before the OM transfer period.

RCTDT_T2 An extended register of RCTDT_T of OM group SITE.

RCUDP_D (RCU dial pulse delay) A register for OM group SITE2 that counts test calls on RCU dial pulse lines for dial tone delay greater than 3 s. A high number of delayed calls means high switch use, RCU trouble, or a blocked channel.

RCUDP_D2 An extended register of RCUP_D of OM group SITE2.

RCUDP_T (RCU dial pulse total) A register for OM group SITE2 that counts test calls on RCU dial pulse lines. The system updates this register every 15 min before the OM transfer process.

RCUDP_T2 An extended register of RCUP_T of OM group SITE2.

RCUDT_D (RCU digital delay) A register for OM group SITE2 that counts test calls on RCU Digitone lines that have one of the following conditions: dial tone delay that is greater than 3 s, DTMF receiver queue overflow. A high number of delayed calls

2001-8.0-RFM03-0302 Glossary 221

means high switch use, RCU trouble, channel congestion, or not enough available receivers.

RCUDT_D2 An extended register of RCUT_D of OM group SITE2.

RCUDT_T (RCU digital tone) A register for OM group SITE2 that counts test calls on RCU Digitone lines. The system updates this register every 15 min, before the OM transfer process.

RCUDT_T2 An extended register of RCUT_T of OM group SITE2.

RCUKS_D (RCU keyset delay) A register for OM group SITE2 that counts dial tones that exceed 3 s on Meridian business set (MBS) lines that are attached to an RCU. A high number of delayed calls means high switch use, RCU trouble, or a blocked channel.

RCUKS_D2 An extended register of RCUKS_D of OM group SITE2.

RCUKS_T (RCU keyset total) A register for OM group SITE2 that counts the dial tones that the system applies to MBS lines attached to an RCU. The system updates this register every 15 min, before the OM transfer process.

RCUKS_T2 An extended register of RCUKS_T of OM group SITE2.

RCVCSBU (Receiver system busy usage) A usage register for OM group RCVR that counts if the following trunks uses receivers: - trunks that system maintenance (tk_system_busy) removes from service - trunks that are not available to traffic because the associated peripheral modules are out of service (tk_pm_busy) - trunks that maintenance slates for use after call processing, but are available now (tk_deloaded)

RCVMBU (Receiver manual busy usage) A usage register (10 s scan rate) for OM group RCVR that counts if the following trunks use receivers: - trunks that a maintenance person (tk_man_busy) removes from service - trunks the system seizes for manual or system action (tk_seized)

RCVOVFL (Receiver overflows) A register for OM group RCVR that counts when the system cannot satisfy a request for a receiver because all receivers are busy. When all receivers are busy, the request attempts to enter the wait queue for the receiver type.

RCVQABAN (Receiver queue abandons) A register for OM group RCVR that counts when the system deletes a request for a receiver from the wait queue because the caller abandons the call.

RCVQOCC (Receiver queue occupancy) A usage register (10 s scan rate) for OM group RCVR that counts if receiver requests are in the wait queue.

RCVQOVFL (Receiver queue overflow) A register for OM group RCVR that counts when a request for a register fails to enter the wait queue because the queue is full. The size of the wait queue equals the number of receivers, except for Digitone receivers, entered in table RECEIVER. The wait queue size for Digitone receivers equals half of the number entered in table RECEIVER or 100. The Digitone receivers equal half of the number that is less than the other. The system routes the overflow of incoming calls from the receiver queue to no service circuit (NOSC) treatment. The system routes the overflow of outgoing calls from the receiver queue back to where the calls started.

RCVR Receiver.

2001-8.0-RFM03-0302 Glossary 222

RCVRSZRS (Receiver seizures) A register for OM group RCVR that counts when the system receives the assigned call and before the system sets a network path from the receiver to the line, trunk, or position. If a path is not available, the system releases the receiver. The system routes incoming calls that are not assigned a receiver on second attempt to no service circuit (NOSC) treatment. The system routes calls that are not able to get a network path on second attempts to network blockage heavy traffic (NBLH) treatment.

RCVTRU (Receiver traffic usage) A usage register(10 s scan rate) for OM group RCVR that counts if the following trunks use receivers: - trunks that carry traffic (tk_cp_busy) - trunks that carry traffic and inform maintenance when idle (tk_cp_busy_deloaded) - trunks the far-end office seize for lockout (tk_lockout)

R & D Research and Development.

RD 1. Receive Data. 2. Requires Dial Tone (Stromberg- Carlson). 3. See Ringdown.

RDLY Receiver Attachment Delay.

RDTDP_D (RDT dial pulse delay) A register for OM group SITE2 that counts the calls that the system samples on RDT dial pulse lines when the dial tone delay exceeds 3 s.

RDTDP_D2 An extended register of RDTDP_D of OM group SITE2.

RDTDP_T (RDT dial pulse total) A register for OM group SITE2 that counts the calls that the system samples on RDT dial pulse lines. The system updates this register every 15 min.

RDTDP_T2 An extended register of RDTDP_T of OM group SITE2.

RDTDT_D (RDT digitone delay) A register for OM group SITE2 that counts the calls that the system samples on RDT Digitone lines when the dial tone delay exceeds 3 s.

RDTDT_D2 An extended register of RDTDT_D of OM group SITE2.

RDTDT_T (RDT digitone total) A register for OM group SITE2 that counts the calls that the system samples on RDT Digitone lines. The system updates this register every 15 min.

RDTDT_T2 An extended register of RDTDT_T of OM group SITE2.

RDTKS_D (RDT keyset delay) A register for OM group SITE2 that counts the calls that the system samples on RDT keyset signaling when the dial tone delay exceeds 3 s.

RDTKS_D2 An extended register of RDTKS_D of OM group SITE2.

RDTKS_T (RDT keyset total) A register for OM group SITE2 that counts the calls that the system samples on RDT keyset signaling. The system updates this register every 15 min.

RDTKS_T2 An extended register of RDTKS_T of OM group SITE2.

REA Rural Electrification Administration.

read Retrieve information from memory.

2001-8.0-RFM03-0302 Glossary 223 readout Visual display of processed information or output. read/write head A small electromagnet used to read, write, or erase data on a magnetic storage device, such as disk or tape. reboot To restart a computer. To stop and boot the operating system again.

REC Local Terminating Call.

RECALLS (Recalls) A register for OM group IBNSG that counts recalls in a customer subgroup. record A collection of related items of data, or fields, treated as a unit. recorder, traffic A device for measuring the amount of telephone traffic carried by a group or groups of switches or trunks, and for periodically printing a record of the traffic. The electromechanical type consists of rotary stepping switches which every 100 seconds scan the “C lead” of each group of switches or trunks and register the number of busies encountered, then each 15, 30 or 60 minutes, prints out the busy count. recording trunk A one-way trunk from a local office to a toll office over which ticket information is passed. record length A measure of the size of a record, usually specified in units such as words, bytes, or characters. record line card A card which shows the subscriber name and address, lists the station equipment (linefinder and connector number) and the cable pair. The card also has space for trouble reported, trouble found, and the date reported and cleared. redundancy check A check based on the transfer of more bits or characters than the minimum number required to express the message itself, the added bits or characters having been inserted systematically for checking purposes.

REGATTS (Registration Attempts) A dual mode register for wireless OM group OMMTX that pegs when the switch receives a registration attempt message from the serving subcell.

REGCOMPS (Registration Completions) A dual mode register for wireless OM group OMMTX that pegs when the switch successfully processes a registration message from the serving subcell. register A high-speed device used in a central processing unit for temporary storage of small amounts of data or intermittent results during processing. register sender A unit of common control equipment in a dial office which combines the function of a register and a sender.

REJCNGST (Facility reject messages originated due to switch congestion) A register for OM group PRAFAC that counts facility reject messages that originate at the DMS because of congestion at the DMS. Facility reject messages are sent back to the originators whenever it is not possible to route that facility message.

REJMSGDS (Facility reject messages discarded) A register for OM group PRAFAC that counts facility reject messages that are discarded by the DMS whenever the message cannot be routed.

2001-8.0-RFM03-0302 Glossary 224

REJMSGOR (Facility reject messages originated) A register for OM group PRAFAC that counts facility reject messages that are created and sent on a primary rate access (PRA) D channel.

REJMSGTM (Facility reject messages terminated) A register for OM group PRAFAC that counts received facility reject messages that terminate at the DMS.

REJMSGTR (Facility reject messages transmitted) A register for OM group PRAFAC that counts facility reject messages that do not terminate at the DMS but are transmitted to another switch. Both incoming and outgoing trunk groups are incremented.

REJNORTX (Facility reject messages originated due to no routing translation) A register for OM group PRAFAC that counts facility reject messages that originate at the DMS because no translation was found for the destination address.

REJRTUNA (Facility reject messages originated due to route unavailable) A register for OM group PRAFAC that counts facility reject messages that originate at the DMS due to network failure.

release time The time in seconds from the hang-up of the calling party until the switching system has returned to normal or idle state.

release version The version of a program currently available for purchase.

relief The provision of additional equipment or facilities to correct a condition of actual or expected traffic overload.

RELSBILL This register is not currently supported. If it were, it would count the number of times a billed party was released because the billed party greeting was too long. This number is incremented for the relevant key each time the following billing accep- tance retry count values are reached: Billing_No_Response, Billing_Reject_Error, and Billing_Total_Retry.

REM 1. Remote Equipment Module. 2. Remove.

remote switching modules and/or remote switching systems Small, remotely controlled electronic end office switches that obtain their call processing capability from an electronic-analog or digital host office. The remote switching modules and/or remote switching systems cannot accommodate direct trunks to an IC.

remote trunk arrangement Arrangement that permits the extension of TSPS functions to remote locations.

reorder signal An audible signal at the rate of 120 pulses per minute, to indicate that the trunk or circuit should be released and a new attempt made.

repair desk A manual position arranged to receive calls regarding subscriber encountered trouble.

repeater A device which serves as an interface between two circuits, receiving signals from one circuit and transmitting them to the other.

repeater VF Voice frequency amplifier placed onto a circuit that requires voice amplification due to the distance.

repertoire A complete set of instructions that belongs to a specific computer or family of computers.

2001-8.0-RFM03-0302 Glossary 225

REPERRR A register for OM group CAINMSGR that counts the number of Report_Error mes- sages the switch receives from the SCP.

REPERRS A register for OM group CAINMSGS that counts the number of Report_Error mes- sages sent to the SCP. report Printed output that can be read.

REQ See request.

Required Positions Derived from the Force Capacity tables using actual work time and work volume. request A count of the number of requests for a particular resource. rerun Repeat the execution of a program. resident A program that occupies a dedicated area of the computer’s main memory during the operating session.

RESPRCVD A register for OM group CAINTRIG that counts the number of responses the switch recieves from the SCP that can be decoded and the requested action attempted. This register may be pegged when the switch receives messages Analyze_Route, discon- nect, continue, Authorize_Termination, Collect_Information, non-conversational Connect_To_Resource and non-conversational Send_To_Receive. retrial An attempt, after a failed attempt, to establish a telephone call. retrieve Search for, select, and extract data contained in a file or data base.

Return key This key is used to move the cursor to the next line on the display screen. On some keyboards this key is called the “Enter” key.

REV CALL See Revertive Call. reverse video A term used to indicate the ability to display dark characters on a light background. The inverse of the normal foreground and background colors on a video screen.

REVERT (Revertive Call Attempts) A register for OM group LMD that counts revertive calls initiated on an LM. This register increases when ringing starts after the caller goes on- hook for the first time. revertive call A call which originates and terminates on the same line. For example, when a person dials back their own number.

RF Radio Frequency.

RFP Request For Proposal.

RHC Regional (Bell) Holding Company.

RI Ring Indicator. ringback tone An intermittent tone which is returned to the calling party to indicate the called party is being rung. ringdown A circuit on which application of ringing current at one end brings in a signal at the other end.

2001-8.0-RFM03-0302 Glossary 226

ring-start A device whose operation is initiated by a ring indicator signal.

RJE Remote Job Entry.

RNGB Ring Back Tone.

robotics Area of artificial intelligence pertaining to robots. The science of robot design and use.

RODR Reorder.

ROH Receiver Off-Hook.

ROM Read-Only Memory. Nonerasable, permanently programmed memory usually used to store programs and instructions that are needed whenever the computer is used. Programs stored in ROM are called firmware.

RORD Reorder Tone.

RORIGOUT (Remote originating to outgoing) A register for OM group SITE that counts calls that originate at an RLM, RLCM, RSC, or RCT that the system routes to a trunk.

rotary connector group A group that, if the pilot terminal number is busy, will seek the next idle trunk available in that associated group.

rotary out-trunk switch A rotary motion switch used for the purpose of concentrating traffic so that it can be carried on fewer trunks.

ROUT Route and Interoffice Destination DMO.

route The particular circuit group, or interconnected circuit groups, between two reference points used to establish a path for a call.

routine A set of program instructions which accomplishes a particular task that needs to be done frequently. These instructions can be used over and over again, simply by referring to them from other parts of the program.

routing The process of determining and prescribing the path to forward telephone calls through a network.

RPS 1. Recall Position Seizures. 2. A traffic office measurement of the number of recalls routed to operators in a particular team. Reported for each call queue and each call type. Included on fifteen minute reports.

RPM Revolutions Per Minute.

Rq Required.

RRBCMEVT A register for OM group CAINMSGR that counts the number of Request_Report_BCM_Event messages the switch receives from the SCP.

RSCIRALL (Line-to-line calls attempted on interswitching channels) A register for OM group RSCIR that counts attempts to originate line-to-line calls on interswitching channels. The total includes calls that the system blocks because all interswitching channels are busy. The total excludes calls that cannot complete because the destination is busy.

2001-8.0-RFM03-0302 Glossary 227

RSCIRALT (Line-to-trunk calls attempted on interswitching channels) A register for OM group RSCIR that counts attempts to originate line-to-trunk calls on interswitching channels. The total includes calls that the system blocks because all interswitching channels are busy. The total excludes calls that cannot complete because the destination is busy.

RSCIRATL (Trunk-to-line calls attempted on interswitching channels) A register for OM group RSCIR that counts attempts to originate trunk-to-line calls on interswitching channels. The total includes calls that the system blocks because all interswitching channels are busy. The total excludes calls that cannot complete because the destination is busy.

RSCIRATT (Trunk-to-trunk calls attempted on interswitching channels) A register for OM group RSCIR that counts attempts to originate trunk-to-trunk calls on interswitching chan- nels. The total includes calls that the system blocks because all interswitching channels are busy. The total excludes calls that cannot complete because the destina- tion trunk is busy.

RSCIRBLL (Line-to-line calls blocked by busy interswitching channels) A register for OM group RSCIR that counts when a line-to-line call cannot complete because all the interswitching channels are busy. When a line-to-line call cannot complete because all of the interswitching channels are busy, software reroutes the call. The call travels through the DS-1 links to the host site.

RSCIRBLT (Line-to-line calls blocked by busy interswitching channels) A register for OM group RSCIR that counts when a line-to-trunk call can not complete because all the interswitching channels are busy. When a line-to-trunk call can not complete because all the interswitching channels are busy, software reroutes the call. The call travels through the DS-1 links to the host site. The call goes to the destination through a different trunk connected to the host site.

RSCIRBTL (Trunk-to-line calls blocked by busy interswitching channels) A register for OM group RSCIR that counts when a trunk-to-line call cannot complete because all the interswitching channels are busy. When a trunk-to-line call cannot complete because all the interswitching channels are busy, software reroutes the call. The call goes through the DS-1 links to the host site. The call goes to the destination through a different trunk connected to the host site.

RSCIRBTT (Trunk-to-trunk calls blocked by busy interswitching channels) A register for OM group RSCIR that counts when a trunk-to-trunk call cannot complete. The call cannot complete because all the interswitching channels are busy. When a trunk-to-trunk call cannot complete because all the interswitching channels are busy, software reroutes the call. The call travels through the DS-1 links to the host site.

RSCIRCBU (Busy interswitching channels) A usage register for OM group RSCIR that counts The system scans the channels every 100 s. The results are accumulated in the remote and the counter is updated in the CM every 15 minutes. Register RSCIRCBU records if interswitched channels are busy. These channels carry line-to-line, line-to-trunk, trunk-to-line, and trunk-to-trunk calls.

RSCISALL (Line-to-line calls attempted on intraswitching channels) A register for OM group RSCIS that counts attempts to originate line-to-line calls on intraswitching channels. The total includes calls that the system blocks because all intraswitching channels are busy. The total excludes calls that do not complete because the destination is busy.

RSCISALT (Line-to-trunk calls attempted on intraswitching channels) A register for OM group RSCIS that counts attempts to originate line-to-trunk calls on intraswitching channels. The total includes calls that the system blocks because all intraswitching channels are busy. The total excludes calls that do not complete because the destination is busy.

2001-8.0-RFM03-0302 Glossary 228

RSCISATL (Trunk-to-line calls attempted on intraswitching channels) A register for OM group RSCIS that counts attempts to originate trunk-to-line calls on intraswitching channels. The total includes calls that the system blocks because all intraswitching channels are busy. The total excludes calls that do not complete because the destination is busy.

RSCISATT (Trunk-to-trunk calls attempted on intraswitching channels) A register for OM group RSCIS that counts attempts to originate trunk-to-trunk calls on intraswitching chan- nels. The total includes calls that the system blocks because all intraswitching channels are busy. The total excludes calls that do not complete because the destina- tion trunk is busy.

RSCISBLL (Line-to-line calls blocked by busy intraswitching channels) A register for OM group RSCIS that counts when a line-to-line call does not complete because all intraswitching channels are busy. When a line-to-line call does not complete, because all intraswitching channels are busy, software reroutes the call. The call travels through the DS-1 links to the host site.

RSCISBLT (Line-to-trunk calls blocked by busy intraswitching channels) A register for OM group RSCIS that counts increases when a line-to-trunk call does not complete because all intraswitching channels are busy. When a line-to-trunk call does not complete, because all intraswitching channels are busy, software reroutes the call. The call travels through the DS-1 links to the host site. The call travels to the destination through a different trunk that connects to the host site.

RSCISBTL (Trunk-to-line calls blocked by busy intraswitching channels) A register for OM group RSCIS that counts when a trunk-to-line call does not complete because all intraswitching channels are busy. When a trunk-to-line call does not complete, because all intraswitching channels are busy, software reroutes the call. The call travels through the DS-1links to the host site. The call travels to the destination through a different trunk connected to the host site.

RSCISBTT (Trunk-to-trunk calls blocked by busy intraswitching channels) A register for OM group RSCIS that counts when a trunk-to-trunk call doesn’t complete because all intraswitching channels are busy. In this scenario, software reroutes the call and the call travels through the DS-1 links to the host site.

RSCISCBU (Busy intraswitching channels) A usage register for OM group RSCIS. Every 100 s, the system scans intraswitching channels and register RSCISCBU records the number of intraswitched channels that are busy. The results are accumulated in the remote and the counter in the CM is updated every 15 minutes. These channels carry line-to-line, line-to-trunk, trunk-to-line, and trunk-to-trunk calls.

RSPLSHRQ (Received Splash Request) A register for wireless OM group that is not currently in use.

RSPLSHSC (Received Splash Service Call) A register for wireless OM group that is not currently in use.

RSRCCLR A register for OM group CAINMSGS that counts the number of Resource_Clear messages sent to the SCP.

RSQ Receive Signal Quality.

RS-232 An industry-wide standard protocol for asynchronous serial data communications between computers and peripheral devices.

2001-8.0-RFM03-0302 Glossary 229

RTA Remote Trunk Arrangement.

RTS Request To Send.

RTYEXDOP The number of calls routed to operator because of too many errors. This number is incremented for the relevant key each time the billed party does not hang up to refuse the charges and the value of one of the following parameters is reached: Billing_No_Response, Billing_Reject_Error, or Billing_Total_Retry. run The execution of a program by a computer on a given set of data.

RV Revertive.

RVRT Revertive Call. Usage begins when ringing is applied to the line and continues until the call has been answered and both parties disconnect. This register includes total office revertive usage for host and remotes.

R/W Read/Write.

S1 Speed Calling One Digit.

S2 Speed Calling Two Digit.

SAC Special Area Code.

SAM Service Attitude Measurement.

SAMENUM The number of times the call is converted to a collect call because the billed number is the same as the dialed number. This number is incremented for the relevant key each time the billed and called numbers are the same, and the Collect_If_Same_Num parameter in the User Interaction table is set to yes.

SAT Supervisory Audio Tone.

SATT Strowger Automatic Toll Ticketing.

SATTOS (Supervisor Audio Tone Time Outs) A register for wireless OM group that pegs when an ICP receives a timeout message from the voice channel indicating SAT Failure message. Pegs for all SAT/digital voice color code (DVCC) timeout conditions. These include call setup failure, dropped calls, and dropped handoffs on this cell. save To store information somewhere other than in the computer’s main memory, such as on a tape or disk, so it can be used again.

SAWT Service Average Work Time. The average work time generated by each service initiation. The formula for this calculation is SWV/SI.

SBITMIS (Signal-Bit Mismatch) A register for wireless OM group ICPCP that pegs when an ICP rejects an origination/page response message from a subscriber unit. The ICP rejects these messages because they did not follow the CCH signal bit (S-bit) restrictions sent from the cell site to the subscriber unit.

SBU (System busy usage) A usage register (100 s scan rate) for OM group TRK that counts if a trunk is in one of the following states: remote busy, peripheral module busy, system busy, carrier fail or deloaded. The system generates this register for office types that are correct.

2001-8.0-RFM03-0302 Glossary 230

SC 1. Secondary Channel. 2. Sent-Collect.

SCA Selective Call Acceptance. See also OM group SCA for extended description and field names.

SCAACT (SCA activation) A register for OM group SCA that counts activations of the SCA feature by subscribers.

SCAAUNIV (SCA activations universal) A register for OM group SCA that counts successful activations of the SCA feature by a universal user.

SCADACT (SCA deactivations) A register for OM group SCA that counts deactivations of the SCA feature by subscribers.

SCADENY (SCA denials universal) A register for OM group SCA that counts every time the system denies the SCA feature to a universal user (because the DENYSCA option is in effect).

SCADUNIV (SCA deactivations universal) A register for OM group SCA that counts deactivations of the SCA feature by a universal user.

SCAEATT (SCA editing attempts) A register for OM group SCA that counts attempts to enter the screening list editing (SLE) function for the SCA.

SCAEDEN (SCA editing denied) A register for OM group SCA that counts attempts to access SLE for the SCA feature. Register SCAEDEN counts attempts that the system denies for one of the following reasons: the system does not assign the SCA feature to the line, the system does not activate the SCA feature in the office, the system denies a universal access attempt because the DENYSCA option is on the line. The system routes the call to feature not allowed (FNAL) treatment.

SCAEOVFL (SCA editing overflowed) A register for OM group SCA that counts denied attempts to access SLE for the SCA feature. The system denies the attempts because there are not the required system resources.

SCAEUSAG (SCA editing use) A usage register (10 s scan rate) for OM group SCA that counts if a line uses SCA SLE.

SCAMA Stromberg-Carlson AMA.

SCAN Switched Circuit Automatic Network.

scan A sequential and progressive test of circuits to detect busy or idle status. The intent of a scan is, by sampling, to measure the average traffic usage on a group of circuits.

scan interval The time interval between scans of circuits. Normal scan intervals are 100 seconds and 10 seconds, so that counts approximate CCS or tenths of CCS.

scanner A device that enables a computer to read a printed or handwritten page. Advanced scanners can read the letters of typewritten text, transmitting them into the computer as if they were typed on the keyboard.

scanner, traffic A device which, at specified intervals, tests circuits or equipment and is able as a result to provide such information as the traffic carried, traffic overflowed and lost, register occupancy, and call holding times.

SCASAT (SCA screening attempt) A register for OM group SCA that counts terminating calls

2001-8.0-RFM03-0302 Glossary 231

that attempt to access the SCA feature.

SCASAT2 An extension register of SCASAT.

SCASBLK (SCA screening blocked) A register for OM group SCA that counts blocked attempts to the SCA feature. The system blocks the attempts because the system cannot access the screening list. When the system blocks SCA screening, the call proceeds as if the system screened and rejected the call.

SCASDEN (SCA screening denied) A register for OM group SCA that counts denied attempts to use the SCA feature. When the system denies a call, the call proceeds as if the the system screened and rejected the call.

