(12) Patent Application Publication (10) Pub. No.: US 2005/0042218A1 Zauderer (43) Pub

Total Page:16

File Type:pdf, Size:1020Kb

Load more

US 2005004221.8A1 (19) United States (12) Patent Application Publication (10) Pub. No.: US 2005/0042218A1 Zauderer (43) Pub. Date: Feb. 24, 2005 (54) MHC CLASS - PEPTIDE-ANTIBODY Publication Classification CONJUGATES WITH MODIFIED BETA2-MCROGLOBULIN (51) Int. Cl." ........................ A61K 39/395; A61K 39/00 (52) U.S. Cl. ..................................... 424/144.1; 424/185.1 (75) Inventor: Maurice Zauderer, Pitsford, NY (US) Correspondence Address: (57) ABSTRACT STERNE, KESSLER, GOLDSTEIN & FOX PLLC 1100 NEW YORKAVENUE, N.W. The present invention is directed to a novel targeted vaccine WASHINGTON, DC 20005 (US) delivery System, comprising one or more peptide-MHC ASSignee: Vaccinex, Inc. Class I complexes linked through the B-microglobulin (73) molecule to an antibody which is specific for a cell Surface (21) Appl. No.: 10/887,230 marker. The complexes of the invention contain a B-mi croglobulin that has been modified to have greater affinity to (22) Filed: Jul. 9, 2004 the C. chain of MHC Class I than native f3P-microglobulin. Alternatively, the complexes of the invention contain B-mi Related U.S. Application Data croglobulin fused or linked to the antigenic peptide. The (60) Provisional application No. 60/485,716, filed on Jul. complexes of the invention are useful for treating and/or 10, 2003. Provisional application No. 60/513,043, preventing cancer, infectious diseases, autoimmune dis filed on Oct. 22, 2003. eases, and/or allergies. Patent Application Publication Feb. 24, 2005 Sheet 1 of 2 US 2005/0042218 A1 FCG 1. M S R S v A. L. A VLALLS LSGI, EA I C R T P K I Q v Y 1. O S R H P A E N G K S N F L N C Y V S G F H P S D I E W D L. L. 2O 30 40 K N G E R E K V E H S D L S F S K D W S F Y L. L. Y Y T E F SO 60 70 T P T E K D EY A