SCASRUT (SCA call screening rejected) A register for OM group SCA that counts calls that the SCA feature rejects. The system routes the call to SCA treatment.

SCASRUT2 An extension register of SCASRUT.

SCASTRM (SCA call screening termination) A register for OM group SCA that counts calls that the SCA feature accepts.

SCAUNIV (SCA universal access attempts) A register for OM group SCA that counts the number of times a universal user attempts to access the SCA feature.

SCC Specialized Common Carrier. A common carrier, not a telephone company, offering new and different services to meet public needs not adequately met by existing “traditional” carriers.

SCD Service Circuit Diagnostic.

scenario An imagined sequence of events that determine key system inputs and parameters to a decision-making model. For each scenario, one can then run the model on a computer, observing how system variables interact over time.

SCF Selective Call Forwarding. See also OM group SCF for an extended description and field names.

SCFACT (SCF successful activations) A register for OM group SCF that counts calls that correctly activate the SCF feature by subscribers.

SCFAUNV (SCF activations universal) A register for OM group SCF that counts correct activa- tions by a universal user of the SCF feature.

SCFDACT (SCF successful deactivations) A register for OM group SCF that counts calls that correctly deactivate the SCF feature by subscribers.

SCFDENY (SCF denials universal) A register for OM group SCF that counts the number of times the SCF feature is denied to a universal user because the DENYSCF option is in effect.

SCFDUNV (SCF deactivations universal) A register for OM group SCF that counts deactivations of the SCF feature by a universal user.

SCFEATT (SCF editing attempts) A register for OM group SCF that counts attempts to access SLE for the SCF feature.

SCFEDEN (SCF editing denials) A register for OM group SCF that counts attempts to access SLE for the SCF feature that are denied. Attempts are denied for one of the following

2001-8.0-RFM03-0302 Glossary 232

reasons: the SCF feature is not assigned to the line; the SCF feature is not activated in the office; a universal access attempt is denied because the DENYSCF option is on the line. The system routes the call to FNAL treatment.

SCFEOVF (SCF editing overflow) A register for OM group SCF that counts attempts to access SLE for the SCF feature that fail because of lack of system resources.

SCFEUSG (SCF editing usage) A usage register (10 s scan rate) for OM group SCF that records if a line uses SLE for the SCF feature.

SCFFAIL (SCF failure) A register for OM group SCF that counts calls that attempt to forward. Calls that attempt to forward use the SCF feature but fail because of feature interac- tions.

SCFFWD (SCF forwarded calls) A register for OM group SCF that counts calls that the SCF feature forwards through a base station.

SCFFWD2 An extension register for field SCFFWD of OM group SCF.

SCFOVFL (SCF overflow) A register for OM group SCF that counts calls that attempt to for- ward. Calls that attempt to forward use the SCF feature but fail because of lack of system resources or because of system failure.

SCFSAT (SCF screening attempt) A register for OM group SCF that counts calls that the system routes to a base station when the SCF feature is active on the station.

SCFSAT2 An extension register of SCFSAT from OM group SCF.

SCFSBLK (SCF screening blocking) A register for OM group SCF that counts calls that attempt to forward. Calls that attempt to forward use the SCF feature but are not screened because the screening list is not available.

SCFSDEN (SCF screening denials) A register for OM group SCF that counts calls that attempt to forward. Calls that attempt to forward use the SCF feature but are not screened because the incoming directory number is not available.

SCFSOVFL (SCF screening overflow) A register for OM group SCF that counts attempts to forward that use the SCF feature that fail. Attempts to forward can fail because the maximum number of simultaneous calls that can use SCF has been reached.

SCFUNIV (SCF universal access attempts) A register for OM group SCF that counts the number of times a universal user attempts to access the SCF feature.

schedule A list of events in the order they should occur.

SCLL Speed Call Long List Changes.

SCM Subscriber Carrier Module.

SCMAT Digital Satellite Interface Channel Termination Attempts. Scored when channel is assigned for a call to satellite line.

SCMOF Digital Satellite Interface Channel Termination Overflow. Call attempts to satellite lines that fail due to all channels busy.

SCMUS Digital Satellite Interface Channel Termination Usage. Channel usage for calls to satellite lines.

2001-8.0-RFM03-0302 Glossary 233

SCOOF Digital Satellite Interface Channel Origination Overflow. Off-hook request for service from satellite line is abandoned while request is in all-channels-busy queue awaiting channel assignment. Scored after channel assignment, when call processor recog- nizes on-hook condition of satellite line.

SCOSZ Digital Satellite Interface Channel Origination Seizures. Scored when channel is assigned in response to an off-hook request for service from satellite line. Includes channel origination overflow count.

SCOUS Digital Satellite Interface Channel Origination Usage. Channel usage for calls from satellite lines.

SCP Service Control Point. screen display Anything shown on the screen that is visible. screen update Process of changing screen contents to reflect new information.

SCRJ Selective Call Rejection. See also OM group SCRJ for extended description and field names.

SCRJACT (SCRJ activation) A register for OM group SCRJ that counts successful attempts to activate the Selective Call Rejection (SCRJ) feature by subscribers.

SCRJAUNIV (SCRJ activation universal) A register for OM group SCRJ that counts successful attempts to activate the Selective Call Rejection (SCRJ) feature by a common user.

SCRJDACT (SCRJ deactivation) A register for OM group SCRJ that counts successful attempts to deactivate the Selective Call Rejection (SCRJ) feature by subscribers.

SCRJDENY (SCRJ universal access denial) A register for OM group SCRJ that counts when the system denies the SCRJ feature to a universal user because the DENYSCRJ option is in effect.

SCRJDUNV (SCRJ universal access denial) A register for OM group SCRJ that counts when the system denies the SCRJ feature to a universal user because the DENYSCRJ option is in effect.

SCRJEATT (SCRJ editing attempts) A register for OM group SCRJ that counts attempts to invoke a selective call rejection screening list editing session.

SCRJEDEN (SCRJ editing denied) A register for OM group SCRJ that counts attempts to invoke a selective call rejection screening list editing session that fail for the following reasons: the Selective Call Rejection (SCRJ) feature is not assigned to the line; the SCRJ feature is not activated in the office; the system denies a common attempt because the DENYSCRJ option is on the line. The system routes the call to feature not allowed (FNAL) treatment.

SCRJEOVF (SCRJ editing overflow) A register for OM group SCRJ that counts attempts to invoke a selective call rejection screening list editing session that fail for the following reasons: system failure or a lack of hardware or software resources.

SCRJEUSG (SCRJ editing usage) A usage register (10 s scan rate) for OM group SCRJ that records if a line uses the selective call rejection screening list editing facility.

SCRJSAT (SCRJ screening attempts) A register for OM group SCRJ that counts calls that

2001-8.0-RFM03-0302 Glossary 234

terminate on a line on which the SCRJ feature is active.

SCRJSAT2 An extension register of SRJESAT for OM group SCRJ.

SCRJSBLK (SCRJ screening blocked) A register for OM group SCRJ that counts selective call rejection attempts that the system blocks because the screening list is not available. The call continues as if the SCFJ feature screened the call.

SCRJSDEN (SCRJ screening denial) A register for OM group SCRJ that counts calls that the SCRJ feature does not screen because the incoming directory number is not available. The call continues as if the system feature screened the call.

SCRJSRJT (SCRJ call screening rejected) A register for OM group SCRJ that counts calls that the SCRJ feature screens and rejects. The system routes the call to selective call rejection (SCRJ) treatment.

SCRJUNIV (SCRJ universal access attempts) A register for OM group SCRJ that counts when a universal user attempts to access the SCRJ feature.

scrolling To move data on a computer screen until the desired spot in the text is reached.

SCSL Speed Call Short List Changes.

SCWID Spontaneous call waiting identification.

SCWDATTS (SCWID attempts) A register for OM group CNDXPM that increases each time the XPM receives a request to make a SCWID call.

SCWDCOMP (SCWID completed) A register for OM group CNDXPM that increases each time the XPM successfully transmits data to the SCWID line.

SCWDFAIL (SCWID failure) A register for OM group CNDXPM that increases each time the XPM fails to transmit data to the CMR card. The copy is successful when the system copies data to the CMR card.

SCWDNAKA (SCWID no ACK alerting) A register for OM group CNDXPM that increases each time the XPM expects an acknowledgement tone and a tone does not transmit. The tone is from customer equipment and occurs during alerting.

SCWDNAKR (SCWID no ACK re-alerting) A register for OM group CNDXPM that increases each time the XPM expects an acknowledgement tone and a tone does not transmit. The tone is from customer equipment and occurs during re-alerting.

SCWDNUTR (SCWID no universal tone receivers (UTR) channels) A register for OM group CNDXPM that increases each time the XPM receives a SCWID request with the ACK_TONE option and UTR channels are not available. The UTR channels monitor for the ACK tone.

SCWDNYDS (SCWID denied display by cancel (CSCWID)) A register for OM group CND that counts the number of calls not allowed to display because the controller activated CSCWID before originating the current call. This register does not apply to ISDN sets.

SCWDOVLP (SCWID overlap) A register for OM group CNDXPM that increases each time the XPM tries to apply call waiting tone 2 (CWT2) and the data transmission is not complete.

SCWIDDEL (SCWID data delivered) A register for OM group CND that counts all SCWID data delivered for a waiting call to the XPM from the CM. Note: Register SCWIDDEL

2001-8.0-RFM03-0302 Glossary 235

indicates that the system delivers SCWID data to the XPM from the CM. Associated OM group CNDXPM must be referenced to determine if the XPM delivered the SCWID data to the telephone of the subscriber. This register does not apply to ISDN sets. This register in not supported on the DMS 100G switch.

SDD3S Digital Satellite Interface Dial Tone Delay Over 3 Seconds. Off-hook requests for service from satellite lines that do not receive dial tone within three seconds.

SDLC Synchronous Data Link Control (IBM).

SDM Sub-Rate Data Multiplexer. search To look for a specific piece of data. sec Second. secondary busy season The month(s) within the five to six months on either side of the primary busy season that is periodically among the three highest busy season months. secondary storage device A device used to store large quantities of data and programs. Supplements the main storage of a computer. sector Defined area of a track on a disk surface. It is numbered and can hold a specified number of characters. security The state achieved by hardware, software, or data as a result of successful efforts to prevent damage, theft, or corruption.

SEF Small Exchange Factor. segment Division of a computer program. selector A switch in a dial telephone office whose function is to select a trunk toward the desired destination. The appropriate trunk group is determined from the last digit dialed, and the first idle trunk in the group is selected automatically. selectors A In step-by-step central offices, selectors are arranged in bays of either 120 or 160 selectors and two bays are arranged together with a trunk DTA (Distributing Terminal Assembly) to make up a “board” of either 240 or 360 selectors. For trunk access purposes, selectors are usually arranged in standard selector subgroups, the number of selectors in a standard subgroup being a sub-multiple of either 240 or 360. Selectors A refer to selectors in a standard subgroup. selectors B There are often selector boards in a central office which are not full, and in these boards there are so-called leftover selector subgroups which do not contain a standard number of selectors. Selectors B refer to selectors in leftover subgroups. selectors, originating Selectors which are beyond the median switching stage of the office and having the majority of their traffic destined for points outside of the office. selectors, terminating Selectors which are beyond the median switching stage of the office and having the majority of their traffic destined for points inside of the office. self-test A test of the internal circuitry in a communications device. semaphores Synchronization primitives used to coordinate the activities of two or more programs or processes running at the same time and sharing information.

2001-8.0-RFM03-0302 Glossary 236

semi pub Coin telephone located so that it is available to the public part of the time. These phones are located inside a store or business establishment.

sender A device in a common control switching system which receives address information from a translator or from a register and outpulses routing digits to a trunk or the called subscriber’s number.

SENDNOT A register for OM group CAINMSGR that counts the number of Send_Notification messages received by the SSP.

separations The division of telephone company costs and revenues between interstate and intrastate jurisdictions for regulatory purposes.

SEQATT (Subscriber dialed MCCS sequence call attempts) A register for OM group CDMCCS that counts subscriber-dialed MCCS sequence call attempts [that is, the number of times that the subscriber keys an octothorpe (#) after the called party disconnects]. If hardware problems occur with the DRAM or an MCCS receiver, the call receives dial tone.

SEQFAIL (Subscriber dialed MCCS sequence call failures) A register for OM group CDMCCS that counts failed subscriber-dialed MCCS sequence calls caused by hardware prob- lems with the DRAM or an MCCS receiver. A dial tone returns if hardware problems occur with the DRAM or with an MCCS receiver.

SEQQRY (Subscriber dialed MCCS sequence database queries) A register for OM group CDMCCS that counts calling card validation queries the system sends to the billing validation database on sequence calls.

sequential file A file on which records are stored one after another normally in ascending or descending sequence, based upon some control field.

serial Things occurring one after the other. A serial interface is one that sends out one bit at a time.

serial data Data transmitted sequentially, one bit at a time.

serial port An input/output port in a computer through which data is transmitted and received one bit at a time. In most cases, in personal computers, serial data is passed through an RS-232 serial interface port.

SERIALRC (Serial call recalls) A register for OM group IBNSG that counts serial call recalls that an attendant consoles in a subgroup answers.

serial transmission A method of data transfer in which the bits composing a character are sent sequen- tially. Serial transmission is required for telephone data transfer.

SERVERR The number of times invalid codes are entered during service selection. This number is incremented for the relevant key each time an invalid one-digit or two-digit number is dialed during service selection.

service observation Statistical measurement of the quality of service provided for telephone subscribers.

service order A written order to provide, change, or disconnect service to a customer.

session The period of time during which a computer system operator works from a terminal at one sitting.

2001-8.0-RFM03-0302 Glossary 237

SETA Southeastern Telecommunications Association. settlements The toll settlements agreement between telephone companies to fairly reimburse each carrier for their contribution in providing toll service. Interstate toll settlements are now managed by the National Exchange Carrier Association. Interexchange (long distance) carriers pay access charges to local exchange carriers for use of their facilities in reaching the end user. End users also pay the local exchange carriers access charges. NECA determines equitable distribution of the access charges among the local exchange carriers based on each ones facilities and expenses.

SF 1. See Single Frequency. 2. See Straightforward Trunk.

SFAILQRY (Supervisory Audio Tone Failed Query) A register for wireless OM group that pegs when the RSSI value that was measured on a voice channel is between the deltat thresholds specified in fields CONNECT and IGNORE in table PARTDATA and the idle channel RSSI, but the voice channel audit failed to get a response. This indicates the ICP did not send the SAT present message to the CM and the call was not set up.

SG Signal Ground.

Shannon’s Law A tenet stating the relationship between the maximum bit rate capacity of a channel of bandwidth W and its signal-to-noise ratio. shared file A direct access device that may be used by two systems at the same time. sheath miles The actual length of cable in route miles. short The failure of a signal entered at one end of a conductor to reach the opposite end.

SI Service Initiations. A service measurement for the amount of work time generated by call receiving a particular service.

SIF Signaling Information Field

SIGNORED (Supervisory Audio Tone Ignored) A register for wireless OM group ICPCP that pegs when the RSSI value that was measured on the voice channel is weaker than the threshold value specified in field IGNORE in table PARTDATA and for the idle RSSI. This indicates the ICP did not send the SAT present message to the CM and the call was not set up. sign on The process of establishing a user/computer interface. signal-to-noise ratio The ratio of the amplitude of the desired signal to the amplitude of noise signals. signal-to-noise test A test used as an indicator of transmission line quality. silicon chip A tiny portion of a silicon wafer with thousands of electronic components and circuit patterns etched onto its surface. simulate Employ mathematical models to represent real world situations. singing Objectionable noise to communicating subscribers resulting from unbalanced hybrid energy leaks being amplified by excessive gain in the transmission channel. single frequency A method of signaling over long haul telephone lines in which the presence of a 2600 Hz continuous tone indicates to the far end that the line is idle. Tone is on

2001-8.0-RFM03-0302 Glossary 238

during the idle condition and off when the circuit is in use.

SIO Service Information

SITE for RLM Traffic and dial-tone speed recording for remote sites. See also OM group SITE for RLM for an extended description and field names.

SITE for RPM Traffic and dial-tone speed recording for remote sites. See also OM group SITE for RPM for an extended description and field names.

SIT State Income Tax.

SITE2 Traffic and tone speed recording, remote site 2. See also OM group SITE2 for an extended description and field names.

sizing The process of determining the number of ports on a communications hardware device to support a given level of activity.

SK Stuck.

SL Subscriber Line Transfer.

slave Unit controlled by another unit.

SLC Subscriber Loop Carrier.

SLLNK SL-100 link. See also OM group SLNNK for an extended description and list of field names.

SLLNKINC SL-100 incoming link. See also OM group SLNNKINC for an extended description and list of field names.

SLLNKBAD (SL-100 incoming link bad) A register for OM group SLLNK that counts messages that are not correct that the system receives from the data link. The operating company can use this register to identify data links that have input problems. Not necessary, garbled, or deleted characters are examples of input problems.

SLLNKIOF (SL-100 incoming link okay overflow) A register for OM group SLLNK that counts messages from the data link that the system places in a queue. This register increases when register SLLNKIOK overflows.

SLLNKIOK (SL-100 incoming link okay) A register for OM group SLLNK that counts messages from the data link that the system places in a queue.

SLLNKIOV (SL-100 incoming link overflow) A register for OM group SLLNK that counts mes- sages that the system discards or overwrites when the messages attempt to use an incoming queue that is full. A full queue is a queue that has the maximum number of messages waiting to be processed.

SLLNKIQU (SL-100 incoming link queued) A usage register (100 s scan rate) for OM group SLLNK that counts records if there are messages in the queue waiting to be pro- cessed. This register does not increase for NT1X89 links.

SLLNKOVF (SL-100 link overflow) A register for OM group SLLNK that counts messages that are discarded or overwritten because of an attempt to enqueue on a full queue. A full queue contains the a maximum number of messages waiting to be processed. Discarded or overwritten messages cannot be retrieved.

2001-8.0-RFM03-0302 Glossary 239

SLLNKOK (SL-100 link okay) A register for OM group SLLNK that counts messages that are enqueued successfully for transfer to the downstream processor.

SLLNKQU (SL-100 link queued) A usage register (100 s scan rate) for OM group SLLNK that records whether there are messages in the queue waiting to be processed.

SLT Signaling Link Transfer

SLTPGREQ (slotted mode page request) A register for OM group CAUCPSYS that counts when CPN receives a peg request from CM for a mobile station in slotted mode paging; pegged on a per-CAU basis (not based on logical cell number)

SLTPGRES (slotted mode page response) A register for OM group CAUCPSCT that counts when a mobile station in slotted mode responds to a page within CDMACONF.CAUPGTO seconds. It is pegged based on the sector from which the response came from.

SLTPGRRS (slotted mode page retry response) A register for OM group CAUCPSCT that counts when a mobile station in slotted mode responds to the second page (repage) within CDMACONF.CAUPGTO seconds. It is pegged based on the sector from which the response came from.

SLTPGRTY (slotted mode page retry) A register for OM group CAUCPSYS that counts after no response is received by the PCN within CAUPGTO seconds and after the second page request has been sent. Like register SLTPGREQ, it is pegged on a per-CAU basis, which is only applicable for the mobile station in slotted mode paging.

SLTPGTO (slotted mode page timeout) A register for OM group CAUCPSYS that counts when a CPN has times out two times without receiving a page response from the mobile station in slotted mode paging.

SLU Subscriber Line Usage.

SM Satellite Number Termination.

SMDR Station Message Detail Recording.

SN Individual Satellite Line.

S/N Signal-to-Noise ratio.

SNA Systems Network Architecture (IBM).

SND2RSRC A register for OM group CAINMSGR that counts the number of Send_To_Resource messages the switch receives from the SCP.

SNET Service Network.

SNWK Service Network Loop.

SO Satellite Number Origination. software Programs or instructions that tell a computer what to do. software license An agreement between the publisher or developer of a computer program and the person who purchases a copy of it. Most licenses allow a single copy of the pro- gram to be used on only one machine at a time. It can be copied for backup pur-

2001-8.0-RFM03-0302 Glossary 240

poses, and it can be moved from one machine to another, but it cannot be actually in use in two places at once.

SOH Start Of Header.

sort Arrange data according to a logical system.

SOTSNCBN (No circuit business network trunks) A register for OM group SOTS that counts calls the system routes to GNCT treatment because no Meridian Digital Centrex (MDC) trunk is available.

SOTSNCID (No circuit inward dial trunks) A register for OM group SOTS that counts calls that the system routes to GNCT because no direct inward dial or dial trunk is available.

SOTSNCID (No circuit inward dial trunks) A register for OM group SOTS that counts calls that the system routes to GNCT because no direct inward dial or dial trunk is available.

SOTSNCIM (No circuit intermachine trunk) A register for OM group SOTS that counts calls the system routes to GNCT because no intermachine trunk is available.

SOTSNCIT (No circuit intertoll trunks) A register for OM group SOTS that counts calls that the system routes to GNCT because no intertoll trunk is available.

SOTSNCLT (No circuit local tandem trunks) A register for OM group SOTS that counts calls that the system routes to GNCT because no local tandem trunk is available.

SOTSNCOF (No circuit offnet trunk) A register for OM group SOTS that counts calls that the system routes to GNCT because no circuit offnet access or direct outward dial trunk is available.

SOTSNCON (No circuit onnet trunk) A register for OM group SOTS that counts calls that the system routes to GNCT because no dedicated access or mobile telephone exchange trunk is available.

SOTSNCOT (No circuit other trunk) A register for OM group SOTS that counts calls that the system routes to GNCT because one of the following types of trunk is not available: test line trunk, test desk trunk or maintenance trunk.

SOTSNCRT (No circuit) A register for OM group SOTS that counts calls that the system routes to GNCT because one of the following types of trunk is not available: - 0+/0- tandem to TOPS - outgoing to AMR5 or centralized automatic message accounting (CAMA) - outgoing local - recording completing outgoing - TOPS outgoing

SOTSNCTC (No circuit toll-completing trunks) A register for OM group SOTS that counts calls that the system routes to GNCT because no toll-completing trunk is available.

SOTSNOSC (No service circuit) A register for OM group SOTS that counts calls that the system routes to GNCT because an automatic number announcement or intercept trunk is not available.

SOTSPDLM (Machine-dialed partial dials) A register for OM group SOTS that counts machine- dialed calls that the system routes to partial dial timeout treatment.

SOTSPSGM (Machine-dialed permanent signal) A register for OM group SOTS that counts

2001-8.0-RFM03-0302 Glossary 241

machine-dialed calls that the system routes to permanent signal timeout treatment.

SOUTMFL (Outgoing first-trial matchfails) A register for OM group SOTS that increases for each failed first attempt to find a network path (from a line or trunk to a selected outgoing or test trunk). The system routes the call to another trunk if one is available. If the routing list is exhausted before the system finds another trunk, the system routes the call to GNCT. This register doesn’t count the failed attempts to connect to special tone or announcement trunks. If the system allows only one attempt to find a network connection, SOTS_SOUTRMFL increases instead of SOTS_SOUTMFL.

SOUTNWT (Outgoing network attempts) A register for OM group SOTS that counts attempts to find a network path from a line or trunk to a selected outgoing or test trunk. The attempt may involve a connection that uses a conference circuit or digital echo suppressor. If that occurs, only one attempt is counted, although two or more network paths must be set up. SOUTMFL counts first trial failures. Another outgoing trunk then routes the call. If the system allows only one attempt at a network connection, and a failure occurs, the register SOUTRMFL increases. If the call is a second-trial failure, SOUTRMFL counts the failure to get a path. The call is then routed to network blockage heavy traffic (NBLH) treatment.

SOUTOSF (Outgoing first-trial seize failures) A register for OM group SOTS that counts first-trial seize failures that occur after an outgoing trunk has been selected and the necessary network paths acquired. The register then routes the call to another outgoing trunk. If a seize failure occurs where one seize fail is allowed, SOUTROSF increases instead of SOUTOSF.

SOUTRMFL (Outgoing retrial matchfails) A register for OM group SOTS that increases for each failure of a second attempt to find a network path. The failure is from a line or trunk to a selected outgoing or test trunk. The number of connection failures accumulates over all groups in the routing chain. The result is that the two failures do not involve the same group. If only one attempt to find a network connection is allowed, SOUTRMFL increases instead of SOUTMFL. Register SOUTRMFL is a last network attempt failure. As a result of being last, register SOUTRMFL counts the number of calls that are unable to get a network connection.

SOUTROSF (Outgoing retrial seize failures) A register for OM group SOTS that increases for each failed second attempt to seize an outgoing trunk. If this occurs in a plain ordinary telephone service (POTS) environment, the system routes the call to start signal timeout (SSTO) treatment. In an equal access environment, the system routes the call to signal timeout Bell operating company (STOB). The system also routes the call to signal timeout inter LATA carrier/international carrier (STOC) treatment. One of the following can cause the failure: - a reversed trunk - failure to receive a known start-dial - not planned stop-dial - timeout before getting expected stop-dial Register SOUTROSF does not count a call if it entered supervision. If the system allows only one attempt to seize an outgoing trunk, SOUTROSF increases instead of SOUTOSF.

SPCLCCT (Special calls accounted) A register for OM group IBNSG that counts when an attendant answers a call. This register does not count transfer-to-attendant calls or dial zero calls.

STNATTS (Special tone attempts) A register for OM group STN that counts attempts to connect an idle special tone circuit to a line or trunk. The system makes a maximum of two attempts for any call. If the system cannot correct receiver off-hook (ROH) tone, the

2001-8.0-RFM03-0302 Glossary 242

system routes the call forward. If the system cannot connect call waiting tone (CWT), the call proceeds as if the system sent the tone. The calling party hears ringing until the called party disconnects and the new call completes. Because of failure to get CWT tone, the called party has no notice of a call waiting.

STNMBU (Special tone manual busy) A usage register for OM group STN that records if the circuits are manual busy. It has a scan rate of 100 s.

STNMTCHF (Special tone match failures) A register for OM group STN that counts attempts to connect an idle special tone circuit to a line or trunk that fails. The value in this register is the total of first and second trial network match failures.

STNOVFL (Special tone overflow) A register for OM group STN that counts attempts to connect an idle special tone circuit to a line or trunk that overflows. The line or trunk over- flows because no circuits are available. A circuit is available if less than the maximum number of connections to that circuit are in effect at that time. The circuit is also available when the circuit is in one of the following states: - idle - initialize - call processing busy Table STN specifies the maximum number of connections to the circuit at one time.

STNSBU (Special tone system busy) A usage register for OM group STN that records if circuits are system busy. It has a scan rate of 100 s.

STNTRU (Special tone true usage) A usage register for OM group STN that records if calls connect to a special tone. It has a scan rate of 100 s.

STRMBLK (Terminating blocks - speech links) A register for OM group SOTS that counts failed attempts to find a voice path from the network to a terminating line. Register STRMBLK increases only if the failure occurs because all the line module (LM) channels to the network are busy. Register STRMBLK also increases if the network cannot link with an idle channel from the line that serves the terminating line.

STRMGSGL (Terminating ground start line glare) A register for OM group SOTS that counts failed attempts to terminate to a ground start line. The failures occur because of a glare condition. A glare condition (also known as a double seizure) occurs when the system seizes both ends of a two-way trunk at the same time.

STRMMFL (Terminating match failure) A register for OM group SOTS that counts failed attempts to find a voice path to a terminating line that fails because a network connection is not available. If the attempt is the last attempt to make a network connection, the system routes the call to network blockage heavy traffic (NBLH) treatment.

STRMNWT (Terminating network attempts) A register for OM group SOTS that counts failed attempts to find a voice path to a terminating line. The complete path consists of the following elements: - a segment through the network - a channel on the link between the line module and the network - a matching channel on the line shelf

STRMRBLK (Terminating retry blocks - speech links) A register for OM group SOTS that counts failed attempts to find a voice path from the network to a terminating line. The system routes attempts to network blockage normal traffic (NBLN) treatment.

source code Symbolic coding in its original form before being processed by a computer. The computer automatically translates source code into a code the computer can under-

2001-8.0-RFM03-0302 Glossary 243

stand.

SP Sent-Paid.

SPASSQRY (Supervisory Audio Tone Passed Query) A register for wireless OM group ICPCP that pegs when the RSSI value that was measured on the voice channel is between the delta thresholds specified in fields CONNECT and IGNORE in table PARTDATA and the idle channel RSSI, and the voice channel query passed. This indicates the ICP sent the SAT present message to the CM and the call was set up. space 1. Empty unit Transfer-Prohibited of data storage. 2. One or more blank characters. space parity Parity bit is always a digital zero (0).

SPASSQRY (Supervisory Audio Tone Passed Query) A register for wireless OM group SPASSQRY that pegs when the RSSI value that was measured on the

SPCL Speed Call Long List.

SPCS Speed Call Short List.

SPDT Special Dial Tone. special rate area A portion of an exchange that, because of a common interest factor, is allowed to dial into another exchange that is restricted to the remainder of the exchange. Usually there is a monthly charge for this special consideration.

SPF Subscriber Plant Factor.

SPF INT Subscriber Plant Factor Interstate.

SPF INT ADJ Subscriber Plant Factor Interstate Adjustment.

SPF ST Subscriber Plant Factor State.

SPFST ADJ Subscriber Plant Factor State Adjustment.

SPF Total Subscriber Plant Factor Total.

SPF Total Adjusted Subscriber Plant Factor Total Adjusted.

SPLCLREQ Special Call Request. SPLCLREQ is incremented each time an application makes a special call request. This is a one-shot request for a call from a particular queue, and the agent is not idled if no call is found. SPLCLREQ = GOTSPLCL + NOSPLCL

SPLCLRQ2 Extension register of SPLCLREQ.

SPM Settlement Per Message.

SPT Signal Transfer Point.

SREG Study Registers.

SSD Shared Secret Data

SSSC Station-to-Station Sent-Collect.

2001-8.0-RFM03-0302 Glossary 244

SSSP Station-to-Station Sent-Paid.

SSTO Start Signal Timeout.

SSZEROOP The number of calls routed to the operator via 0 during language or service selection. This number is incremented for the relevant key each time the caller dials 0 during service selection and the call is routed to the operator. This number is not incremented for prison calls.

ST 1. State. 2. Signaling Terminal.

stack A data structure from which items are removed in the reverse order from which they were inserted. For example, when a program calls a subroutine, information about how to return to the main program is usually placed on the stack. If the subroutine then calls another subroutine, information about how to return to the first subroutine is placed on the stack. Since this information is retrieved from the stack in the opposite order from which it was placed there, each subroutine returns control to the right place. Stacks are very useful for dealing with one operation nested inside another.

STARS Sample Traffic Analysis and Reports System.

start bit The first bit transmitted in the asynchronous transmission of data. The start bit, along with a stop bit (or bits), frames a transmitted character. Used to synchronize the receiver with the transmitter, a start bit signals the receiving computer that a character is to be transmitted. A start bit is always a digital one (1).

statement A set of instructions that make up one unit of a computer program.

static RAM A memory that does not need to be refreshed many times a second, as is required with dynamic RAM. It does not lose its contents as long as power to the computer is on.

station-to-station call A call placed to a particular number rather than to a specified person or department at the number.

statistical loading Number of actual characters received divided by the maximum number that could be received.

STDM Synchronous Time Division Multiplexer.

step-by-step An automatic switching system in which the call is extended progressively step-by- step to the desired terminal under the direct pulses of a subscriber’s dial or from a register sender.

STGOPEG (Shared trunk group outgoing count) A register for OM group EASHRTRK that counts outgoing calls on a shared trunk group. The register increases after the system selects an available outgoing trunk, makes an internal network connection, and seizes the trunk.

STGOVFL (Shared trunk group call attempt overflows) A register for OM group EASHRTRK that counts call attempts that overflow the last shared trunk group in the routing chain.

STGUSG (Shared trunk group connect usage) A usage register (10s scan rate) for OM group EASHRTRK that records if the trunk groups connect an end office that has an access tandem.

2001-8.0-RFM03-0302 Glossary 245

STIMEOUT (Supervisory Audio Tone Timeout) A dual mode register for wireless OM group OMMTX that pegs when the switch receives a SAT failure message (analog calls) or a DVCC failure message (digital calls) from the serving subcell druing call setup.

STKCOINS (Stuck Coins) A register for OM group LMD that counts attempts to collect or return coins that fail because the coins are stuck. This register increases when call process- ing stops an attempt to collect or return the coins. The call proceeds as if the attempt to collect or return the coin had worked. stop bit A bit that marks the end of an asynchronously transmitted character, thus framing (with the start bit) the transmitted character. Transmission of a stop bit returns the transmission circuit to its at rest or idle state, and also provides timing information tied to the baud rate. storage Place where data is held in the computer or its peripherals. store To store an item of data is to transmit the data from the computer to a memory device. stored program computer A computer that can store its own instructions as well as data.

STP Signal Transfer Point straightforward trunk A trunk between two manual switchboards arranged so that the insertion of a calling plug at the originating end will give a calling indication at the terminating end.

STRCONV A register for OM group CAINTRIG that counts the number of times the switch receives a Send To Resource message in a conversation package. string A sequence of letters, numerals, or other characters treated as a single data item. study area A telephone company’s operations within a single state. style A style of type is a particular size; either plain, boldface, or italic. subdirectory A disk directory that is stored in another directory. subgroup A subset of the total number of trunks in a group, to which only a portion of the sources have access. subgroup busy hour The hour for which the traffic load of a particular subgroup is the greatest. subscriber line or exchange line The telephone line connecting the end office to the subscriber’s station. subscriber line charge The monthly flat rate access charge paid by the end user to the local exchange carrier.

SUBSEQAT 1.The total number of subsequent name recording attempts following a first attempt. This number is incremented for the relevant key each time name recording is at- tempted after the first attempt. 2. The total number of attempts made to recognize speech after the first attempt. This number is incremented for the relevant key each time a retry attempt is made. The number of retries is determined by the values for each of the following retry parameters: Billing_No_Response, Billing_Reject_Error, or Billing_Total_Retry.

2001-8.0-RFM03-0302 Glossary 246

subset Group of items contained within a larger group.

subtending end office of an access tandem An end office that has final trunk group routing through that tandem.

subtributary office A class of tributary office which does not have direct access to its toll center, but is connected to its toll center office by means of circuits which are switched through to the toll center at another tributary office.

SUCCESS1 The number of successful recordings of names in the first attempt. This number is incremented for the relevant key each time the caller’s name is recorded on the first attempt.

SUCCSEQ The number of successful recordings of names in the second or later attempts. This number is incremented for the relevant key each time the caller’s name is recorded on a subsequent attempt. The number of attempts is determined by the following parameters in table VSN Retry Counts: Name_No_Response, Name_Format_Err, and Name_Total_Retry.

Supv, Supy Supervisor or Supervisory.

surge protector Absorbs brief bursts of excessive voltage coming in from the AC power line. These surges are created by lightning or by electric motors switching off. Early microcom- puters were easily damaged by surges, but present-day personal computers usually have adequate surge protection built in.

SUSP Service Suspended Service.

SVCE Service Circuits.

SVCMBU (Service circuit manual busy usage) A usage register (10 s scan rate) for OM group SVCT that records if service circuits are manually busy.

SVCOVFL (Service circuit overflow) A register for OM group SVCT that counts attempts to place calls on a service circuit wait queue. The system places calls on a service circuit wait queue when all service circuits are in use.

SVCQABAN (Service circuit queue abandon) A register for OM group SVCT that increases when the originator of a call goes on hook before a circuit becomes available. The system places the call on a service circuit wait queue.

SVCQOCC (Service circuit queue occupancy) A register for OM group SVCT that counts calls that the system places on the service circuit wait queue.

SVCQOVFL (Service circuit queue overflow) A register for OM group SVCT that counts calls that the system cannot place on a service circuit wait queue because the queue is full.

SVCSBU (Service circuit system busy usage) A usage register (10 s scan rate) for OM group SVCT that records if service circuits are system busy, or in the INI state.

SVCSZRS (Service circuit seizures) A register for OM group SVCT that increases when the system seizes a service circuit for use by a call.

SVCSZ2 An extension register SVCSZRS in OM group SVCT.

SVCT Service circuits. See also OM group SVCT for an extended description and list of field names.

2001-8.0-RFM03-0302 Glossary 247

SVCTRU (Service circuit traffic usage) A usage register (10 s scan rate) for OM group SVCT that records if service circuits service calls.

SVCTRU2 An extension register SVCTRU in OM group SVCT.

S/W Software.

SWAG Scientific Wild Ass Guess. switch A mechanical or solid state device which opens or closes circuits, changes operating parameters, or selects paths or circuits, either on a space or time division basis. switch access The type of access a group of circuits or subscriber lines have to another group of circuits. With full access, all circuits have access to all other circuits. When the circuits can only access certain of the other circuits on a patterned basis, the access is said to be “graded” or “limited.” switchboard A cabinet having a vertical face mounting line and trunk jacks with associated line and busy lamps, horizontal key shelf mounting cords, supervisory lamps, and keys for talking and ringing. An operator uses the cords to interconnect lines and trunks and supervise the connections. switchboard, toll A switchboard at which toll telephone connections are established, supervised, and timed. switching equipment capacity administration The purpose of switching equipment capacity administration is to assure that the installed traffic capacity is used effectively and that possible shortages of traffic sensitive components are recognized and corrected before they become service- affecting. The required functions to perform this role are basically: (1) collection of traffic usage and service data on all components, (2) calculating the traffic capacity of all components, (3) calculating traffic characteristics of the collected traffic data, (4) validating traffic characteristics, (5) stating capacity in terms of main stations or trunks, (6) tracking main station and forecasted trunk growth, and (7) planning expedient relief action on overloaded components. switchroom Part of the central office which houses the automatic switching equipment, switch- board relay equipment, associated ring and tone supplies, batteries, charging equip- ment, etc. switchtrain A series of switches or trunks that move a telephone call through an office.

SWV Service Work Volume. The amount of work time generated by calls receiving a particular service.

SXS Step-by-Step. sync Synchronous. sync character A character transmitted to establish character synchronization in synchronous communications. synchronization check A check that determines whether a particular event or condition occurs at the proper moment. synchronous A form of transmission in which groups of data bits are sent at regular uniformly

2001-8.0-RFM03-0302 Glossary 248

timed intervals. Unlike asynchronous transmission, synchronous transmission does not require start or stop bits.

syntax A set of rules governing the structure of a programming language and its expressions. Syntax rules are like grammar rules. If a program violates the language syntax rules, a syntax error occurs.

SYSABDN (System originations abandoned) A register for OM group OTS that counts system- generated calls that are abandoned before they connect to a terminating line, outgoing trunk, tone, announcement, lockout status, or feature activation or deacti- vation.

SYSFSET (System originations to custom calling features) A register for OM group OTS that counts system-generated calls that activate or deactivate a custom calling feature. Note: This Register does not increase in DMS-300 international offices.

SYSLKT (System originations to lockout) A register for OM group OTS that counts system- generated calls that fail to connect or receive a treatment and that route to lockout.

SYSOP System Operator. The person who manages a bulletin-board system.

SYSOUT (System to outgoing connections) A register for OM group OTS that counts system- generated calls that connect to an outgoing trunk.

system access code Characters or numbers used to identify a user to a computer system.

system busy The status of trunk circuits that have failed the tests performed by automatic trunk testers and have been taken out of service pending testing by maintenance personnel.

SYSTRM (System to terminating connections) A register for OM group OTS that counts system-generated calls that terminate to a line, and connection to busy tone termina- tions.

SYSTRMT (System to treatment) A register for OM group OTS that counts system-generated calls that route to a tone or an announcement because of an error condition.

SZ Seizure.

table Set of data arranged as an array (or matrix).

tabulator A device that receives data on automatically ticketed calls from a ticketer, sorts the information into a proper format, and transfers it onto paper or magnetic tape for processing.

tandem 1. An incoming call which does not terminate locally. 2. The generic term that describes trunk-to-trunk switching of concentrated traffic.

TANDEM (Tandem) A register for OM group TRK that counts incoming calls on a trunk group that first routes to an outgoing trunk group. Register TANDEM increases before the system determines if the outgoing trunk group is busy, or if a junctor path is avail- able. The system generates this register for office types that are correct, except OFF300.

tandem area The general area served by the local offices having direct trunks to or from the tandem office. This area may consist of one or more communities or may include only a portion of a relatively large city.

2001-8.0-RFM03-0302 Glossary 249 tandem completing A trunk group from a local tandem switching machine to an end office (Class 5). Local tandem switching machine includes those end offices used as tandem equip- ment arrangements. tandem connection A call switched at a tandem office. tandem office A major switching center linking together end offices particularly in densely settled areas where it is not economical to provide direct interconnection between all end offices. tandem originating A trunk group from an end office (Class 5) to a local tandem switching machine. A local tandem switching machine includes those end offices used as tandem equip- ment arrangements. tandem trunk A general classification of trunks between a tandem central office and any other central office or exchange. May carry first route or overflow traffic from the originat- ing end office. Also, a trunk between end offices which can be used to pass traffic to other end offices.

TAP Transmission Level Point. tape Magnetic medium for data storage. tape drive A device that converts information stored on magnetic tape into signals that can be sent to a computer. target 1. The target is the place to which information is supposed to be copied (e.g., the “target disk” when copying disks). 2. A target is something that is being searched for (as when searching for a word in a document). tariff In data communications, the published rate for a specific unit of equipment, facility, or type of service provided by a communications common carrier. task Single unit of work for a central processing unit.

TB Timeout Before Dialing.

TBBS Popular program for implementing bulletin-board systems.

TBU0 A usage register (default scan rate of 100 s) for OM group TRA640M1 that counts records when a line processes calls. Parameter TRA640M1_SCAN_RATE in table OFCVAR specifies the scan rate.

TBU1 A usage register (default scan rate of 100 s) for OM group TRA250M1 that counts records if a line processes calls. Parameter TRA250M1_SCAN_RATE in table OFCVAR specifies the scan rate.

TBU2 A usage register (default scan rate of 100 s) for OM group TRA125M1 that counts records if a line processes calls. Parameter TRA125M1_SCAN_RATE in table OFCVAR specifies the scan rate.

TBU3 A usage register (default scan rate of 100 s) for OM group TRA125M2 that counts records if a line processes calls. Parameter TRA125M2_SCAN_RATE in table OFCVAR specifies the scan rate.

TC 1. Toll Center. 2. See Toll Completing.

2001-8.0-RFM03-0302 Glossary 250

TCA Toll Center Area. The dial offices served from a toll center on outward toll calls.

TCABORT A register for OM group TCAPUSAGE that counts the TCAP messages sent or received that contain the package type Abort.

TCCNPERM A register for OM group TCAPUSAGE that counts the TCAP messages that the system sends or receives that contain the package type Conversation Without Permission. A message with this package type continues a transaction. The message informs the receiving node that the node cannot end the transaction normally. Each message contains one TCAP package. Conversation packages always associate with a transac- tion.

TCCWPERM A register for OM group TCAPUSAGE that counts TCAP messages that the system sends or receives that contain package type Conversation With Permission. A mes- sage with this package type continues a transaction. The message informs the receiving node that the node may end the transaction normally. Each message contains one TCAP package. Conversation packages always associate with a transac- tion.

TCDPUSE A register for OM group TCAPUSAGE that counts incoming and outgoing TCAP messages that contain a dialogue portion.

TCINVKL A register for OM group TCAPUSAGE that counts Invoke Last components that the system sends or receives. An Invoke component initiates an operation on a remote node. Invoke Last indicates that additional replies do not follow. There can be several components in each package.

TCINVKNL A register for OM group TCAPUSAGE that counts Invoke Not Last components that the system sends or receives. An Invoke component initiates an operation on a remote node. An Invoke Not Last component indicates that additional replies follow. There can be several components in each package.

TCD Traffic Channel Designation.

TCMANCT (Machine intercept (ANCT) treatment) A register for OM group TRMTCM that counts calls that the system routes to ANCT treatment. The system routes the calls to treatment because the directory number that the caller dials is not connected. The directory number that the caller dials is out of service. The DMS-100 local, DMS- 100G, international, and DMS-100/200 local/toll offices use this register.

TCMANTO (Answer timeout (ANTO) treatment) A register for OM group TRMTCM for DMS-MTX offices that counts calls that the system routes to ANTO treatment. The system routes the call to treatment because the called party did not answer before ANTO.

TCMATBS (Attendant busy (ATBS) treatment) A register for OM group TRMTCM that is not in use. The system handles Meridian Digital Centrex (MDC) treatments in table AUDIO.

TCMATDT (Audio tone detector timeout (ATDT) treatment) A register for OM group TRMTCM for DMS-250 tandem offices that counts calls that the system routes to ATDT treatment because a calling subscriber remained off-hook. The calling subscriber remained off-hook long enough for the audio tone detector default timer to time out. The system disconnects calling subscriber on the completion of the treatment, and the system does not bill the call.

TCMBLDN (Blank directory number (BLDN) treatment) A register for OM group TRMTCM that counts calls that the system routes to BLDN treatment. The system routes the calls to treatment when the caller dials a directory number the system did not assign.

2001-8.0-RFM03-0302 Glossary 251

TCMCBTN (Clearback tone (CBTN) treatment) A register for OM group TRMTCM that counts calls that the system routes to CBTN treatment for reasons the licensee assigns. This register supports the integration of software loads that are licensee-specific.

TCMCFWV (Variable call forwarding verification (CFWV) treatment) A usage register for OM group TRMTCM that counts calls that the system routes to variable CFWV treatment. The system routes the call to treatment because a subscriber with the Variable Call Forwarding feature dials the activation code. The subscriber dials the call forwarding activation code while call forwarding is already active on a line. It is a usage register for DMS-100 local, and DMS-100/200 local/toll offices.

TCMCHAF (Changed 800 number forward (CHAF) treatment) A Canada-only usage register for OM group TRMTCM that counts calls that the system routes to CHAF treatment for originating screening office with enhanced 800 service. The system routes calls to treatment because the response from the operating company (Bell Canada) database is Changed 800 Number - Treatment 2. The system routes the calling subscriber to national directory assistance.

TCMCHAN (Changed 800 number announcement (CHAN) treatment) A Canada-only register for OM group TRMTCM for originating screening offices with enhanced 800 service that counts calls calls that the system routes to CHAN announcement treatment . The system routes calls to treatment because the response from the operating company (Bell Canada) database is Changed 800 Number-Treatment 1. The system routes the calling subscriber to an announcement that states the dialed 800 number has changed. The announcement advises the subscriber to check the number before the subscriber dials again.

TCMCNAD (Call not allowed (CNAD) treatment) A usage register for OM group TRMTCM that counts calls that the system routes to CNAD treatment. For example, for private virtual network calls, TCMCNAD counts calls that the system routes to CNAD treatment. The system routes the calls to treatment because the calling party does not have access to a database.

TCMDISC (Disconnect timing (DISC) treatment) A register for OM group TRMTCM that counts calls calls that the system routes to DISC treatment. The system routes the calls to treatment for one of the following reasons: - the subscriber fails to go on-hook within 10 s after the other party terminates the call - the call disconnects by force from a centralized automatic message accounting (CAMA) position that a non-TOPS switching office serves - the called party does not answer a direct dialing overseas call within 5 min of set up - an origination (caused by a hardware failure) comes from an outgoing emergency service office (911) trunk TCMNC8F (Network control system (NCS) 800 service failure (NC8F) treatment) A register for OM group TRMTCM that counts calls that the system routes to NC8F treatment for DMS-250 tandem offices. The system routes the calls to treatment because an NCS 800 service failure occurs for one of the following reasons: - 800 number not found (action code 20) - 800 number out of band (action code 21) - 800 number not in service (action code 22)

TCMNCREJ (Call rejected (NCREJ) treatment) A register for OM group TRMTCM that counts calls that the system routes to CREJ treatment. For example, for integrated services digital network (ISDN), TCMNCREJ counts calls that the system routes to CREJ treatment. The system routes the call to treatment because a functional terminal rejects the call.

2001-8.0-RFM03-0302 Glossary 252

TCMSGIN A register for OM group TCAPUSAGE that counts the transactions that terminate at the remote network. The system can terminate a transaction without receiving a message. Not all received messages associate with a transaction.

TCMSGOUT A register for OM group TCAPUSAGE that counts TCAP messages. Each transaction consists of a minimum of one message that the system sends to a remote network node. Not all sent messages associate with a transaction.

TCMNTRS (No terminal responding (NTRS) treatment) A register for OM group TRMTCM that counts when the system routes a call to NTRS treatment. For example, for integrated services digital network (ISDN), TCMNTRS counts calls that the system routes to CREJ treatment. The system routes the call to treatment because an operating terminal does not respond to a call.

TCMN9DF (Network Control System (NCS) 900 database failure (N9DF) treatment) A register for OM group TRMTCM that counts calls that the system routes to N9DF treatment for TANDEM offices. The system routes the calls to treatment because the 900 number dialed is not in the NCS database. The subscriber receives an announcement or reorder tone to indicate that the system cannot complete the 900 call as dialed.

TCMN9NS (Network Control System (NCS) 900 not in service (N9NS) treatment) A register for OM group TRMTCM that counts calls that the system routes to N9NS treatment for DMS-250 tandem offices. The system routes the calls to treatment because the 900 number that the caller dials is not in service. The subscriber receives an announce- ment or reorder tone to indicate that the system cannot complete the 900 call as dialed.

TCMN9OB (Network Control System (NCS) 900 out-of-band (N9OB) treatment) A register for OM group TRMTCM that counts calls that the system routes to N9OB treatment for DMS-250 tandem offices. The system routes calls to treatment because the 900 number that the caller dials is not accessible from the calling area. The subscriber receives an announcement or reorder tone. The announcement or tone indicates that the 900 call is out of band from where the call originated.

TCMOPRT (Regular operator intercept (OPRT) treatment) A register for OM group TRMTCM that counts calls that the system routes to the operator for DMS-100 local and DMS-100/ 200 local/toll offices. The system routes the calls to the operator because the system disconnects directory number dialed. The system also routes the calls to the operator because the number is out of service.

TCMOSVR (Operator services voice response (OSVR) treatment) A register for OM group TRMTCM that counts calls that the system routes to OSVR treatment for one of the following reasons: - on a directory assistance Operator Number Identification call, the operator entered the calling number at the AOSS console. The operator searched for the requested directory number. The operator connected the subscriber to the audio response unit (ARU) for voice response. - on a directory assistance automatic number identification (ANI) call, the ANI equipment provides the calling number to the DMS switch. The operator searched for the requested directory number, and connected the subscriber to the ARU for voice response. - on an operator-handled intercept call, the operator collected the called number. The operator initiated a search for a possible new number, and connected the subscriber to the ARU for voice response. The system routes the AOSS call to an internal or external ARU. The system can connect the subscriber to the operator again. The system can connect the subscriber if the subscriber stays on the line after the subscriber listens to the announcement.

2001-8.0-RFM03-0302 Glossary 253

TCMPDIL (Partial dial timeout (PDIL) treatment) A register for OM group TRMTCM that counts calls the system routes to PDIL treatment. The system routes calls to treatment because the system received at least one digit, but not enough digits to complete the call. The system can receive a multifrequency (MF) key pulse signal on a call on an MF trunk. If the system receives the key pulse signal, the system routes the call to PDIL treatment. Offices that use this register: DMS-100 local, DMS-100G, interna- tional, DMS-200 toll, DMS-100/200 local/toll, DMS-250 tandem, and DMS-MTX.

TCMPSIG (Permanent signal timeout (PSIG) treatment) A register for OM group TRMTCM that counts calls that the system routes to PSIG treatment. The system routes calls to treatment because the system does not receive digits before timeout. When the system receives distorted signals, the system routes the calls to reorder (RODR) treatment. For DMS-300 gateway offices, TCMPSIG counts calls that the system routes to PSIG treatment. The system routes a call incoming on an R1 signaling trunk to PSIG treatment for one of the following reasons: the system receives a key pulse (KP) signal that is not correct during digit collection, the receiver times out while the receiver waits for digits during digit collection, or KP1 or KP2 signals are not present during translation verification. The system routes a call incoming on a private line or an international 101 test line to PSIG treatment. The system routes the call to treat- ment if the receiver times out while the receiver waits for digits during digit collec- tion. For DMS-250 tandem and DMS-MTX offices, TCMPSIG counts calls that the system routes to PSIG treatment. The system routes a call originating on an incoming or two-way trunk to PSIG treatment. The system routes a call to treatment because the caller does not dial digits in the period specified. Trunk subgroup parameter PSPDSEIZ specifies the period.

TCMRING (No terminal responding-release call (RING) treatment) A register for OM group TRMTCM that counts calls that the system routes to RING treatment. The system routes an ISDN user part to basic rate access (ISUP-to-BRA) call to RING treatment when: timer T310 expires, the originator of the call is an ISDN party or the audible ringing is not already in progress for the call. This register is for DMS-100 local and DMS-100/200 local/toll offices.

TCMTDBR (Test desk bridged (TDBR) treatment) A register for OM group TRMTCM that counts calls that the system routes to TDBR treatment. The system routes the calls to treatment for one of the following reasons: * An AT&T mechanized loop tester connects to a line that has one of these options activated: — suspended service (SUS) — remote suspended service (RSUS) — plug up (PLP) — remote make busy (RMB) * The test desk closes the tip and ring loop, or the line goes off-hook. A No. 14 local test desk signaling type trunk (trunk group type TD) connects in idle bridge mode to a line. This line has one of the options SUS, RSUS, PLP, or RMB activated.

TCMTRBL (Trouble intercept (TRBL) treatment) A register for OM group TRMTCM that counts calls that the system routes to TRBL treatment. The system routes the calls to treat- ment for one of the following reasons: - An incoming operator (trunk group type IO) originates a check call to a busy line that has the plug-up (PLP) option. The PLP option is assigned in table LENLINES or IBNLINES. - A test desk (trunk group type TD) position tries to use a directory number dialing to post a line. The line has the PLP option assigned in table LENLINES or IBNLINES. - A call originates from a line or trunk to a line that has the PLP option assigned in table LENLINES or IBNLINES.

2001-8.0-RFM03-0302 Glossary 254

TCMUNDN (Unassigned directory number (UNDN) treatment) A register for OM group TRMTCM that counts calls that the system routes to the UNDN treatment. The system routes the calls to treatment because, for the digits dialed, the operating company specifies treatment UNDN. Treatment UNDN is in field TRMT in table THOUGRP, AVTHGRP, or WRDN. For DMS-300 gateway offices, TCMUNDN counts calls that the system routes to treatment UNDN. The system routes the following calls to treatment: - calls incoming on a private line - calls incoming on an R1 signaling trunk - calls incoming on an international 101 test line - calls outgoing on a No. 6 signaling trunk The system routes the calls to treatment UNDN if the terminating exchange determines the national number received is not in use. While the call connects, the system determines the number is not in use. The system must reach the subscriber by another number. The DMS-100 local, international, DMS-200 toll, and DMS-100/200 local/toll offices use the register TCMUNDN.

TCMUNDT (Unidentified (UNDT) treatment) A register for OM group TRMTCM for DMS-100 local, DMS-200 toll, DMS-100/200 local/toll, and DMS-MTX offices, UNDT is the default value for entries in field TREAT. Field TREAT is in tables CLSVSCRC and PFXTREAT when treatment is not required.

TCMUPAB (Universal public access blocked (UPAB) treatment) A register for OM group TRMTCM that counts calls that the system routes to UPAB treatment. Universal public access includes telephones for use without coins, coin telephones, and hotel/motel tele- phones.

TCMVACS (Vacant speed number (VACS) treatment) A register for OM group TRMTCM for DMS-250 tandem offices that counts calls that the system routes to VACS treatment. The system routes calls to treatment because the number has a speed number format but is not in the database.

TCMVACT (Vacant code (VACT) treatment) A register for OM group TRMTCM for DMS-100 local, DMS-100G, international DMS-200 toll, and DMS-100/200 local/toll offices use register TCMVACT. Register TCMVACT counts calls that the system routes to VACT treatment for one of the following reasons: * A line dials: — a toll terminating center code — an operator code — a terminating inward wide area telephone service (INWATS) number — a tandem INWATS number — a numbering plan area (NPA) + NPA code — a number that is specified in sub-table FNPACODE as unauthorized central- ized automatic message accounting (CAMA) * A line or trunk dials a country code that is not assigned. * The system does not specify data in table INWORICN for an originating INWATS call. * For an originating INWATS call, the system does not specify a terminating service office code in table INWORICN. The code is for the NXX code and the area code N0/1 Xdialed. The system does not specify a code when the originating screening office is also the terminating screening office. * On a terminating INWATS call, the system does not specify data in table INWTERCN for the incoming digits. * On a station ringer call, the last four digits do not match those of the calling line. The system defines the call as no-prefix local. * A blue box fraud call is cut off. * A call is a line or operator-to-test-line call.

2001-8.0-RFM03-0302 Glossary 255

* The originator fails to dial the single-party direct-dial digit. * The originator fails to dial enough digits on speed calling or call forwarding updates. * The originator attempts to place a three-way call to an automatic number announcement, an outgoing service desk, or a revertive call. For DMS-300 gateway offices, TCMVACT counts calls that the system routes to VACT treatment.

TCMVCCT (Vacant country code (VCCT) treatment) A register for OM group TRMTCM for DMS- 250 tandem offices that counts calls that the system routes to VCCT treatment. If the network system is not datafilled for country code dialing, the system routes an international direct distance dialing call to VCCT treatment.

TCMVPFX (Vacant prefix code (VPFX) treatment) A register for OM group TRMTCM that counts calls that receive VPFX treatment because the prefix digits a subscriber dials are not datafilled.

TCP/IP 1. Transmission Control Protocol/Internet Protocol. 2. See Transport Control Protocol/Interface Program.

TCQNPERM A register for OM group TCAPUSAGE that counts TCAP messages that the system sends or receives, that have the package type Query Without Permission. This package type initiates a transaction and informs the destination node that the node may not terminate the transaction normally. Each message has one TCAP package. Outgoing query packages associate with a transaction. Incoming packages do not associate with a transaction.

TCQWPERM A register for OM group TCAPUSAGE that counts TCAP messages that the system sends or receives, that have package type Query With Permission. This package type initiates a transaction and informs the destination node that the node can end the transaction normally. Each message contains one TCAP package. Outgoing query packages associate with a transaction. Incoming query packages do not associate with a transaction.

TCREJECT A register for OM group TCAPUSAGE that counts Reject components that the system sends or receives. The system sends the Reject component in reply to a message or component that contains a protocol error. There can be several components in each package.

TCRESPNS A register for OM group TCAPUSAGE that counts TCAP messages that the system sends or receives that contain the package type Response. This package type ends the transaction normally. Each message contains one TCAP package. Response packages always associate with a transaction.

TCRSLTL A register for OM group TCAPUSAGE that counts Return Result Last components that the system sends or receives. The system sends a Return Result component in reply to an Invoke component whose operation is completed. Return Result Last indicates that no additional result components follow.

TCRSLTNL A register for OM group TCAPUSAGE that counts Return Result Not Last components that the system sends or receives. The system sends a result component in reply to an Invoke component whose operations complete. Return Result Not Last indicates that no additional replies follow.

TCRTERR A register for OM group TCAPUSAGE that counts components of type Return Error that the system sends or receives. The system sends an error component in reply to an Invoke component that has an operation that failed. There can be several compo-

2001-8.0-RFM03-0302 Glossary 256

nents in each package.

TCUAARD (Automatic number identification (ANI) account recently disallowed) A register for OM group TRMTCU2 that increases when the system routes a call to ANI account recently disallowed (AARD) treatment. The system routes the call to treatment if the ANI status is recently disallowed.

TCUADBF (Automatic number identification database failure (ADBF) treatment) A register for OM group TRMTCU for DMS-250 tandem offices that counts calls that the system routes to treatment ADBF. The system routes the calls to treatment because call processing cannot find the ANI of the subscriber in the database.

TCUANBB (Automatic number identification (ANI) feature group B blockage (ANBB) treatment) A register for OM group TRMTCU2 for DMS-250 tandem offices that counts calls that the system routes to ANBB treatment. The system routes a call to ANBB treat- ment if a call without a correct ANI attempts to access feature group B trunks. The system blocks the ANI that is not correct in table ANISCRNU.

TCUANIA (Automatic number identification account status not allowed (ANIA) treatment) A register for OM group TRMTCU for DMS-250 tandem and DMS-300 gateway offices that counts calls that the system routes to treatment ANIA. The system routes calls that originate on a trunk to treatment ANIA if the system cannot find ANI in the database. The system also routes these calls to treatment if the database is set to block calls that come from that ANI.

TCUCACE (Carrier access coded in error (CACE) treatment) The DMS-100 local, DMS-200 toll, and DMS-100/200 local toll end offices with equal access use register TCICACE. This is a register for OM group TRMTCU that counts calls that the system routes to treatment CACE. The system routes the calls to treatment because the dialed carrier access code 10XXX is empty or has changed.

TCUBBFS (Blue box fraud screening (BBFS) treatment) A register for OM group TRMTCU2 for DMS-250 tandem offices that counts calls that the system routes to BBFS treatment.

TCUBCNI (Bearer capability not implemented (BCNI) treatment) A register for OM group TRMTCU2 for DMS-100 local and DMS-100/200 local/toll end offices that counts calls that the system routes to BCNI treatment. The system routes the calls to treat- ment because bearer capability checking fails at the terminating interface.

TCUCACB (Carrier access code blocked (CACB) treatment) A register for OM group TRMTCU2 for DMS-100/200 local/toll end offices with equal access, this register counts calls that the system routes to CACB treatment. The system routes the calls to treatment because the system blocks dialed carrier access code (CAC) calls. The system blocks CAC calls for one of the following reasons: - The carrier has chosen to not handle CAC calls. - The carrier only handles traffic from customers that make the accessed carrier their primary inter-LATA carrier.

TCUCCCF (TOPS carrier call completion failure (CCCF) treatment) A register for OM group TRMTCU2 for DMS-100/200 local/toll switching offices with TOPS and DMS-200 toll switching offices with TOPS. It counts calls that the system routes to TOPS CCCF treatment. The system routes the calls to treatment because the selected first and alternate carrier cannot complete the TOPS carrier call.

TCUCCIR (Credit card invalid release (CCIR) treatment) A register for OM group TRMTCU2 that counts calls that the system routes to CCIR treatment because the credit card used is invalid.

2001-8.0-RFM03-0302 Glossary 257

TCUCCNA (Calling card not allowed (CCNA) treatment) A register for OM group TRMTCU2 for DMS-250 offices that counts calls that the system routes to CCNA treatment. In an international DMS-250 tandem office with the Credit Card Calling feature, the system routes a call to CCNA treatment. The system routes the call to treatment when the system assigns a credit card number as ABUSED in table CCTAB. The system takes the call down after the application of this treatment.

TCUCCNV (Calling card invalid (CCNV) treatment) A register for OM group TRMTCU2 for DMS- 250 offices that counts calls that the system routes to CCNV treatment. In a DMS- 250 tandem office with the Mechanized Calling Card Service (MCCS) feature, the system routes a call to CCNV treatment if the travel card number (TCN) is invalid. The subscriber has one more opportunity to enter a correct TCN. The system routes the call to an announcement. In an international DMS-250 office with the Credit Card Calling feature, the system routes a call to CCNV treatment. The system routes the call to treatment if a credit card authorization code does not match the authori- zation code the subscriber filed against the card.

TCUCGFL (Closed User Group failure (CGFL) treatment) A register for OM group TRMTCU2 for DMS-300 gateway offices that counts calls that the system routes to CGFL treatment. The system routes the calls to treatment if the call is not an authorized attempt to use Closed User Group Service. The service screening determines if the call is authorized. Service screening by destination is an option available on DMS-300 gateway switches. The feature checks that each call only uses those services that are allowed at the destination.

TCUCNAC (Call not accepted (CNAC) treatment) A register for OM group TRMTCU2 for offices with ISDN that counts calls that the system routes to CNAC treatment. The system routes the calls to treatment because the bearer capability of the originator is not compatible with that of the terminator.

TCUCNDT (Coin denied termination (CNDT) treatment) The DMS-100 local, DMS-100/200 local toll, DMS-250 tandem, and DMS-MTX offices use register TCUCNDT. This is a register for OM group TRMTCU that counts calls that the system routes to treatment CNDT. The system routes a call that originates on a line or trunk to treatment CNDT. The system routes the call to treatment if the coin line directory number has the denied terminating (DTM) option assigned. The system dials the coin line directory number. This register does not increase in GL04.

TCUCNOT (Coin overtime (CNOT) treatment) A register for DMS-100 local and DMS-100/200 local toll offices, that counts calls that the system routes to treatment CNOT. A DMS office can have the Local Coin Overtime Charging feature BR0372. The system routes a call that originates on a coin line in a DMS office with this feature to treatment CNOT. The system routes the call to treatment if the called did not deposit coins for the overtime period. If the DMS office does not have feature BR0372, the system routes the call to overflow or like tone.

TCUCOSX (Class of service exceeded (COSX) treatment) A register for OM group TRMTCU2 for DMS-250 tandem offices that counts calls that the system routes to COSX treatment. The system routes the calls to treatment because the call failed class-of-service screening.

TCUD950 (Dial 950 (D950) treatment) A register for OM group TRMTCU for DMS-100 local, DMS-200 toll, and DMS-100/200 local toll end office with equal access use register TCUD950. This register counts calls that the system routes to the treatment D950. The system routes the calls to treatment because the subscriber dials the carrier code 10XXX instead of 950-1XXX.

2001-8.0-RFM03-0302 Glossary 258

TCUDACD (Dial carrier access code (DACD) treatment) A register for OM group TRMTCU for DMS-100 local, DMS-200 toll, and DMS-100/200 local toll end office with equal access feature use register TCUDACD. Register TCUDACD counts calls that the system routes to treatment DACD. The system routes the calls to treatment because the subscriber did not dial the required carrier access code 10XXX.

TCUDCFC (Disallowed coin free call (DCFC) treatment) A register for OM group TRMTCU for DMS-100 local and DMS-100/200 local toll offices that counts calls that the system routes to treatment DCFC. The system routes a call that originates on a coin free line to treatment DCFC. The system routes the call to treatment if the call originator dials a call other than an operator assisted (0+) call. The system also routes a call to treatment if the call originator dials a call other than a three-digit service code.

TCUDNTR (Denied terminating (DNTR) treatment) A register for OM group TRMTCU for DMS- 100 local, DMS-100G, international, and DMS-100/200 local toll offices use register TCUDNTR. Register TCUDNTR counts calls that the system routes to treatment DNTR. The system routes a call that originates on a line or trunk to treatment DNTR. The system routes the call to treatment if the non-coin line directory number has the denied terminating (DTM) option. The subscriber dials the non-coin line directory number. This register does not increase in GL04.

TCUDODT (Denied originating data terminal (DODT) treatment) A register for OM group TRMTCU for DMS-100 local, DMS-200 toll, DMS-100/200 local toll, and DMS-300 gateway offices that counts that the system routes to treatment DODT. The system routes the calls to treatment because a data unit attempts to originate a call. The data unit attempts to originate a call when the RS-232 data terminal ready (DTR) lead was not on.

TCUEROR (Enhanced roamer validation (ERV) originator treatment) A register for OM group TRMTCU2 that increases when the tumbling electronic serial number (TESN) process of the ERV system finds an invalid originating mobile. When the clearinghouse, which provides the ERV services, identifies an originating mobile as fraudulent, this treatment is set.

TCUERTO (Enhanced roamer validation (ERV) timeout treatment) A register for OM group TRMTCU2 that increases when a cellular call times out while waiting for a response from a clearinghouse. The clearinghouse provides real-time positive roamer validation services and maintains a positive subscriber database.

TCUERTR (Enhanced roamer validation (ERV) terminator treatment) A register for OM group TRMTCU2 that increases when the tumbling electronic serial number (TESN) process of the ERV system finds an invalid terminating mobile. When the clearinghouse, which provides the ERV services, identifies a terminating mobile as fraudulent, this treatment is set.

TCUESNF (Customer unauthorized electronic serial number (ESN) fraud treatment) A register for OM group TRMTCU2 that increases when the subscriber makes a call attempt from a mobile (originating call) with a false manufacturer ESN code. The datafill in table ESN FRAUD determine if a manufacturer ESN code is false. The register increases when the system blocks the call. This event causes the originator to receive the ESNF treatment. If a subscriber uses a mobile with a false manufacturer ESN code to make an E911 call. The system does not block the call. The ESNF treatment does not apply, and register TCUESNF does not increase.

TCUFDNZ (First digit not zero (FDNZ) treatment) A register for OM group TRMTCU for DMS- 250 tandem offices that counts calls that the system routes to treatment FDNZ. The

2001-8.0-RFM03-0302 Glossary 259

system routes a travel card number (TCN) call reorigination to the FDNZ treatment. The system routes the TCN call to treatment if the first digit of the address digits is not zero. The subscriber has one more opportunity to dial the called number cor- rectly. The system routes the call to the announcement.

TCUFNAL (Feature not allowed (FNAL) treatment) A register for OM group TRMTCU for DMS- 100 local, DMS-100G, international, DMS-200 toll, DMS-100/200 local toll, and DMS-MTX offices that counts calls that the system routes to treatment FNAL. The system routes the calls to treatment because a subscriber dials the feature activation digits of a requirement calling feature. The requirement calling feature is not assigned to the line of the subscriber.

TCUGFNV (FONCARD not-valid treatment) A register for OM group TRMTCU2 that increases when the system routes a call to the global fiber optic network card (FONCARD) not- valid treatment. The system routes the call to treatment when the global FONCARD is not correct. The global FONCARD is not correct because the global FONCARD is not datafilled, or is datafilled as invalid at the service control point.

TCUHNPI (Home number plan area (NPA) intercept (HNPI) treatment) A register for OM group TRMTCU for DMS-100 local, DMS-200 toll, DMS-100/200 local toll, and DMS-MTX offices that counts calls that the system routes to treatment HNPI. The system routes a call that originates on a line or trunk to treatment HNPI. The system routes the calls to treatment if the call originator dials the home NPA. The call originator dials the home NPA when the system does not permit home NPA dialing.

TCUIDPB (International direct distance dialing (IDDD) prohibited (IDPB) treatment) A register for OM group TRMTCU2 for DMS-250 tandem offices that counts calls that the system routes to IDPB treatment. The system routes an IDDD call to IDPB treatment. The system routes the call to treatment if the call originates from a subscriber that cannot use an IDDD destination number. The authorization code or automatic number identification (ANI) database of the subscriber specifies that the subscriber cannot use this IDDD number.

TCUILRS (Inter-LATA restriction (ILRS) treatment) A register for OM group TRMTCU for DMS- 100 local, DMS-200 toll, and DMS-100/200 local toll end office with equal access use register TCUILRS. Register TCUILRS counts calls that the system routes to the treatment ILRS for one of the following reasons: - A line with the inter-LATA toll denied (ITD) option attempts to originate an inter-LATA call. - A line with the carrier toll denied (CTD) option attempts to use a carrier to originate a toll call. The system completes or blocks the call to a carrier and sends the call to the inter-LATA restricted treatment. The decision to block a call to a carrier with the carrier toll denied option assigned depends on the call characteris- tics. The call characteristics are as follows: - The system completes a (10XXX) 0 + 7/10 digit operator assisted call. If the call is direct dial, the system routes the call to treatment ILRS. - The system completes a (10XXX) 011+ CC + NN operator assisted call. If the call is direct dial, the system routes the call to treatment ILRS. - The system completes a 10XXX + 0 direct dial call. - The system routes a 10XXX + # direct dial call to treatment ILRS. - The system completes a 1 + 800 + 4 digit direct dial call. - The system routes a 950 + 1XXX direct dial call to treatment ILRS. - The system routes a (10XXX) 1 + NPA + 555 + 4 digit direct dial call to treatment ILRS. If the system routes the call to the inter-LATA restriction treatment, the system routes the call to an announcement.

2001-8.0-RFM03-0302 Glossary 260

TCUINAC (Invalid account code (INAC) treatment) A register for OM group TRMTCU for DMS- 250 tandem offices that counts calls that the system routes to treatment INAC. The system routes a call that requires account code validation to treatment INAC. The system routes the call to treatment if the account code dialed is invalid for that trunk group.

TCUINAU (Invalid authorization code (INAU) treatment) A register for OM group TRMTCU for DMS-250 tandem offices that counts calls that the system routes to treatment INAU for one of the following reasons: - authorization code that the system dials was invalid - subscriber did not dial the authorization code in a correct city of origin - security code digits that the subscriber dials with the authorization code did not match the security code digits. The system stores the security digits against the authorization code

TCUINCC (Invalid city code (INCC) treatment) A register for OM group TRMTCU2 for DMS-250 tandem offices, register TCUINCC counts calls that the system routes to INCC treatment. The system routes the calls to treatment because the caller dialed an invalid city code.

TCUINPD (Invalid personal identification number digit (INPD) treatment) A register for OM group TRMTCU2 for DMS-250 tandem offices that counts calls that the system routes to INPD treatment. The system routes the calls to treatment because the personal identification number (PIN) digits do not match. The subscriber dials the PIN digits which do not match the authorization code database.

TCUITCF (Information transfer capability failed (ITCF) treatment) A register for OM group TRMTCU2 for DMS-300 gateway offices that counts calls that the system routes to ITCF treatment. The system routes the calls to treatment because of an information transfer capability value that is not correct.

TCUITDN (Treatment international toll denied) A register for OM group TRMTCU2 increases when the system applies treatment International Toll Denied.

TCUIVCC (Invalid corridor call (IVCC) treatment) An equal access usage register for OM group TRMTCU2 for DMS-100 local and DMS-100/200 local/toll end offices that counts calls that the system routes to IVCC treatment. The system routes a call to IVCC treatment when a subscriber attempts to make an inter-LATA call. The call is outside the inter-LATA corridor of the operating company.

TCUJACK (Justified alternate calling knowledge (JACK) treatment) A register for OM group TRMTCU2 for DMS-250 tandem offices that counts hotel calls that the system routes to JACK treatment. The system routes the call to treatment because the call fails line information database (LIDB) verification twice. The JACK treatment can route to an announcement, tone, or terminating trunk.

TCULCAB (Local call area barred (LCAB) treatment) A register for OM group TRMTCU2 for DMS-250 tandem offices that counts calls that the system routes to LCAB treatment. The system routes a local call to LCAB treatment if the call attempts to use a carrier. Carriers cannot complete calls that originate and terminate in the same local calling area.

TCULCNV (Local exchange carrier (LEC) calling card not valid (LCNV) treatment) A register for OM group TRMTCU2 for DMS-250 tandem offices that counts calls that the system routes to LCNV treatment. The system routes the calls to treatment because a subscriber enters an LEC calling card number that is not correct. An announcement prompts the subscriber to enter a correct number. For LEC calling card calls, the

2001-8.0-RFM03-0302 Glossary 261

system does not access table TMTCNTL. To receive a credit-card invalid announce- ment, the user must enter LCNV treatment in table MCCSANNS.

TCUMSCA (Misdirected CAMA call (MSCA) treatment) A register for OM group TRMTCU for DMS-100 local, DMS-200 toll, DMS-100/200 local toll, and DMS-MTX offices that counts the calls that the system routes to treatment MSCA for one of the following reasons: - A local call attempted to use the toll network but the system did not permit the attempt. - A subscriber dialed a prefix digit 0 or 1 on a local call.

TCUMSLC (Misdirected local calls (MSLC) treatment) A register for OM group TRMTCU used by the DMS-100 local, DMS-100G, DMS-100/200 local toll, DMS-250 tandem, and DMS-MTX offices that counts calls that the system routes to treatment MSLC for one of the following reasons: - A line attempted to originate an operator-assisted call (0+) to codes NPA555, 555, or 800. - The last four digits on a station ringer call do not match those of the calling line. The call is not defined as no-prefix local in the local calling area (LCASCRCN) and prefix treatment (PFXTREAT) tables. - The subscriber does not dial a prefix digit 0 or 1 on a toll call. The prefix treat- ment (PFXTREAT) table specifies that the system requires a prefix digit on toll calls.

TCUN00B (N00 call blocked (N00B) treatment) A register for OM group TRMTCU2 for DMS- 250 tandem offices with CCS7 transaction capabilities application part (TCAP)-based service. Register TCUN00B counts calls that the system routes to N00B treatment when the N00 database blocks the N00 number.

TCUN950 (Do not dial 950 (N950) treatment) A register for OM group TRMTCU used by DMS- 100 local, DMS-200 toll, and DMS-100/200 local toll end offices with equal access feature. This register counts calls that the system routes to treatment N950. The system routes the calls to treatment because the system dials 950-1XXX instead of the carrier access code 10XXX. The system routes the call to an announcement.

TCUNACD (Do not dial carrier access code (NACD) treatment) A register for OM group TRMTCU used by DMS-100 local and DMS-100/200 local toll end offices with equal access us. It counts calls that the system routes to treatment NACD. The system routes the calls to treatment because the carrier access code is the carrier access code of the primary inter-LATA carrier (PIC) of the subscriber. The carrier access code is 10XXX. The PIC of the subscriber is assigned in table LENFEAT. The subscriber dials the carrier access code.

TCUNACK (Negative acknowledgement (NACK) treatment) A register for OM group TRMTCU used by DMS-100 local, DMS-100G, international, and DMS-100/200 local toll offices. It counts calls that the system routes to treatment NACK when a subscriber attempts to use a custom calling feature. The system cannot complete the call because of feature interaction or restriction.

TCUNIDIR A register for OM group TCAPUSAGE that counts TCAP messages that the system sends or receives that contain a one directional package type. A message with a one directional package type flows in one direction only. Each message has one TCAP.

TCUNOCN (No coin (NOCN) treatment) A register for OM group TRMTCU used for DMS-100 local and DMS-100/200 local toll offices that counts calls that the system routes to treatment NOCN. The system routes a call that originates on a coin line to treatment NOCN. The system routes the call to treatment if the subscriber deposits no coin on a call the system charges.

2001-8.0-RFM03-0302 Glossary 262

TCUNPAR (Numbering plan area restricted (NPAR) treatment) A register for OM group TRMTCU2 for DMS-250 tandem offices that counts calls that the system routes to NPAR treatment. The system routes the calls to treatment for one of the following reasons: an INWATS call that a subscriber dials. The numbering plan area (NPA) of the subscriber is assigned BLOCKED in table IEXCLUDE, a subscriber dials a universal access code followed by an 800 number.

TCUPTFL (Plain ordinary telephone service (POTS) failure (PTFL) treatment) A register for OM group TRMTCU2 for DMS-300 gateway offices that counts calls that the system routes to PTFL treatment. The system routes the call to treatment because service screening determines the call is not an authorized attempt to use POTS service. Service screening by destination is an option available on DMS-300 gateway switches. The feature checks that each call only uses the services allowed at the destination.

TCUORSS (Originating service suspension (ORSS) treatment) A register for OM group TRMTCU used for DMS-100 local, international, and DMS-100/200 local toll offices, TCUORSS counts calls that the system routes to ORSS treatment. The system routes a call that originates on a line to ORSS treatment. The system routes the call to treatment if the line has the denied originating option or the suspended service option assigned. The options are assigned in table LENLINES or table IBNLINES. For DMS-MTX offices, TCUORSS counts calls that the system routes to treatment ORSS. The system routes the call to treatment because a mobile that is temporarily not correct originates a call.

TCURSDT (Restricted date and time (RSDT) treatment) A register for OM group TRMTCU for DMS-250 tandem offices that counts calls that the system routes to treatment RSDT. The system routes the calls to treatment because the authorization code of the subscriber does not allow access to the network. The subscriber is the originating subscriber.

TCUSCUN (Service currently unavailable (SCUN) treatment) A register for OM group TRMTCU2 for DMS-250 tandem offices that counts calls that the system routes to SCUN treatment. The system routes 0+ONNET call to SCUN treatment when the call cannot access an operator.

TCUTDND (Toll denied (TDND) treatment) A register for OM group TRMTCU for DMS-100 local, DMS-200 toll, and DMS-100/200 local toll offices use register TCUTDND. Register TCUTDND counts calls that the system routes to treatment TDND for one of the following reasons: - A line with the toll denied (TDN) option assigned in table LENLINES originated a direct dial (DD) call. Class-of-service screening did not intercept the DD call. - A coin line with option TDN assigned in table LENLINES originated an operator assisted (OA) call. Class-of-service screening did not intercept the OA call. - The switching office has AMR5 signaling. A line, other than coin, with option TDN assigned in table LENLINES originated a zero plus (0+) or zero minus (0-) call. The ZEROMPOS field in table LINEATTR is other than AMR5. - A call terminated on an incoming or two-way CAMA/AMR5 trunk with AMR5 signaling format. The category code in table AMRCAT for the trunk specifies treatment TDND. - An MDC line originates a toll call other than 1+ 555, 1 + NPA555, or 1+ 800. The line has the toll denied restriction specified with the direct outward dial access code in table IBNXLA. For DMS-MTX offices, TCUTDND counts calls that the system routes to treatment TDND. The system routes the calls to treatment because a cellular subscriber attempted a toll call that table CELLULAR restricts.

TCUTESS (Terminating service suspension (TESS) treatment) A register for OM group TRMTCU

2001-8.0-RFM03-0302 Glossary 263

for DMS-100 local and DMS-100/200 local toll offices that counts calls that the system routes to treatment TESS. The system routes calls to treatment for one of the following reasons: - An incoming operator verification call terminated on a busy line. The line has the suspended service (SUS) option assigned in table LENLINES or table IBNLINES. - A call that originates on a line or a trunk call terminated on a line. The line has option SUS assigned in table LENLINES or table IBNLINES. For DMS-MTX offices, TCUTESS counts calls that the system routes to the terminating service suspension treatment. The system routes calls to treatment because the termi- nating mobile is temporarily not correct. This register does not increase in GL04.

TCUTINV (Temporarily invalid authorization code (TINV) treatment) A register for OM group TRMTCU for DMS-250 tandem offices that counts calls that the system routes to treatment TINV. The system routes calls to treatment because the authorization code that the subscriber dials is temporarily not correct.

TCUUCCN (Unpaid credit card (UCCN) treatment) A register for OM group TRMTCU2 that counts calls that receive UCCN treatment.

TCUUMOB (UnRegistered mobile (UMOB) treatment) A register for OM group TRMTCU for DMS-MTX offices that counts calls that the system routes to treatment UMOB. The system routes calls to treatment because the mobile identification number (MIN) of the mobile station is not correct. The mobile station attempts the origination.

TCUUNCA (Unauthorized CAMA call (UNCA) treatment) A register for OM group TRMTCU that is not currently active.

TCUUNIN (Unauthorized INWATS call treatment) A register for OM group TRMTCU for DMS- 100 local, DMS-200 toll, and DMS-100/200 local toll offices that counts calls that the system routes to treatment UNIN for one of the following reasons: - An INWATS call that originates from outside the state dialed an 800 + NX2 number where the system reserves NX2 codes for intrastate calls. - An INWATS call that originates in the state dialed an 800 + NNX + XXXX number. - An INWATS terminating call originates from a band that is further away than the terminator paid for. - A call with an INWATS number that is not correct terminated on an INWATS line. - A call that was not direct dialed terminated on an INWATS line. - A call that originated in the local free calling area terminated on an INWATS line. The system cannot bill the subscriber for the call.

TCUUNOW (Unauthorized OUTWATS call (UNOW) treatment) A register for OM group TRMTCU for DMS-100 local and DMS-100/200 local toll offices that counts calls that the system routes to treatment UNOW. The system routes a call that originates on an OUTWATS line to treatment UNOW. The system routes the call to treatment if the call originator dialed an out-of-band code.

TCUVPFL (Virtual private network failure (VPFL) treatment) A register for OM group TRMTCU2 for DMS-300 gateway offices that counts calls that the system routes to VPFL treatment. The system routes the calls to treatment because the call is not an autho- rized attempt to use virtual private network service. The service screening determines if the call is not an authorized attempt. Service screening by destination is an option available on DMS-300 gateway switches. The feature checks that each call uses only the services allowed at the destination.

TD 1. Transmit Data. 2.Tone Dial Receiver.

2001-8.0-RFM03-0302 Glossary 264

TDD Telecommunications Device for the Deaf.

TDM Time Division Multiplexer.

TDND Toll Denied.

TDR Toll Distribution Record.

technology The knowledge and methods used to create a product.

TELCO Telephone Operating Company. Also called TELOP.

telecommunication Any process that enables written or printed matter, fixed or moving pictures, words, music, or visible or audible signals or signals controlling the functioning of mecha- nisms, etc. to be relayed by means of an electromagnetic system.

telecommunications The technology concerned with communicating at a distance.

telecommunication serviceA specified set of user-information transfer capabilities provided to a group of users by a telecommunication system.

telegraphy 1. The technology associated with sending messages electrically and providing a written record of the message transferred. 2. The study of transmission of messages by telegraph and the making of telegraph instruments.

telephone An instrument that conveys speech by converting the human voice into electric signals sent by line, radio, or fiber to a distant point where the signals are recon- verted to sound waves.

telephone system A telecommunication system set up for the transmission of speech or other sounds.

Teletypewriter Exchange An international system similar to the telephone system, but linking teletypewriters.

TELEX See Teletypewriter Exchange.

TELOP Telephone Operating Company.

TELPAK Bell Private Line Package.

temporary storage Storage reserved for intermediate results.

ten-day record A record of toll calls for a period of ten days to determine the calling patterns to and from each central office.

TEP Traffic Engineering Practice.

tera Prefix meaning one trillion.

TERMBLK (Terminating Failures) A register for OM group LMD that counts attempts to find a speech link from the network module to a terminating line that failed. Attempts fail because of one of the following reasons: - There are no speech links available from the network to a terminating line - No match between an idle channel on the links to the network and an idle channel on the link shelf that serves the terminating line is present.

terminal An input/output device whereby a user is able to communicate directly with a computer. A terminal must have a keyboard, so that the user can type in instructions

2001-8.0-RFM03-0302 Glossary 265

and input data, and a means of displaying output, such as a CRT screen or a type- writer. terminate-and-stay resident See memory resident. terminating call A call completed to a subscriber line in the office being considered. terminating direction The use of access service for the completion of calls from a customer premises to an end user premises. terminating toll center Toll center through which the called subscriber’s line is reached.

TERAIFL (Auto identified outward dialing (AIOD) failure (AIFL) treatment) A register for OM group TRMTER that counts calls for DMS-100 local and DMS-100/200 local toll offices that the system routes to AIFL treatment. The system routes an incoming call on a PBX line with the AIOD feature to AIFL treatment. The system also routes an incoming call on a trunk of group type PX or P2 with the AIOD feature to AIFL treatment. The system routes a call to treatment if the DMS fails to receive the AIOD message over the AIOD data link in the specified delay.

TERANFL (Announcement fail (ANFL) treatment) A register for OM group TRMTER that counts calls that the system routes to ANFL treatment for reasons that the licensee assigns. This register supports the integration of software loads for the licensee.

TERC7AP (CCS7 application (C7AP) failure treatment) A register for OM group TRMTER that counts service switching point (SSP) calls for access tandem and equal access end offices. It counts calls that the system routes to C7AP treatment. The system routes the calls to treatment for one of the following reasons: - service control point database time-out or trouble - transaction capabilities application part (TCAP) message decoding problems - transaction identification is not available for SSP calls or - carrier identification for 800 calls is not correct The C7AP treatment is available instead of RODR. The RODR treatment is now dedi- cated for distorted signals during dialing or in-pulsing.

TERCONP (Connection not possible (CONP) treatment) A register for OM group TRMTER that counts calls that the system routes to CONP treatmentFor DMS -250 tandem offices. The system routes calls to CONP treatment when 3L-to-3L blocking does not allow a carrier to complete a call.

TERDTFL (Equipment related treatment of datafill error) A register for OM group TRMTER that counts the number of times the system encounters an error in datafill for the DMS- 100G switch.

TERERDS (Trunk permanent ground (ERDS) treatment) A register for OM group TRMTER that counts calls that the system routes to ERDS treatment. The DMS-100 local, DMS-200 toll, DMS-100/200 local toll, and DMS-300 gateway office use this register. The system routes a call to ERDS treatment because the system detects a permanent ground during a call.

TERFDER (Feature data error (FDER) treatment) A register for OM group TRMTER that counts calls for DMS-100 local K&S offices (Austria) that the system routes to FDER treat- ment. The system routes calls that originate in DMS-100 switches with the Call Forwarding K&S (Austria) feature to FDER treatment. The system routes the calls to treatment when a caller attempts a call forward that is not correct. North American DMS-100 switches do not use the FDR treatment.

2001-8.0-RFM03-0302 Glossary 266

TERINBT (Installation busy (INBT) treatment ) A register for OM group TRMTER for DMS-100 local (International NETAS), and international offices, that counts calls that the system routes to INBT treatment. The system routes the calls to treatment because an incoming call attempts to terminate on a line. The link is in the installation busy (INB) state.

TERINOC (Invalid operator code (INOC) treatment) A register for OM group TRMTER for DMS- 100/200 local toll offices that counts system routed-to-INOC treatment calls . The system routes the calls to treatment when the Auxiliary Operator Services System (AOSS) trunk sends an invalid operator identification code (OIC).

TERINVM (Equipment-related treatment of an invalid message) A register for OM group TRMTER increases when the called party number receives an invalid numbering plan indicator. The register also increases when the called party receives an invalid calling party category.

TERIMTOC (Multifrequency compelled (MFC) time-out or confusion (MTOC) treatment) A register for OM group TRMTER counts calls that the system routes to MTOC treat- ment for reasons that the licensee assigns. This register supports integration of software loads for the licensee.

TERM0 A register for OM group TRA640M1 that counts increases when a call terminates to a line with the SLU option and a ringing tone begins. It doesn’t count calls within the same hunt group or the same equivalent group.

TERM1 A register for OM group TRA250M1 that counts increases when a call terminates to a line with the SLU option and a ringing tone begins. It doesn’t count calls within the same hunt group or the same equivalent group.

TERM2 A register for OM group TRA125M1 that counts increases when a call terminates to a line with the SLU option and ringing tone begins. It doesn’t count calls within the same hunt group or the same equivalent group.

TERM3 A register for OM group TRA125M2 that counts increases when a call terminates to a line with the SLU option and a ringing tone begins. It doesn’t count calls within the same hunt group or the same equivalent group.

TERMATT A register for OM group CAINMSGS that counts the number of Termination_Attempt messages sent to the SCP.

TERMIEC (Register Termination - IEC) A register for OM group HPCBASIC that counts the number of HPC calls intended to complete on trunks to points outside the measuring switch, and that are intended for an IEC.

TERMIECN (Register Termination - IEC No Circuit) A register for OM group HPCBASIC that counts the number of outgoing HPC calls that cannot be routed on a trunk to a point outside the measuring switch because no idle trunks are available, and that are intended for AIN IEC (interLATA call).

TERMNOT A register for OM group CAINCRS that counts the number of Termination notification messages sent to the SCP by the switch.

TERMGNCT (Termination General No Circuit) A register for OM group CAINCRS that counts the number of calls made on a CAIN-capable agency when TERMGNCT is datafilled as the trigger criteria in table NETBUSY.

2001-8.0-RFM03-0302 Glossary 267

TERMLINE (Register Termination - Line) A register for OM group HPCBASIC that counts the number of calls recognized by the measuring switch as HPC calls, whose destination is a line served by the measuring switch, including calls which have been call forwarded.

TERMLRN (Terminating LRN Recognized Call) A register for OM group CAINLNP that pegs when the switch processes a terminating LRN for a call that matches its own.

TERMNC (Register Termination - No Circuit) A register for OM group HPCBASIC that counts the number of outgoing HPC calls that cannot be routed on a trunk to a point outside the measuring switch, because no idle trunks are available.

TERMNOT A register for OM group CAINCRS that counts the number of Termination notification messages sent to the SCP by the switch.

TERMTRK (Register Termination - Trunk) A register for OM group HPCBASIC that counts the number of calls that complete on trunks to points outside the measuring switch, that the switch has recognized as HPC calls. TERMTRK is pegged each time an IAM message is sent from an ISUP trunk, or when the inband signaling trunk is seized.

TERNCUN (National Communications System (NCS) unexpected error (NCUN) treatment) A register for OM group TRMTER for DMS-250 tandem offices that counts calls that the system routes to NCUN treatment if: the action code in a response message received from the NCS is 8 (unexpected error) on a virtual private network (VPN) call, or the action code in a response message received from the NCS is 5, 23, or 63 (not used)

TERNMZN (No metering zone (NMZN) treatment) A register for OM group TRMTER that wasn’t active at the time of this publication.

TERNONT (Not on network (NONT) treatment) A register for OM group TRMTER for DMS-250 tandem offices that counts calls that the system routes to NONT treatment. The system routes the calls to treatment when the caller attempts a call origination to an area code. The area code is not on the network.

TERPERR (Equipment-related treatment of protocol error) A register for OM group TRMTER that increases when the system routes a call to protocol error treatment.

TERPNOH (Permanent signal no receiver off-hook (PNOH) treatment) A register for OM group TRMTER that wasn’t active at the time of this publication.

TERPTOF (Premature trunk offering (PTOF) treatment) A register for OM group TRMTER that wasn’t active at the time of this publication.

TERQ33A (Q33 fault treatment on incoming trunks) A register for OM group TRMTER that counts the number of calls sent to treatment. The system sends calls to treatment because of a Q33 fault on an incoming trunk. A Q33 fault occurs when AB bits of time slot 16 are set to (A=B=1).

TERQ33B (Q33 fault treatment on outgoing trunks) A register for OM group TRMTER that counts the number of calls sent to treatment. The system sends calls to treatment because of a Q33 fault on an outgoing trunk. A Q33 fault occurs when AB bits of time slot 16 are set to (A=B=1).

TERRODR (Reorder (RODR) treatment) A register for OM group TRMTER for DMS-100 local, international, DMS-100G, DMS-200 toll, and DMS-100/200 local toll offices. This register counts calls the system routes to RODR treatment because:

2001-8.0-RFM03-0302 Glossary 268

- the system received distorted signals during dialing or in-pulsing, or - an attempt to outpulse too many digits to a trunk of group type OP occurred. For DMS-300 gateway offices, register TERRODR counts calls that the system routes to RODR treatment. The system routes calls incoming on a private line, R1 signaling trunk, or international 101 test line to RODR treatment. The system routes the calls to treatment for one of the following reasons: - the selector in the chosen route list is not known while the call is in routing - a time-out occurs before the subscriber dials all the digits - while the call is in translation, one of the following isn’t correct: an translation result, A key pulse (KP) signal, or a signaling type. The system routes calls outgoing on an R1 signaling trunk, a no. 5 signaling trunk, or an international 101 test line to RODR treatment. The system routes the calls to treatment if the selector in the chosen route list is not known. The system routes calls outgoing on a no. 6 signaling trunk to RODR treatment if the selector in the chosen route list is not known while the system routes the call OR a timeout occurs while or before the caller dials the digits. For DMS-250 tandem offices, register TERRODR counts calls that the system routes to RODR treatment for one of the following reasons: - the number of digits the caller dials is more than the maximum number required - a digit receiver or network path is not available for foreign exchange office (FXO) or foreign exchange station (FXS) circuit - the speed number database did not return enough digits for translation to make a determination - an error condition that is not expected occurs on an outgoing trunk while a call is up - a treatment is set that does not appear in the trunk-group-specific treatment subtable, or in subtable TMTCNTL.OFFTREAT For DMS-MTX offices, register TERRODR counts calls that the system routes to RODR treatment for one of the following reasons: - the number of digits pulsed on an incoming trunk is more than the maximum required - an error condition that is not expected occurs on an outgoing trunk while a call is up - a resource is not available - no page response from a mobile unit

TERROR A register for OM group CAINAGOM that counts the number of times an error scenario is encountered when processing communication for a terminating call model.

TERSCFL (Database system communication failure (SCFL) treatment) A register for OM group TRMTER for DMS-250 tandem offices that counts calls that the system routes to database SCFL treatment for one of the following reasons: - a failure in the communications link to the National Communications System (NCS) prevents the processing of virtual private network (VPN) calls - the VPN transaction processing feature cannot hold onto a request because the WAIT_FOR_ACK queue is full - the NCS communications software in the DMS-250 fails to respond - the system detects an error in the data received from the NCS - communication links are not available to the NCS

TERSONI (Equipment-related treatment of service or option not implemented) A register for OM group TRMTER that increases when the system receives a circuit existence indicator that is not correct. The register also increases when the system receives a teleservice indicator in an initial address message.

TERSSTO (Start signal time-out (SSTO) treatment) A register for OM group TRMTER for DMS-

2001-8.0-RFM03-0302 Glossary 269

100 local, DMS-200 toll, and DMS-100/200 local. This register counts calls that the system routes to SSTO treatment for one of the following reasons: - time-out waiting for an operator answer - automatic number identification (ANI) outpulse failure or time-out, while the system outpulses the called number or the ANI information - failure on an outgoing trunk during remote office test line (ROTL) tests

TERSTOB (Signal timeout Bell operating company (STOB) treatment) A register for OM group TRMTER for DMS-100/200 local toll that counts calls that the system routes to STOB treatment. The system routes a call in an equal access environment over an access tandem (AT) trunk to STOB treatment. The system routes the call to treatment because the AT trunk does not receive equal access end office (EAEO) wink.

TERSTOC (Signal timeout inter-LATA carrier (IC)/international carrier (INC) (STOC) treatment) A register for OM group TRMTER for DMS-100/200 local toll that counts calls that the system routes to STOC treatment. The system routes a call in an equal access environ- ment over an access tandem (AT) trunk to STOC treatment. The system routes the call to STOC treatment because the AT does not receive IC/INC wink(s).

TERSYFL (System failure (SYFL) treatment) A register for OM group TRMTER for DMS-100 local, international, DMS-200 toll, DMS-100/200 local toll, and DMS-MTX offices use register TERSYFL. Register TERSYFL counts calls that the system routes to SYFL treatment. The system routes the call to SYFL treatment when the system must abort a call because of a failure of the switching unit. A failure of the switching unit occurs for one of the following reasons: - call failure or integrity loss from port 1 - miscellaneous messages from port 2 - software failure or error condition - line-to-line, line-to-trunk, or trunk-to-line error takedown - miscellaneous failures during overlap outpulsing - miscellaneous error returns during call set-up - the line module (LM) of the called line is busy or under test - automatic number identification (ANI) test failure caused by data error - ANI failure on local call detail recording (CDR) call - data error - failure in line number control processor - integrity loss while receiving digits - ring failure The system also routes a call on an incoming or two-way CAMA trunk with Bell operating company format to SYFL treatment. The system routes a call to treatment if the start signal does not match the signal in field SDATA in table TRKGRP. For DMS-300 gateway offices, register TERSYFL counts calls that the system routes to the system failure treatment.

TESS Terminating Service Suspension. test data Sample data especially created to test the operation of a given program. test desk (testboard) A manual switchboard at a local dial office equipped with instruments to test subscriber’s lines and control repair service staff activities. text The part of a message that contains the information to be conveyed. text editor A program that assists in preparing text. It is used to manipulate text; for example, to erase, insert, change, and move words or groups of words. text file A file containing lines of written information that can be sent directly to the screen or

2001-8.0-RFM03-0302 Glossary 270

printer by using ordinary operating system commands.

TFA Transfer-Allowed

TFANCU (Connect usage) A usage register (100 s scan rate) for OM group TFCANA that counts a connection at the intersection of the STSN and the DTSN. The system collects the connect usage only after the system collects setup usage at the intersec- tion. The OM usage scan accumulates the connect usage. The usage scan begins to accumulate at the intersection of the STSN and the DTSN when a call connection occurs. The system can route calls to an alternate route after a seize-fail or an out-fail causes a connection. These calls connect to the DTSN intersections, and contribute connect time to each of the STSN by the DTSN intersections.

TFANCU2 An extension of register TRANCU in OM group TFCANA.

TFANPEG A peg attempt register for OM group TFCANA that counts network connections at the intersection of the STSN and DTSN. The register counts successful network connections. If a seize-fail or an out-fail occurs after the connection, the call can connect to another route. When the call reroutes, the system counts an attempt at the intersection of the successful network connection of the new route.

TFANPEG2 An extension of register TRANPEG in OM group TFCANA.

TFANSU (Setup usage) A usage register (100 s scan rate) for OM group TFCANA that is a record of the setup time at the intersection of the STSN and DTSN. Setup usage is the number of seconds between origination and connection of a call. The system does not generate TFANSU for international switches. Time-sampling accumulates the setup time. The setup count begins for lines when the origination message arrives at the central control. The system must accept the origination message for service. Accepted for service indicates that a channel is free. If the system requires a digitone receiver, either a receiver or space in the receiver-wait queue is available. For dial pulse lines, a the system requires a free channel. If resources are not available, the origination returns to one of the following for reorigination: LM, LCM, RLM & RLCM.

TFANSU2 An extension of register TRANSU in OM group TFCANA.

TFRCPR (Authcode prompt (ACPR) treatment) A register for OM group TRMTFR that counts calls that the system routes to treatment ACPR.

TFRADPA (Address digits prompt announcement (ADPA) treatment) A register for OM group TRMTFR that calls that the system routes to treatment ADPA.

TFRBUSY (Busy line (BUSY) treatment) A register for OM group TRMTFR that counts calls for DMS-100 local, DMS-100G, and International toll offices that the system routes to the treatment BUSY. Register TFRBUSY also counts calls for DMS-200, and DMS-100/ 200 local toll offices. The calls go to treatment BUSY for one of the following reasons: - A line or trunk dialed a directory number (DN) that is call processing busy and Call Waiting is not activated. - A line without the intercom (INT) option, assigned in table LENLINES, dials its own DN. - The system seizes the called line for testing. The called line is out of service and the system does not assign the plug-up (PLP) option. Test equipment can access busy lines except when the busy line has the no double connection (NDC) option. Table LENLINES or table IBNLINES contains the NDC option. Register TFRBUSY counts calls, for DMS-300 gateway offices, that the system routes to

2001-8.0-RFM03-0302 Glossary 271

treatment BUSY. The system routes calls that are incoming on a private line, an R1 signaling trunk, or an international 101 test line. The system also routes calls that are outgoing on a no. 6 signaling trunk if the call terminates on a line that is: call process- ing busy, damaged, or out of service. Register TFRBUSY counts calls, for DMS-MTX offices, that the system routes to treatment. The system routes the calls to BUSY if: a mobile station dials its own DN, or a mobile station or trunk dials a DN that is call processing busy.

TFCANA Traffic separation/traffic analysis. See also OM group TFCANA for an extended description and field names.

TFRCBDN (Call back destination number (CBDN) treatment) A register for OM group TRMTFR that counts push-button international subscriber-dialed calls that the system routes to an announcement that requests a destination number.

TFRCCAP (Credit card announcement prompt (CCAP) treatment) A register for OM group TRMTFR that counts calls that the system routes to treatment CCAP.

TFRCCDT (Credit card dial tone (CCDT) treatment) A register for OM group TRMTFR that counts calls that the system routes to treatment CCDT.

TFRCCTO (Calling card timeout (CCTO) treatment) A register for OM group TRMTFR that counts calls, for DMS-250 tandem offices, that the system routes to treatment CCTO. The calls go to treatment because the subscriber did not enter a travel card number (TCN) in the timeout period. The office parameter MCCS_CALLING_CARD_TIMEOUT in table OFCVAR determines the timeout period (1 to 10 s). The system routes a call to an announcement. If the caller does not dial any digits after this announcement, the system routes the call to partial dial timeout (PDIL) treatment.

TFRCFOV (Call forwarding overflow (CFOV) treatment) A register for OM group TRMTFR that counts calls, for DMS-100 local, DMS-100G, and DMS-100/200 local toll offices, that the system routes to treatment CFOV. The system routes a call to treatment if the system cannot forward the call through a POTS call forwarding base station. The call cannot forward if the number of calls exceeds the maximum simultaneous forwarding limit of the base station.

TFRCONF (Confirmation tone (CONF) treatment) A register for OM group TRMTFR that counts calls, for DMS-100 local, DMS-100G, and DMS-100/200 local/toll offices, that the system routes to treatment CONF. The system routes the calls to CONF when a caller accesses a custom calling feature.

TFRFRDR (Feature reorder (FRDR) treatment) A register for OM group TRMTFR for DMS-100 local, and DMS-100/200 local toll offices with the IBN message service feature, this register counts calls that are routed to treatment FRDR because a voice message exchange (VMX) failure has been detected during activation or deactivation of a Message Waiting indication.

TFRICNF (Invalid conference code (ICNF) treatment) A register for OM group TRMTFR that counts three-way calls, for DMS-250 offices, that the system routes to treatment ICN. The system routes the calls to ICN because the controller of the three-way conference call dials an invalid conference feature code.

TFRILRR (International line restriction (ILRR) treatment) A register for OM group TRMTFR that counts calls for DSM-100 local, international, and DMS-100/200 local toll interna- tional end offices that are routed to the treatment ILRR. A call originating in an international end office with the International Line Restriction feature is routed to treatment ILRR when an attempt is made to originated a call that is restricted by

2001-8.0-RFM03-0302 Glossary 272

feature NC0473 (International Line Restrictions for DMS-100).

TFRIWUC (International wake-up call) A register for OM group TRMTFR that counts calls that are routed to treatment IWUC for DMS-100 local, International and DMS-100/200 local toll international end offices. The system routes a call that originates in an international end office with the International Wake-up Call feature to the trunk. The trunk uses the wake-up announcement during the wake-up process. If a party answers a wake-up call, the line of the subscriber receives treatment IWUC.

TFRMANL (Manual line (MANL) treatment) A register for OM group TRMTFR that counts calls, for DMS-100 local and DMS-100/200 local toll offices, that the system routes to treatment MANL. The system routes a call that originates on a line with the originat- ing manual service (MAN) option to treatment MANL. Table LENLINES contains the MAN option. The system routes the call to MAN when the line attempts to originate a call.

TFRMHLD (Music on hold (MHLD) treatment) A register for OM group TRMTFR that is no longer used. The audio interlude table (AUDIO) handles the Meridian Digital Centrex (MDC) treatments.

TFRNCII (Network communication system invalid identification code (NCII) treatment) A register for OM group TRMTFR that counts calls for DMS-250 tandem offices that the system routes to treatment NCII. The system routes the calls to NCII because the action code is 7 (invalid ID code). The network communication system (NCS) sends a response message that contains the action code.

TFRNCIX (Network communication system incoming exclusion (NCIX) treatment) A register for OM group TRMTFR that counts calls for DMS-250 tandem offices that the system routes to treatment NCIX. The system routes the calls to NCIX because the action code is 6 (incoming exclusion). The network communication system (NCS) sends a response message that contains the action code.

TFRNCTF (Network communication system translation failure (NCTF) treatment) A register for OM group TRMTFR that counts calls for DMS-250 tandem offices that the system routes to network communication system translation failure (NCTF) treatment. The system routes the calls to TFRNCTF because the network communication system (NCS) sends one of the following action codes: - 9 misdialed number - 12 supplementary code required - 13 outgoing trunk not found - 14 automatic number identification not found - 15 NPA_NXX not found - 16 pilot number not found - 17 associated partition not found - 18 ADF format error - 19 switch ID not found

TFRNINT (Changed number intercept (NINT) treatment) A register for OM group TRMTFR that counts calls for DMS-250 tandem offices that the system routes to treatment NINT. The system routes the calls to NINT because the called number changed.

TFRORAC (Originating revertive action for two-party lines with coded ringing (ORAC) treatment) A register for OM group TRMTFR that counts calls for DMS-100 local and DMS-100/ 200 local toll offices that the system routes to treatment ORAC. The system routes a call that originates on a two-party line with coded ringing to treatment ORAC. The system routes a call to ORAC when the line attempts to terminate to a party on the same line.

2001-8.0-RFM03-0302 Glossary 273

TFRORAF (Originating revertive action for two-party lines with frequency ringing (ORAF) treatment) A register for OM group TRMTFR that counts calls for DMS-100 local and DMS-100/200 local/toll offices that the system routes to treatment ORAF. The system routes a call that originates on a two-party line with frequency ringing to treatment ORAF. The system routes a call to ORAF when the line attempts to terminate to a party on the same line.

TFRORMC (Originating revertive action for multiparty lines with coded ringing (ORMC) treat- ment) A register for OM group TRMTFR that counts calls for DMS-100 local and DMS-100/200 local toll offices that the system routes to treatment ORMC. The system routes a call that originates on a multiparty line with coded ringing to treatment ORMC. The system routes a call to ORMC when the line attempts to terminate to a party on the same line.

TFRORMF (Originating revertive action for multiparty lines with frequency ringing (ORMF) treatment) A register for OM group TRMTFR that counts calls for DMS-100 local and DMS-100/200 local toll offices that the system routes to treatment ORMF. The system routes a call that originates on a multiparty line with frequency ringing to ORMF treatment. The system routes a call to ORMF when the line attempts to terminate to a party on the same line.

TFRPGTO (Mobile page timeout (PGTO) treatment) A register for OM group TRMTFR that counts calls for DMS-MTX offices that the system routes to treatment PGTO when a page timeout occurs.

TFRPRSC (Priority screen fail (PRSC) treatment) A register for OM group TRMTFR that counts calls for DMS-250 tandem offices that the system routes to treatment PRSC. The system routes a call that originates on a trunk to treatment PRSC. The system routes a call to PRSC when authorization code priority screening is in effect in the office. The system routes a call to PRSC when the authorization code priority of the subscriber is lower than the current office priority.

TFRRRPA (Revertive ring prefix announcement (RRPA) treatment) A register for OM group TRMTFR that wasn’t active at the time of this publication.

TFRSCRJ (Selective call rejection (SCRJ) treatment) A register for OM group TRMTFR that counts calls for DMS-100 local offices that receive treatment SCRJ. The call receives SCRJ because the Selective Call Rejection feature screened and rejected the call.

TFRSINT (Service interception (SINT) treatment) A register for OM group TRMTFR that counts calls that the subscriber does not dial correctly, that go to treatment SINT. Register TFRSINT counts calls for DMS-250 tandem offices. Datafill in the universal translation tables route calls to SINT. The datafill routes the calls to a TOPS position. The service interception (SVI) facility (in the TOPS position) handles the calls.

TFRSORE (Station origination restriction error (SORE) treatment) A register for OM group TRMTFR that counts calls that the system routes to the treatment SORE. The system routes the calls to SORE because they are prohibited on an Integrated Business Network (IBN) line.

TFRSRRR (Single-party revertive ringing (SRRR) treatment) A register for OM group TRMTFR that counts calls for DMS-100 local and DMS-100/200 local toll that the system routes to treatment SRRR. The system routes a call to treatment if a subscriber dials their own directory number to ring an extension telephone. The system routes the call if the line has the intercom (INT) option. Table LENLINES contains the INT option.

2001-8.0-RFM03-0302 Glossary 274

TFRTRRF (Terminating revertive action for coded ringing (TRRF) treatment) A register for OM group TRMTFR that counts calls for DMS-100 local and DMS-100/200 local/toll offices that the system routes to treatment TRRF. The system routes the called party to treatment TRRF when both calling and called parties are multiparty lines with frequency ringing. Both parties must be on the same line. The system routes the called party to TRRF when it goes off-hook.

TG See Tandem Completing.

TGN Trunk Group Number.

thermal noise Noise resulting from the movement of electrons, power line induction, and cross modulation from adjacent circuits.

thermal printer Prints by heating spots on the paper with an array of tiny, fast-acting heating ele- ments.

THGP Thousand Group DMO.

third-generation computers Refers to computers made with integrated circuits. Current computers built with circuits that have large-scale integrations are often called forth-generation computers.

THIRDNUM The number of third party billing calls received by the TOPS VSN. This number is incremented each time 12 or a 10-digit third number are dialed during service selection.

THIRD12 The number of third party billing calls selected by dialing 12. This number is incremented for the relevant key each time the caller dials 12. The call must originate from a number valid for a third number billing.

thread Group of beads which form a complete program.

TI Trunk, Incoming.

TIC Tandem Interconnecting.

ticket, toll A ticket used to record details of toll calls.

ticket, trouble A ticket used to record service faults as they are reported.

tie The connection of two or more conductors so that a signal placed on one produces a signal on all tied conductors.

tiled windows Tiled windows divide the screen into sections without overlapping one another.

time & charges A request by a calling party for an operator to inform them after the call is complete how long they talked and the charge for the call.

TIMEOUTS A register for OM group CAINMSGS that counts the number of Timeout messages sent by the SSP.

time sharing A method of operation whereby a computer system or facility is shared by several users for different purposes at (apparently) the same time. The computer services each user in sequence; however, the speed of the computer makes it appear as though the users are all handled simultaneously.

2001-8.0-RFM03-0302 Glossary 275

TKT Trunk Test.

TL 1. Trunk-to-Line (Stromberg-Carlson, 2nd & 3rd characters). 2. Timeout to Lockout (Stromberg-Carlson, 4th & 5th characters).

TLDNPOM Temporary Local Directory Number Pools for each Operational Measurement. See also OM group TLDNPOM for an expanded definition and field names.

TLDNMAX (Temporary Local Directory Number Maximum) A register for OM group TLDNPOM that pegs when the maximum number of TLDNs was simultaneously seized for each TLDN pool over the OM collection.

TLDNATTS (Temporary Local Directory Number Attempts) A register for OM group TLDNPOM that pegs when there is a successful TLDN allocation for call delivery for each TLDN pool over the OM collection.

TLDCOMP (Temporary Local Directory Number Completions) A register for OM group TLDNPOM that pegs when a call delivery is completed to the TLDN.

TLDNTIMO (Temporary Local Directory Number Time Out) A register for OM group TLDNPOM that pegs when a TLDN is released and returned to the TLDN pool due to a call delivery timeout for each TLDN over the OM collection.

TLDNOVFL (Temporary Local Directory Number Overflow) A register for OM group TLDNPOM that pegs when a TLDN request was not accommodated due to no available directory numbers (DNs) for each TLDN over the OM collection. This register pegs even if a TLDN was supplied by the overflow pool.

TM Toll Completing-Toll Switching Combined. A trunk group that combines the func- tions of toll completing and toll switching: i.e., a trunk group from a combination of a switching machine and switchboard (Class 4 or higher rank) to a dial end office (Class 5) or TWX switching plan office.

TMBSREG (Timer-based Registration) A register for wireless OM group OMMTX3 that counts when the mobile registration type is timer-based registration.

TMCCTDG (Trunk module circuit diagnostics) A register for OM group TM that increases when the system runs diagnostics on any trunk interface card or service circuit. The trunk module diagnostics perform the following activities: check that cards of the correct type are present, operates the test relay, operates and releases signal distribution points and analyses scan results, or checks transmission loss in looparound mode.

TMCCTFL (Trunk module circuit failure) A register for OM group TM that increases increases when diagnostics run on a trunk interface card or service circuit fail because of a card fault.

TMCCTOP (Trunk module circuit outside plant) A register for OM group TM that increases when the signaling test at a switching office detects a fault on a trunk circuit. The system detects the fault between the switching office and a far-end office. Register TMCCTOP increases when an originating office does not receive a start-dial or wink signal from the far-end office. A start-dial or wink signal is sent in response to the off-hook that the originating office sent.

TMCCERR (Trunk module errors) A register for OM group TM that counts errors and failures detected in an in-service trunk module. The events that TMERR counts: software and hardware errors, accuracy, audit, and processing failures or controller message congestion

2001-8.0-RFM03-0302 Glossary 276

TMFLT (Trunk module faults) A register for OM group TM that counts errors that cause the trunk module to become system busy. A manual or system-initiated recovery attempt initiates when the trunk modules become system busy.

TMMBP (Trunk module manual busy change) A register for OM group TM that increases when the system makes the trunk module manual busy from an in-service or in- service-trouble state.

TMMBTCO (Trunk module manual busy terminals cut-off) A register for OM group TM that counts subscriber calls (terminals) that are cut off when the system makes a trunk module manual busy. Calls must associate with lines or trunks in a call-processing- busy state or a call-processing-deload state. If calls do not associate, they are not counted by TMMCTCO.

TMMBU (Trunk module manual busy) A usage register (100s scan rate) for OM group TM that records if trunk modules are manual busy.

TMSBP (Trunk module system busy transitions) A register for OM group TM that increases when the system makes the trunk module system busy. The trunk module is made system busy from an in-service or an in-service-trouble state. If the trunk module recovers from the C-side busy state before being made system busy, this register is not increased.

TMSBTCO (Trunk module system busy terminals cut-off) A register for OM group TM that counts subscriber calls (terminals) that are cut off. Calls are cut off when the system makes a trunk module C-side busy. The trunk module is made C-side busy from an in-service or in-service-trouble state. C-side busy is an intermediate state that occurs before the system makes the trunk module system busy.

TMSBU (Trunk module system busy) A usage register (100s scan rate) for OM group TM that counts if trunk modules are system busy. The system makes a trunk module system busy if the trunk module: fails an routine audit, does not have available message paths, or sends more than 200 not requested trouble reports within an audit period.

TO 1. Trunk Outgoing (Stromberg-Carlson). 2. See Tandem Originating.

toggle To toggle something is to switch it back and forth from one state to another.

toll call Any call to a point outside of the free dialing area.

toll center A toll office where operators are present to give assistance in completing incoming calls in addition to providing other traffic related operating functions.

toll center area The area served by a toll center, including the toll center city and the communities served by tributaries of the toll center.

toll circuit A general term applied to interexchange trunks used primarily for toll traffic.

toll completing Incoming toll calls. A trunk group from a switching machine of Class 4 or higher rank to a Class 5 dial office, regardless of location.

toll office A central office used primarily for supervising and switching toll traffic.

Toll PCI Toll Peg Count In.

Toll PCO Toll Peg Count Out.

2001-8.0-RFM03-0302 Glossary 277

toll point (4P) An office that contains ticketing equipment or operators to handle outward toll only. toll station A telephone, either private or public, connected directly to a toll board or bridged onto a ringdown toll circuit. toll switching A trunk group from a switchboard to an end office (Class 5) or TWX switching plan office used to complete delayed outward calls, inward calls, and assistance traffic. toll testboard A manual board on which all of the toll cable pairs entering a toll center appear on line and equipment jacks. The board is equipped with primary and secondary cords for testing and rerouting circuits when applicable.

TONEATT (Tone attempts) A register for OM group TONE that counts calls the system routes to each tone generator. The register increases before the system determines if the call can connect to the tone. If the maximum permitted number of calls uses the tone, the call routes again to the next entry in the routing list.

TONEDENY (TONESYSN resources denied) A register for OM group DSPRMAN. TONEUTIL should be 100% before TONEDENY increments the peg register.

TONEHI (High-water-mark for TONESYSN resource allocations from the TONESYSN pool) A register for OM group DSPRMAN counts the highest number of TONE resources allocated from the node-level pool during a collection/transfer period. Its value starts at zero at the beginning of each collection/transfer period for the node. An update occurs when there is a new high-water-mark in the collection period. This occurs when the total number of resources allocated from the TONE pool exceeds the previous high-water-mark for the pool during the collection period.

TONELOST (Number of TONESYSN resources taken away from or lost by resource management users) A register for OM group DSPRMAN that counts the TONE resources taken away from users of SPM resource management (such as call processing) due to sparing actions.

TONELOW (TONESYSN low-water-mark threshold violations on the node-level TONESYSN pool) A register for OM group DSPRMAN that counts the low-water-mark threshold violations on the SPM node-level pool of TONE resources since the last collection period. Crossing the threshold once indicates a potential for resource exhaustion on the node. Crossing the threshold more than once in a collection period indicates the user (call processing) is operating around the threshold for extended periods.

TONEOVFL (Tone overflow) A register for OM group TONE that counts calls the system routes to a tone generator that do not connect. The system cannot connect the calls because the maximum number of calls are already connected or the generator is maintenance busy. Register TONEOVFL does not count calls that overflow because of network blockage.

TONEUTIL (Percent utilization of TONESYSN resources) A register for OM group DSPRMAN that calculates the percentage of the total TONE resources in the node-level pool allocated to users of resource management (such as call processing). TONEUTIL is the average percentage utilization for all scan periods during a collection/transfer period. It does not indicate the total number in use at the end of a scan or transfer period. tone trunk Trunk carrying dial tone, busy tone, etc. toner cartridge The toner cartridge of a laser printer contains the toner (ink) that will be used to make marks on the paper.

2001-8.0-RFM03-0302 Glossary 278

TOOLONG1 1. The number of times the caller spoke too long during the first name recording attempt. This number is incremented for the relevant key each time the value for the Name_Record_Wait_Time parameter in table User Interaction is reached before the caller is finished speaking. (The name is automatically accepted and recorded if either of the following parameters in table VSN Retry Counts has a value of zero: Name_Format_Error, or Name_Total_Retry. 2. The number of times the billed party spoke too long during the first billing acceptance attempt. This number is incremented for the relevant key each time the response is longer than what is expected.

TOOSOON1 1. The number of times the caller spoke too soon during the first name recording attempt. This number is incremented for the relevant key each time the caller began speaking before the end of the question on the first name recording attempt. (The name is automatically accepted and recorded if either of the following parameters in table VSN Retry Counts has a value of zero: Name_Format_Error, or Name_Total_Retry. 2. The number of times the billed party spoke too soon during the first billing attempt. This number is incremented for the relevant key each time the billed party began speaking before the end of the question.

TOPS Traffic Operator Position System.

TOPSDACC Traffic Operator Position System Directory Assistance Call Completions. Counts call completions that are handled by an operator and by automatic directory assistance call completion (ADACC). ADACC allows a subscriber making a directory assistance (DA) call to be connected to the requested number without originating a new call. The subscriber can be connected to the requested number manually by an operator or automatically by an audio response unit (ARU). TOPSDACC registers are: OHACCPT, AREQST, ADENY, AOFFER, and AACCPT. These registers count the following: 1) call completion offers for operator-handled DA calls that are accepted by a subscriber 2) automatic DA call completion requests that are received from directory assistance system (DAS) 3) automatic DA call completion requests that are denied by a DMS switch 4) automatic DA call completion requests that are offered to subscribers 5) automatic DA call completion requests that are accepted by subscribers

TOPSOVFL (CF3P overflows by TOPS positions) A register for OM group CF3P for TOPS that increases when a call that attempts to connect to a TOPS position cannot request a conference circuit. The request fails because circuits are not available for TOPS calls.

TOPSTRU (CF3P TOPS traffic busy usage) A usage register for OM group CF3P for TOPS that records if the system assigned the circuits to calls being served at a TOPS position in non-CAMA mode.

TOPSQMS TOPS Queue Management System. Records queuing events for TOPS calls that request an operator position from the queue management system (QMS) call and agent manager (CAM). Also records the action taken by the QMS CAM in response to these requests. The queuing events are counted for each call queue. TOPSQMS registers are: POSRQSTD,POSRQST2,CQUEUED, CQUEUED2, GOTPOSIM, GOTPOSI2, CDEFLECT, COVFLMAX, COVFLNCQ, CQDENIED, CABANDON, and CREQUEUE.

TOPSZRS (CF3P sized by TOPS positions) A register in OM group CF3P for TOPS that increases when the system assigns a three-port conference circuit to a call at a TOPS position. This register increases when the system assigns the circuit before any attempt to set up the required network paths. This register increases again if the call fails on the first

2001-8.0-RFM03-0302 Glossary 279

attempt to obtain all the required resources. The CAMA ONI/RONI and ANF calls to TOPS positions do not use a conference circuit.

TOR Traffic Observation Report.

TOTAL A register for OM group DTSR that records the total number of test calls on LMDP and LMDT lines. The system updates the count of total calls every 15 minutes.

Total SLU Total Subscriber Line Usage.

TOTBILLA The total number of calls that were successfully connected to the billed party to perform verbal billing acceptance. This number is incremented for the relevant key each time a connection is made to the billed party and that party has gone off-hook. If the connection is made but the billed party does not answer the phone, this number is not incremented.

TOTC 1. Total Calls (DMS-10 OPM002). 2.Total Incoming Calls (DMS-10 OPM003).

TOTCALL The total number of calls presented to the VSN. This number is pegged by the call distributor (ACPE-RM). This number is incremented for the relevant key each time the ACPE-RM receives a call from the DMS. CALATMPT - number of alternate billings performed + NOCPERES

TOTDR (Total duration) A usage register (10 s scan rate) for OM group IBNSG that records if an attendant-answered call is in a talking state.

TOTS Total Dial Tone Speed.

TOTTHIRD The total number of third-number billing calls identified as such by the TOPS VSN. This number is incremented for the relevant key each time a caller dials the code 12 for third-number billing, or a 10-digit number, during the service selection stage and the call is not restricted from third-number billing.

TOTU (Total usage) A usage register (100 s scan rate) for OM group TRK (for U.S. and Australia only) that records if any trunk in the group is busy. The system generates register TOTU in the following office types: OFF100, OFF100G, OFFCOMB, OFFCOMBLWW, OFFCOMBTOPS, OFF200, OFF200TOPS, OFF250, OFF100OESD, OFF200OESD or OFFCOMBOESD. touch call code A single numeric code used to identify originating equipment groups which possess touch calling features. touch calling Using push buttons rather than a rotary dial to generate dial tone multifrequency address signals.

TP Timeout Partial Dial.

TPL Terminal Per Line.

TPS 1. Terminal Per Station. 2. Transfer Position Seizures. A traffic office measurement of the number of transfer calls routed to operators in a particular team. Includes only those calls which are transferred from one operator to another operator.

TQQABDN (Register Trunk Queuing Abandon) A register for OM group HPCBASIC that counts the number of HPC calls that have been placed in trunk group queues, but were abandoned while in the queue.

2001-8.0-RFM03-0302 Glossary 280

TQQATT (Register Trunk Queuing Attempts) A register for OM group HPCBASIC that counts the number of attempts to place HPC calls in all trunk group queues.

TQQOVFL (Register Trunk Queuing Overflow) A register for OM group HPCBASIC that counts the number of attempts to place HPC calls in trunk group queues that failed because the queues were full.

TQQTMREX (Register Trunk Queuing Timer Expired) A register for OM group HPCBASIC that counts the number of HPC calls removed from trunk group queues due to a timeout treatment.

TR533R A register for OM group CAINMSGR that supports the Bellcore TR-NWT-000533 specifications for the DMS-250 Switch.

TR533S (Toll-Free Services Messages Sent) A register for OM group CAINMSGS that supports the Bellcore TR-NWT-000533 specifications for the DMS-250 Switch.

TRA125M1 Traffic Route Analysis 125 measurements 1. See also OM group TRA125M1 for an extended description and a list of field names.

TRA125M2 Traffic Route Analysis 125 measurements 2. See also OM group TRA125M2 for an extended description and a list of field names.

TRA250M1 Traffic Route Analysis 250 measurements 1. See also OM group TRA250M1 for an extended description and a list of field names.

TRA640M1 Traffic Route Analysis 640 measurements 1. See also OM group TRA640M1 for an extended description and a list of field names.

track 1. Data that are recorded on a disk are arranged in many concentric circles, each of which is called a track. 2. Channel on a magnetic medium.

tracks per inch A measure of storage density in magnetic disks.

TRAF 1. See traffic. 2. Traffic Distribution.

traffic The volume of calls flowing in a network.

traffic capacity The number of CCS (100-second calls) the communication channels of a switching system are designed to handle. Should be stated for some particular grade of service.

traffic density Nonidle bits divided by total bits.

traffic engineering The process of estimating demand and determining capacity requirements.

traffic load The total traffic carried by a trunk or trunk group during a specified time interval.

traffic overflow Traffic which must be directed to additional resources because the original resources are unable to handle it.

traffic, own exchange Traffic originating and terminating within the same exchange

traffic register See meter.

traffic route A set of circuits, all of which carry a given class of traffic between two exchanges.

2001-8.0-RFM03-0302 Glossary 281

Traffic Service Position System (TSPS) A computer-controlled operating position. traffic sensitive and nontraffic sensitive Two categories of cost that telephone companies have to recover in their tariffs and the toll settlement process. a. Traffic sensitive costs are those costs used exclusively for hauling toll traffic beyond the exchange carrier’s end central office (e.g., toll transmission lines, microwave, satellites, toll central offices to connect the toll trunks between end offices, the access tandem central offices where subscribers could be connected to the interexchange carrier of their choice, etc.) b. Nontraffic sensitive costs are those costs involving the end central office, the lines to the end user premises, and some on- premise wiring, all of which are used intermittently for local, intrastate, and interstate toll. traffic, smooth Traffic that has a peakedness factor of less then one. traffic tables Standard traffic engineering tables that are used to determine equipment or trunk group requirements. traffic, telecommunications A flow of calls and messages. traffic, telephone The sum of the holding times of all calls in progress over a particular group of circuits. Usually expressed in CCS (the total amount of traffic in seconds divided by 100). traffic trunk servicing Traffic trunk servicing is based on network busy hour and trunk group busy hour(s) through the busy season. Since it is difficult to predict in advance the hour in which a group is likely to be busiest, data is often collected for all hours in the day for the trunk study weeks. traffic unit A unit of telephone traffic which is numerically equal to percentage occupancy. Also called “Erlang”. traffic usage recorder (TUR) A device for measuring the amount of traffic carried by one or more sets of switches or trunks. traffic volume The sum of the holding times of the traffic carried by a pool of resources over a given period of time. transender A type of register sender used in conjunction with a ticketer on toll calls for sending purposes and depends upon the ticketer for storing various bits of information required to register the call. translator A device in a common central office which accepts the telephone address digits dialed by the customer and changes them into equipment routing digits. transmission 1. The sending of data from one location and the receiving of data in another location, usually leaving the source data unchanged. 2. The transfer of electrical power from one location to another by means of conductors. transmission impairment A level of noise, delay, or distortion that affects data transmission. transport control protocol/interface program

2001-8.0-RFM03-0302 Glossary 282

Developed by the U.S. Department of Defense, one of several software protocols that can be used to connect computers together.

trap To trap an event is to perform a special action when something happens that would ordinarily interrupt the operation of the computer. For example, some programming languages provide “error trapping,” which means that when the program attempts to do something impossible (such as divide by zero or read a file that has not been opened), control will be transferred to an error-handling routine supplied by the programmer.

TRESPR A register for OM group CAINAGOM that counts the number of response messages received by the SSP in response to terminating call model queries to the SCP.

tributary office A local office which is located outside the exchange in which a toll center is located, which has a different rate center from its toll center and which usually tickets and times only a part of its originating toll traffic, but which may ticket or time all or none, of such traffic. The toll center handles all outward traffic not ticketed and timed at the tributary and normally switches all inward toll traffic from outside the tributary’s toll center to the tributary.

TRIDUAVL (Transaction ID unavailable) A register for OM group CNAMD that counts every time the system can not initiate a calling name TCAP query because a transaction ID is not available.

TRK 1. Trunks or Trunk Groups. 2. Toll Recording Location.

TRKATT (Register Trunk Attempts) A register for OM group HPCBASIC that counts the number of calls recognized as HPC calls, on incoming trunks of the measuring switch.

TRMBLK (Terminating Blocks) A register for OM group OFZ that counts the number of at- tempts to find a voice path to a terminating line that fails. This failure occurs when no free channel is present between the host network and the terminating line.

TRMMFL (Terminating match failures) A register for OM group OFZ that counts failed attempts to find a voice path to a terminating line. The system counts more than one failed attempt if the call goes to a part of a hunt group.

TRMNWAT (Terminating Network Attempts) A register for OM group OFZ that counts attempts to find a voice path to a terminating line. The complete path includes the following elements: a segment through the network, a channel on the link between the line module and the network, and a matching channel on the line shelf. Calls are counted only for each attempt, whether the call succeeds or fails.

TRNK Trunk and Trunk Group DMO.

TRNS Translator DMO.

TRP Transfer-Prohibited.

TRSCGRO (Customer group resource overflow (CGRO) treatment) A register for OM group TRMTRS that counts calls that routed to the customer group resource overflow treatment for the following offices: - DMS-100 local - DMS-200 toll - DMS-100/200 local/toll offices An MDC call routes to the CGRO treatment when shortages occur on resources for a customer group, for example six-port conference circuits.

2001-8.0-RFM03-0302 Glossary 283

TRSCHNF (Channel negotiation failure (CHNF) treatment) A register for OM group TRMTRS for DMS-100 local, and DMS-100/200 local/toll offices that counts calls that the system routes to channel negotiation failure treatment. This action occurs because B-channel negotiation fails at the terminating interface or because a link failure occurs.

TRSCLR A register for OM group CAINAGOM that counts the number of Resource_Clear messages sent in conversation for CAIN terminating call models.

TRSCQOV (CAMA queue overflow (CQOV) treatment) A register for OM group TRMTRS that counts calls the system routes to CAMA queue overflow treatment when the CAMA queue overflows for the following offices: - DMS-100 local - DMS-200 toll - DMS-100/200 local/toll with TOPS or AOSS

TRSFECG (Far-end congestion (FECG) treatment) A register for OM group TRMTRS that counts calls the system routes to the far-end congestion treatment. The system routes the following calls to FECG treatment: - calls incoming on a private line - calls incoming on an R1 signaling trunk - calls incoming on an international 101 test trunk - call outgoing on a No. 5 signaling trunk The system routes the calls to FECG treatment for the following reasons: the far-end office encounters congestion in the network or outgoing trunks (while the system connects the call on the first attempt) or the system fails to connect the call on the first attempt.

TRSGNCT (Generalized no circuit (GNCT) treatment) A register for OM group TRMTRS that counts calls the system routes to the generalized no circuit treatment for the follow- ing offices: - DMS-100 local - DMS-100G - DMS-200 toll - DMS-100/200 local/toll A call that originates on a line or trunk routes to the generalized no circuit treatment under the following conditions. The trunk group (other than trunk group type operator verification) is the last route in the route list and all trunks are busy.

TRSNBLH (Network blockage heavy traffic (NBLH) treatment) A register for OM group TRMTRS that calls that go to the network blockage heavy traffic treatment for the following offices: DMS-100 local, DMS-100G, DMS-200 toll, DMS-100/200 local/toll, DMS- MTX.

TRSNBLN (Network blockage normal traffic (NBLN) treatment) A register for OM group TRMTRS that counts calls that route to NBLH treatment for the following offices: DMS-100 local, DMS-100G, DMS-200 toll, DMS-100/200 local/toll, or DMS-MTX. This action occurs after the system aborts the calls because of failure to get a channel in the terminating peripheral module.

TRSNCRT (No circuit (NCRT) treatment) A register for OM group TRMTRS that counts calls the system routes to the no circuit treatment for the following offices: DMS-100 local, DMS-100G, DMS-200 toll, DMS-100/200 local/toll, DMS-250 tandem, and DMS- MTX offices. A routine call that network management deflects will route to no circuit treatment. This action occurs if the operating company sets the deflected calls to route to NCA at the NWM level of a MAP display.

2001-8.0-RFM03-0302 Glossary 284

TRSNECG (Near end congestion (NECG) treatment) A register for OM group TRMTRS for DMS- 300 gateway offices that counts calls the system routes to the near-end congestion treatment.

TRSOTAR (Over The Air Services Provisioning) Resources Unavailable treatment) A register for OM group TRMTRS for DMS-MTX offices, counts the TASP_RESOURCES_UNAVAILABLE treatments. An OTASP origination receives this treatment when: the system cannot allocate a temporary MIN (TMIN), the system cannot allocate a temporary reference number (TRN), or the system cannot allocate a TMIN-related VLR entry.

TRSNOSC (No service circuit (NOSC) treatment) Resources Unavailable treatment) A register for OM group TRMTRS that counts calls the system routes to NOSC treatment for the following offices: DMS-100 local, DMS-100G, DMS-200 toll, DMS-100/200 local/ toll, DMS-MTX.

TRSNOSR (No software resource (NOSR) treatment) Resources Unavailable treatment) A register for OM group TRMTRS for DMS-100 local, DMS-200 toll, and DMS-100/200 local/ toll offices, that counts calls that route to the no software resource treatment. This treatment occurs when the system cannot schedule a CPWAKEUP request or when software resources are all busy. These resources include multiblocks, recording units, custom calling feature extension blocks, supplementary data blocks, or feature data blocks.

TRSSORD (Storage overflow reorder (SORD) treatment) A register for OM group TRMTRS for DMS-250 tandem offices, TRSSORD counts calls that go to the storage overflow reorder treatment for one of the following reasons: - the DMS-250 runs out of network communications service system (NCS) exten- sion blocks while the system translates a virtual private network (VPN) call - the DMS-250 runs out of feature control blocks at the time of a travel card number service (TCN) call origination

TRSTOVD (Toll overload (TOVD) treatment) A register for OM group for TRMTRS for DMS-100 local, and DMS-100/200 local/toll offices, that counts calls that go to the toll overload treatment. A call that originates on a line goes to the toll overload treatment if the calling line is denied access to the toll network. Access is denied because the toll network protection feature is activated.

TRU (Traffic busy usage) A usage register (100 s scan rate) for OM group TRK that counts if a trunk in the group is in one of the following states: - call processing busy (TK_CP_BUSY) - call processing busy deload (TK_CP_BUSY_DELOAD) - lockout (TK_LOCKOUT) The system generates this register for office types that are correct.

TRU2WIN (Incoming two-way trunk usage) A usage register (100 scan rate) for OM group TRK that counts if a two-way trunk in a group is in one of the following states: call processing busy (TK_CP_BUSY), call processing busy deload (TK_CP_BUSY_DELOAD), or lockout (TK_LOCKOUT). The system generates register TRU2WIN for office type DMS250.

truncate 1. To drop one or more digits to the right of the decimal point in a number. 2. To cut off any characters that will not fit into an allotted space. For example, a six character field on a report in which computer would appear as comput.

trunk A communication channel between two ranks of switching equipment in the same office, between central office units in the same switching center, or between two

2001-8.0-RFM03-0302 Glossary 285

switching centers. A trunk is for the common use of all calls of one class between its two terminals. trunk, final The group of trunks which takes the overflow traffic from a group of direct “high usage” trunks. trunk group A set of trunks that are engineered to provide capacity at an estimated load and service level. In most cases, trunk groups are engineered as units where all paths are interchangeable. trunk group identification The name and identification number which identifies a specific trunk group. trunk, high usage A group of trunks which is the primary direct route between two points, and is engineered to carry the maximum traffic at all times. To provide an acceptable grade of service, an alternate “final group” must be provided for the overflow traffic. trunk quantity (required) The number of trunks that are required to carry the measured CCS traffic load at a specified grade of service. trunk quantity (working) The number of trunks that are in service for a particular equipment or trunk group. trunk side connection The connection of a transmission path to the trunk side of a local exchange switching system.

TS Toll Switching.

TS0 (Time switch 0) A usage register (100 s scan rate) for OM group for TS that records the use of P-side time switch 0.

TS1 (Time switch 1) A usage register (100 s scan rate) for OM group for TS that records the use of P-side time switch 1.

TS2 (Time switch 2) A usage register (100 s scan rate) for OM group for TS that records the use of P-side time switch 2.

TS3 (Time switch 3) A usage register (100 s scan rate) for OM group for TS that records the use of P-side time switch 3.

TS4 (Time switch 4) A usage register (100 s scan rate) for OM group for TS that records the use of P-side time switch 4.

TS5 (Time switch 5) A usage register (100 s scan rate) for OM group for TS that records the use of P-side time switch 5.

TS6 (Time switch 6) A usage register (100 s scan rate) for OM group for TS that records the use of P-side time switch 6.

TS7 (Time switch 7) A usage register (100 s scan rate) for OM group for TS that records the use of P-side time switch 7.

TSD Traffic Service Desk.

TSI Timeslot Interchanger.

TSPS See Traffic Service Position System.

TSTRCNV A register for OM group CAINAGOM that counts the number of conversational

2001-8.0-RFM03-0302 Glossary 286

Send_To_Resource messages received by the SSP.

TT 1. Trunk-to-Trunk (Stromberg-Carlson). 2. Toll Ticketing.

TT REGISTER Touch Tone Register.

TQUERY A register for OM group CAINAGOM that counts the number of terminating call model queries sent to the SCP.

TU Traffic Unit.

TUA Traffic Unit Apportionment.

TUR See Traffic Usage Recorder.

turnkey A prepackaged, ready to use computer system that contains all the hardware, software, training, and maintenance support needed to perform a given application.

TVIPREQ A register that counts the number of Virtual IP requests that are sent in conversation for CAIN terminating call model interactions for OM group CAINAGOM.

TVIPRSP A register for OM group CAINAGOM that counts the number of VIP response messages sent in conversation for CAIN terminating call model interactions.

TWP Teletype Printer.

TWX Teletypewriter Exchange Service.

TWXSPT TWX Switching Plan Trunks.

Tx Transmit.

typ Typical.

UC Unit Call.

UCDABNDN (Uniform call distribution abandoned) A register for OM group for UCDGRP that increases when a customer abandons a call while in a queue for attachment to a uniform call distribution (UCD) agent. This register also increases when the customer terminates a call to a UCD agent before the agent answers.

UCDANSR (Uniform call distribution answered) A register for OM group for UCDGRP that counts answered calls that the system uses uniform call distribution to distribute.

UCDBLOCK (Uniform call distribution blocked) A register for OM group for UCDGRP that counts incoming UCD calls that the system blocks for one of the following reasons: - the system cannot provide the correct treatment to the calling party - the system cannot establish network connection between the incoming call and the agent.

UCDDFLCT (Uniform call distribution deflected) A register for OM group for UCDGRP that increases when a call attempts to contact a uniform call distribution (UCD) agent. The system deflects the calls because the number of calls exceeds one of the follow- ing: UCD ringing threshold, maximum queue length, or maximum allowed number of calls in the queue.

UCDDNS (Uniform call distribution night service) A register for OM group for UCDGRP that

2001-8.0-RFM03-0302 Glossary 287

increases when a call attempts to reach a uniform call distribution (UCD) group that has Night Service. The call forwards to the route that field NSROUTE in table UCDGRP specifies.

UCDOFFR (Uniform call distribution offered) A register for OM group for UCDGRP that counts calls that qualify for each uniform call distribution group. This register does not count calls that qualify for Night Service.

UCDPRMPT (Uniform call distribution preempted) A register for OM group for UCDGRP that increases when a priority call preempts a call that waits for a uniform call distribution (UCD) agent.

UCDUSAGE (Uniform call distribution usage) A register for OM group for UCDGRP that scans each UCD group every 100 s. The system records the UCD group use. The UCDUSAGE register increases by the number of busy UCD agents the system detects in the sample time.

UL Underwriters Laboratories, Inc.

UMOD Update Mode.

UNCA Unauthorized CAMA Call.

UNDN Unauthorized Directory Number.

UNDT Undefined Treatment.

UNEXPGI (Unexpected Page Intelligent Cellular Peripheral) A register for wireless OM group ICPCP that pegs when an ICP receives an unexpected page response message from one of its cells.

UNIN Unauthorized INWATS Call. uninterruptable power supply (UPS) An uninterruptable power supply uses batteries to continue providing electricity to a computer for a few minutes in the event of a power failure. This makes it possible to shut down the computer in an orderly way without losing data. unit call Synonymous with CCS; one hundred call seconds. unit of capacity The capability to transmit one conversation.

UNOW Unauthorized OUTWATS Call.

UNRECSEQ The number of times unrecognized speech was detected during subsequent attempts to obtain a yes or no response for billing acceptance. This number is incremented for the relevant key each time unrecognized speech is detected after the message has been played more than once.

UNRECOG1 The number of times unrecognized speech was detected during the first attempt to obtain a yes or no response for billing acceptance. This number is incremented for the relevant key each time unrecognized speech is detected.

UNS Uninterruptable Network Service.

UPC Units Per Call.

2001-8.0-RFM03-0302 Glossary 288

updating The process in which files are made current by adding, changing, or deleting data.

UPDT Update Schedule.

UPDY If UPDT = DOWK, the mnemonic for the day(s) of the week, updating occurs. Valid entries are SUN, MON, TUES, WED, THUR, FRI, and SAT.

UPHR If UPDT = DALY or DOWK, a number from 0 through 23. This specifies the hour of the day at which updating occurs.

upload To transmit data to another computer.

UPS See Uninterruptable Power Supply.

US See usage. usage The percentage of time that a circuit is actually in use. Usually expressed in CCS or Erlangs.

user 1. Any person who owns or uses a computer for problem solving or data manipu- lation. 2. Any person who requires the services of a computer system or network.

USITA United States Independent Telephone Association. Now USTA.

USTA United States Telephone Association.

UT Universal Time.

UTRLDLYP (UTR lower delay peg) A register for OM group for UTR that counts requests for a UTR that are in the queue for a minimum of 3 s. Register UTRLDLYP counts the requests that the system denies and requests the system abandons after a minimum of 3 s. Registers UTRUDLYP and UTRLDLYP increase when a request waits in the queue for a minimum of 7 s. When the system denies the request for a UTR, both registers increase.

UTROVFL (UTR overflow) A register for OM group for UTR that increases if receivers are not available when the system requests a receiver. The count in this register represents the number of attempts to secure a position in the wait queue for the UTR. The number of calls that enter the queue equals UTROVFL subtracted from UTRQOVFL.

UTRQABAN (UTR queue abandon) A register for OM group for UTR that increases when the system deletes a UTR request from the wait queue. The system deletes the request because the calling party abandons the call or because the incoming trunk times out.

UTRQOCC (UTR queue occupied) A register for OM group for UTR that records if requests for UTRs are present in the wait queue. The operating company can set office parameter OMINERLANGS in table OFCOPT to Y. When OMINERLANGS is set to Y, the system stores the register count in deci-erlangs, not in hundred call seconds (CCS).

UTRQOVFL (UTR queue overflow) A register for OM group for UTR that increases when the system denies a UTR request a position in the wait queue because the queue is full. The wait queue can hold the same number of requests as the number of available UTR channels. Each UTR has 32 channels.

UTRRADA (UTR receiver attachment delay) A register for OM group for UTR that counts requests for a UTR channel on which the system performs receiver attachment delay record (RADR) measurements. Not all call processing and diagnostic requests are in the queue. The system cannot include these requests in the UTRRADA register. The

2001-8.0-RFM03-0302 Glossary 289

number of RADR calls correspond to the number of requests that call processing makes for UTR channels.

UTRSAMPL (UTR samples) A register for OM group for UTR that increases when the system takes samples of queue occupancy and the number of receivers in use. The system takes these samples every 10 s. The call processing time stamp determines when 10 s passes. When the system takes a sample, the system adds the current count of UTRs in use to UTRTRU. The system also adds the current count of UTR requests in the queue to UTRQOCC.

UTRSZRS (UTR seizures) A register for OM group for UTR that increases each time the system supplies a UTR to a call in response to a request.

UTRTRU (UTR available) A usage register (10 s scan rate) for OM group for UTR that records the number of universal tone receivers in use. The operating company can set the office parameter OMINERLANGS in table OFCOPT to Y. When OMINERLANGS is Y, the system stores the register counts in deci-erlangs. The system does not store the register counts in hundred call seconds (CCS).

UTRUDLYP (UTR upper delay peg) A register for OM group for UTR that counts requests for a UTR that are in the queue for a minimum of 7 s. The register also counts the number of requests that the system denies. This register also counts requests that the system abandoned after a minimum of 7 s. Register UTRLDLYP increases when a request waits in the queue for a minimum of 7 s. If the system denies the request for a UTR, registers UTRUDLYP and UTRLDLYP increase.

V Volts.

VA Volt-Amperes.

VAC 1. Vacant. 2. Vacuum. 3. Volts-Alternating. 4. Value Added Carrier.

Vacant No. Vacant Number.

VAC CODE Vacated Code.

VAC LEVEL Unassigned Directory Number.

VACT Vacant Code Treatment.

VADIS Voice And Data Integrated System.

VAN Value Added Network. variable Symbol representing a quantity whose value can change.

VCH Voice Channel.

VCHMWOA (Voice Channel Message Waiting Order Attempts) A register for wireless OM group ICPCP that pegs when the switch attempts to send an IS-54 Rev. B message waiting order to a subscriber unit over the VCH.

VCHMWOC1 (Voice Channel Message Waiting Order Completions First Attempt) A register for wireless OM group ICPCP that pegs when a subscriber unit responds on a VCH to the first attempt by the switch to send an IS-54 Rev. B message waiting order.

VCHMWOCR (Voice Channel Message Waiting Order Completions retry attempt) A register for

2001-8.0-RFM03-0302 Glossary 290

wireless OM group ICPCP that pegs when a subscriber unit responds on a voice channel to a retry attempt by the switch to send an IS-54 Rev. B message waiting order.

VDT Visual Display Terminal.

VERIF IN See verification in.

verification in When an operator verifies a telephone number.

verification trunk A trunk to the terminating switching equipment of a central office that will enable an operator to access a subscriber’s line even though it is busy. It is sometimes called a busy visual trunk or a no test trunk.

VF Voice Frequency.

VFA Volunteer Fire Alarm.

VFGBLCKD (Virtual facility group (VFG) blocked) A register for OM group VFGUSAGE that counts increases when an outgoing call attempt fails because resources are not available. The call attempt goes to generalized no circuit (GNCT) treatment. If the count in this register is often large, increase the number of members in the VFG.

VFGLSCBL (Virtual facility group (VFG) line screening code blockages) A register for OM group VFGUSAGE that counts calls blocked by one of the following: line screening code (LSC), or alternate line screening code (ALSC) for the VFG and the associated LSC. The restrictions are for the VFG and the LSC that associates with the call in field OPTIONS in table VIRTGRPS. For this register to increase, the system must assign one of the following options to the VFG: VFGLSC and VFGALSC in table VIRTGRPS, CUSTGRP in table CUSTSTN, or VAC in table FNMAP.

VFGUSAGE Virtual facility group usage. See also OM group VFUSAGE for an extended description and field names.

VFGTOTAL (VFG total) A register for OM group VFGUSAGE that counts outgoing call attempts.

VFGTRU (VFG traffic busy usage) A usage register (100s scan rate) for OM group VFGUSAGE that counts records if VFGs are call processing busy. This register indicates an over- used or under-used VFG. A high or low level of use over time can indicate that you must change the number of VFG members.

VFL Voice Frequency Line.

V & H Coordinates A method of calculating airline miles between two points that is based on the vertical and horizontal coordinates of the two points.

VID Video.

VIPREQ A register for OM group CAINTRIG that counts the number of SCP requests fro VIP handling through Send_To_Resource or Connect_To_Resource messages.

VIPRESP A register for OM group CAINTRIG that counts the number of responses to an SCP with a normal ClearCause after VIP handling.

VLSI Very Large Scale Integration.

VN Verify Number if no answer.

2001-8.0-RFM03-0302 Glossary 291

VNL Via Net Loss. The lowest loss at which trunk facilities can be operated, as limited to their inherent characteristics and achievable return losses.

VR Verification. A circuit used by operators and/or testboard to verify or test busy line conditions of subscribers.

VSNCOM Voice Services Node. Measures call attempts and dispositions for voice services node (VSN)-related calls on an application basis. VSNCOM registers are: VSNATT, VSNIDFL, VSNNOVL, VSNIVFL, VSNOPRF, VSNOPRB, VSNVABN, VSNVABA, VSNDABT, and VSNVABT.

VSAT Very Small Aperture Terminal.

VSNATT VSN Call Attempts. VSNATT counts the number of calls in which the DMS switch attempts to provide VSN application handling. This occurs at the point at which all originating station treatment checks have been passed, any coin signaling is com- pleted, and the DMS switch is ready to select a voice link to a VSN for the call.

VSNDABT VSN Call Aborted Due to Abnormal Condition in DMS. VSNDABT counts the number of times VSN application calls are aborted due to an abnormal condition in the DMS switch. When this register is incremented, the DMS central control logs need to be inspected to determine the time of the occurrence.

VSNIDFL VSN Call Failures Due to the DMS Switch. VSNIDFL counts the number of times the DMS switch fails to provide VSN application handling for calls designated to receive it during the initial connection to the VSN. When this register is incremented, it indicates that an abnormal condition has reduced the availability of resources in the DMS switch. Possible conditions include no available voice link, or no network connection.

VSNIVFL VSN Call Failures Due to the VSN. VSNIVFL counts the number of times the VSN fails to provide VSN application handling for calls designated to receive it. When this register is incremented, it indicates an abnormal condition, which may entail a potential capacity limitation or resource failure ina VSN.

VSNNOVL VSN Call Failure Due to No Voice Link. VSNNOVL counts the number of times the DMS switch fails to provide VSN application handling for eligible calls because an idle voice link cannot be found. When this register is incremented, it indicates possible provisioning problems with the voice links between the DMS and VSN.

VSNOPRB VSN Calls Routed to Operator During Back End of Call. VSNOPRB counts the number of times a VSN application call is routed to an operator during the back-end handling of a call. This register is incremented each time a VSN application call is routed to an operator after a forward connection request has been sent by the VSN handling the call.

VSNOPRF VSN Calls Routed to Operator During Front End of Call. VSNOPRF counts the number of times a VSN application call is routed to an operator during the front-end handling of the call. This register is incremented each time a VSN application call is routed to an operator before a forward-connection request has been sent by the VSN handling the call.

VSNVABA VSN Calls Aborted by VSN. VSNVABA counts the number of times VSN application calls are aborted abnormally by the VSN. When this register is incremented , it indicates an abnormal condition in a VSN. Maintenance notice logs in the DMS switch and logs in the VSN must be checked to isolate the problem. This register is

2001-8.0-RFM03-0302 Glossary 292

incremented each time a VSN application call is terminated due to an abnormal condition. When the VSN receives message data indicating an abnormal condition has occurred, it sends an Abort Call message to the DMS CM, which then terminates the VSN application call.

VSNVABN VSN Calls Aborted Normally by VSN. VSNVABN counts the number of times VSN application calls are aborted by the VSN in the normal manner. This register is incremented each time a VSN application call is terminated due to a normal call- cancellation condition. When the VSN receives message data indicating that a normal call-cancellation condition has occurred (such as when the caller hangs up to abandon the call) it sends an Abort Call message to the DMS CM, which then terminates the VSN application call.

VSNVABT VSN Calls Aborted Due to DMS Detection of an Abnormal Condition in VSN. Register VSNVABT counts the number of VSN application calls aborted when the DMS detects an abnormal condition in the VSN. When this register increases, inspect the DMS central control logs and VSN logs for the period.

VTAM Virtual Telecommunications Access Method (IBM).

W Bandwidth in Hz.

WADS Wide Area Data Service.

WAITDENY (Wait Deny) A register for OM group CP that counts calls lost because call processing requested a brief suspension and the associated call process was the only one available to process requests for service from other calls. The call is lost.

WAKEOVFL (CPWAKEUP Block Overflow) A register for OM group CP that counts unsuccessful CPWAKEUP block seizures.

WAKESZ (CPWAKEUP block seizure) A register for OM group CP that counts CPWAKEUP block seizures.

WAN Wide Area Network.

warm boot The process of fooling the computer into thinking that its power has been tuned off although power is still on.

WATS Wide Area Telephone Service. The U.S. is divided into six WATS zones.

WATS, closed end Originating outward WATS and terminating 800 service.

WATS-INWARD (800 service) Inward WATS is also known as 800 service. It is available on an intrastate as well as an interstate basis. The subscriber pays for the termination of interexchange communications from any station connected to the national network, within the range selected by the subscribing customer, to an Inward WATS dedicated access line.

WATS-OUTWARD Outward WATS is available on both an intrastate and interstate basis. This service enables a subscriber to pay a reduced toll rate for initiating interexchange communi- cations over a dedicated WATS line to any other subscriber in the national network geographically located within the distance limit selected by the caller. Out-WATS is comprised of six ranges or concentric area bands surrounding the subscriber.

WCXOF LS Channel Bidirectional Overflow. Combined count of terminating and final origi-

2001-8.0-RFM03-0302 Glossary 293

nating call attempts to/from the LS lines that fail due to all channels busy in the facilities interconnecting the LGH switch to the TSI.

WDD3S Line Switch Dial Tone Delay Over 3 Seconds. Off-hook requests for service from LS lines that do not receive dial tone within three seconds. weighted standard work seconds A measurement of traffic operator work used to express the relative time required to handle various kinds of calls or work functions, and which is weighted to reflect appropriate degrees of wait time to serve time. wild card A method that permits an operating system to perform utility functions on multiple files with related names, without the programmer or user having to specify each file by its full, unique name.

WIMUS LS Intra-Nodal Line Termination Usage. Measures the portion of LS termination usage (WLMUS) that is connected via the intra-nodal switch.

WINEC LS Intra-Nodal Effective Calls. Count of intraline switch calls that drop back to the intra-nodal switch for the talking connection.

WINITC (Calls Lost Warm Restart) A register for OM group CP that counts calls in progress that were lost because of a warm restart. Following a restart, a short period of time may elapse before the register recognizes how many calls were lost.

WIOUS LS Intra-Nodal Line Origination Usage. Measures the portion of LS line origination usage (WLOUS) that is connected via the intra-nodal switch. wire center The location where the telephone company terminates subscriber local lines and toll lines together with the necessary testing facilities to maintain them. Usually the same location as a Class 5 central office.

WLBFM Line Switch Line Bidirectional Failure to Match. Combined count of terminating and final originating call attempts to/from the LS lines that fail due to inability to match free and available channels in the LGH switch.

WLMAT Line Switch Termination Attempts. Count of calls terminated to lines served by the line switch. Scored on ringing the called line. Does not include revertive calls.

WLMUS Line Switch Line Termination Usage. Total termination usage of calls to lines served by the line switch. Does not include revertive calls.

WLOSZ Line Switch Line Origination Seizures. Count of off- hook requests for service from all lines served by the line switch.

WLOUS Line Switch Line Origination Usage. Total origination usage of calls from lines served by the line switch.

WM Line Switch Number Termination.

WN Wrong Number.

WO Work Order.

W/O Without. word A group of bits, characters, or bytes considered as an entity and capable of being

2001-8.0-RFM03-0302 Glossary 294

stored in one storage location in computer memory.

working loop A revenue producing pair of wires, or its equivalent, between a customer’s station and the central office from which the station is served.

workstation A configuration of computer equipment designed for use by one person at a time.

WP Western Pine (utility pole).

WPM Words Per Minute.

write The process of transferring information from the computer to a storage medium.

WRKTMU (Work time usage) A usage register (10 s scan rate) for OM group IBNSG that records if attendants in a customer subgroup are active on a loop.

WRU Who Are You?

WRVEC Line Switch Line Revertive Effective Calls. Count of revertive calls. Scored when the LGH switch path is disconnected and the line is placed in the revertive talk state.

WU Western Union Telegraph Co.

WUI Western Union International.

WWW World Weather Watch.

XASAUXCP (AUXCP percent usage) A register for OM group XASTAT that indicates the ratio of AUXCP usage compared to the AUXCP_CPU_SHARE office parameter. Updated every minute to reflect the average usage ratio for AUXCP since the last OM transfer occurred. The holding register contains the average usage ratio over the last OM transfer period.

XASBKG (Background percent usage) A register for OM group XASTAT that indicates the ratio of background class usage compared to allocation. Updated every minute to reflect the average usage ratio for background class usage since the last OM transfer occurred. The holding register contains the average usage ratio over the last OM transfer period.

XASCMPLX (Call complexity ratio usage) A register for OM group XASTAT that indicates the ratio of complexity of the observed call mix compared to the standard office. It calculates using the average standardized engineered maximum call attempts per hour. The holding register contains the average value over the last OM transfer period.

XASDNC (NOSFT class percent usage) A register for OM group XASTAT that indicates the ratio of NOSFT usage compared to allocation. Updated every minute to reflect the average usage ratio for NOSFT since the last OM transfer occurred. The holding register contains the average usage ratio over the last OM transfer period.

XASFORE (Foreground percent usage) A register for OM group XASTAT that indicates the ratio of operating system overhead compared to the overhead allocated at capacity. Updated every minute to reflect the average usage ratio for the operating system overhead since the last OM transfer occurred. The holding register contains the average usage ration over the last OM transfer period.

XASGTERM (GTerm usage) A register for OM group XASTAT that indicates the ratio of GTerm usage compared to GAURANTEED_TERMINAL_CPU_SHARE office parameter.

2001-8.0-RFM03-0302 Glossary 295

Updated every minute to reflect the average usage ratio for GTerm since the last OM transfer occured. The holding register contains the average usage ratio over the last OM transfer period.

XASMAINT (Maintenance class percent usage) A register for OM group XASTAT that indicates the ratio of maintenance usage compared to allocation. Updated every minute to reflect the average usage ratio for maintenance since the last OM transfer occurred. The holding register contains the average usage ratio over the last OM transfer period.

XANETM (NETM class percent usage) A register for OM group XASTAT that indicates the ratio of NETMTC usage compared to allocation. Updated every minute to reflect the average usage ratio for NETMTC since the last OM transfer occurred. The holding register contains the average usage ratio over the last OM transfer period.

XASNXFR A register for OM group XASTAT that counts the number of transfer periods.

XASOM (OM usage) A register for OM group XASTAT that indicates ratio of OM usage compared to allocation. Updated every minute to reflect the average usage ratio for OMs since the last OM transfer occurred. The holding register contains the average usage ratio over the last OM transfer period.

XASOTHLD A register for OM group XASTAT that counts the number of one minute intervals during which system utilization exceeded the office parameter CC_ENGLEVEL_WARNING_THRESHOLD.

XASOVER A register for OM group XASTAT that counts the number of transfer periods during which system usage was greater than 100%.

XASPESC (PE state change percent usage) A register for OM group XASTAT that counts the number of one minute intervals during the transfer period in which a PE state change occurred. Increments every minute when a PE state change occurs. The holding register contains the number of one minute intervals during which a PE state change occurs over the last OM transfer period.

XASPUTIL A register for OM group XASTAT that indicates XA-Core peak call processing usage. Updated every 5 minutes to reflect the peak minute call capacity usage observed since the last OM transfer. The holding XASPUTIL register retains the peak usage value observed over the duration fot eh last OM transfer.

XASSCHED (Schedule overhead percent usage) A register for OM group XASTAT that indicates the ratio of scheduling overhead compared to the expected capacity. Updated every minute to reflect the average usage ratio for the scheduler overhead since the last OM transfer occurred. The holding register contains the average usage ratio over the last OM transfer period.

XASSNIP (SNIP class percent usage) A register for OM group XASTAT that indicates the ratio of SNIP usage compared to allocation. Updated every minute to reflect the average usage ratio for SNIP since the last OM transfer occurred. The holding register contains the average usage ratio over the last OM transfer period.

XASTAT A register for OM group XASTAT that counts

XASTAT See also OM group XASTAT for definition and a list of field names.

XASUTIL A register for OM group XASTAT that indicates the percentage of call processing capacity used within the provisioned recommendation for the grade of service

2001-8.0-RFM03-0302 Glossary 296

specifications. Updated every 5 minutes to reflect the average call processing usage observed since the last OM transfer. The holding XASUTIL register retains the average call capacity usage calculated over the duration fo the last OM transfer.

X-BAR Crossbar switch or switching system.

XFR OUT Transfer out.

XLMUS TSI Line Termination Usage. Total terminating usage of all lines served by a TSI. The sum of all XLMUS registers provides total termination usage for all host and remote lines served by the office. Excludes revertive calls.

XLOUS TSI Line Origination Usage. Total originating usage of all lines served by a TSI. The sum of all XLOUS registers provides total origination usage for all host and remote lines served by the office.

xmit Transmit.

XMODEM A special error checking file transfer protocol that transfers files in blocks of 128 bytes. XMODEM transfers are virtually error free. Requires “XMODEM capability” on the part of your terminal software and the remote system.

xmsn See transmission.

xmtr Transmitter.

XNS Xerox Network Services.

XTC External Transmit Clock.

XVR Exchange Voltage Regulator.

YCXOF LG Channel Bidirectional Overflow. Applicable only to remote line groups (RLGs). Combined count of terminating and final originating call attempts to/from the remote line group that fail due to all channels busy in the T-span(s) interconnecting the remote line group to the LGH switch.

YDD3S LG Dial Tone Delay Over 3 Seconds. Off-hook requests for service from the line group that do not receive dial tone within three seconds.

Yellow Pages Classified advertising section of a telephone directory.

YESSEQ The number of yes responses to the billing acceptance message. This number is incremented for the relevant key each time the billed party says yes to accept the charges after the billing acceptance message is played more than once.

YESVFOP The number of calls routed to the operator during verification of a yes response. This number is incremented for the relevant key each time the billed party did not confirm billing acceptance by hanging up.

YES1ST The number of yes responses to the billing acceptance message. This number is incremented for the relevant key each time the billed party says yes to accept the charges the first time the billing acceptance message is played.

YLBFM LG Line Bidirectional Failure to Match. Combined count of terminating and final originating call attempts to/from the line group lines that fail due to the inability to match free and available channels in the LGH switch.

2001-8.0-RFM03-0302 Glossary 297

YLMAT LG Line Termination Attempts. Count of calls terminated to lines, served by the line group. Excludes revertive calls. Scored on ringing the called line.

YLMUS LG Line Termination Usage. Total termination usage of calls to lines served by the line group. Excludes revertive calls.

YLOSZ LG Line Origination Seizures. Count of off-hook requests for service from lines, served by the line group.

YLOUS LG Line Origination Usage. Total origination usage of lines, served by the line group.

YMODEM A special error checking file transfer protocol that transfers files in blocks of 1,024 bytes. Similar to XMODEM, but provides faster data transfer because it uses longer packets and allows transmission of a packet to begin before acknowledgment of the previous packet has been received. Requires “YMODEM capability” on the part of your terminal software and the remote system.

YPS Yellow Pages Service.

yr Year.

YRVEC LG Revertive Effective Calls. Count of revertive calls established by lines served by the line group. Scored when the line group highway switch path is disconnected and the line is placed in the revertive call state.

Z1. Zulu time zone (Greenwich Mean Time). 2. Symbol for impedance (in ohms). zap 1. Erase. 2. Wipe out. zero transmission level The actual measurement less the test tone level, which indicates the departure of a system from its design level. zip tone A short spurt of audio tone applied to a trunk to indicate readiness to accept an order or to indicate class of service.

ZONEBREG (Zone-based registration) A register for wireless OM group OMMTX3 that counts when the mobile registration type is zone-based registration.

Zulu time The international point of reference for the time of day. Greenwich Mean Time. Sometimes called the G time.

0-MINUS Designation of customer dialed traffic in which the operator is called by dialing 0 without any following digits.

0-PLUS Designation of customer dialed traffic involving the operator. The digit 0 precedes the DDD numbers dialed.

1-PLUS Designation of customer dialed traffic in which no operator is involved, and DDD calls are accomplished by dialing the digit 1 followed by the area code and the called telephone number.

2LONGSEQ 1. The number of times the caller spoke too long during subsequent name recording attempts. This number is incremented for the relevant key each time the value for the Name_Record_Wait_Time parameter in table User Interaction is reached before the caller is finished speaking during subsequent name recording attempts. The number of attempts is determined by the following parameters in table VSN Retry Counts:

2001-8.0-RFM03-0302 Glossary 298

Name_No_Response, Name_Format_Err, and Name_Total_Retry. (The name is automatically accepted and recorded if this is the last attempt allowed.) 2. The number of times the (intended) billed party spoke too long during subsequent billing acceptance attempts. This number is incremented for the relevant key each time a value for one of the following parameters has been reached: Billing_No_Response, Billing_Reject_Retry, or Billing_Total_Retry.

2SOONSEQ 1. The number of times the caller spoke too soon during subsequent name recording attempts. This number is incremented for the relevant key each time the caller began speaking before the end of the question in subsequent name recording attempts. The number of attempts is determined by the following parameters in table VSN Retry Counts: Name_No_Response, Name_Format_Err, and Name_Total_Retry. (The name is automatically accepted and recorded if this is the last attempt allowed.) 2. The number of times the (intended) billed party spoke too soon during subsequent billing acceptance attempts. This number is incremented for the relevant key each time the (intended) billed party began speaking before the end of the question after the billing acceptance message has been played more than once.

3 S Three Seconds.

3 WC Three Way Call.

3P Three Pole.

3PDT Three Pole, Double Throw.

3PST Three Pole, Single Throw.

4P Four Pole.

7D Seven Digit Number.

7DGTBILL The number of times 7 digits are dialed instead of 10 in response to the service selection prompt. This number is incremented for the relevant key each time 7 digits are dialed after the service selection message is played.

911 system Emergency call reporting system widely used in U.S.

% (percent service delay) The requests for a particular service that are delayed beyond a specified time interval. The delayed requests are a percentage, in units of 0.1 percent, of the total requests.

%OCC Percent Occupancy (%OCC). A measurement of the percentage of time that operators on a team were unable to accept new calls.

AOPWV AOPWV + AOPIDLT

CBWV + NCWV x 100 CBWV + NCWV + IDLT

AOPCBWV and AOPNCWV are included in the AOPWV. An audit is performed to determine AOPWV and AOPIDLT for the reporting period and used to calculate %OCC. This calculation is more accurate for the reporting period than manual calculations using CBWV, NCWV, and IDLT reported in that period.

%XFR Percent of calls transferred out.

2001-8.0-RFM03-0302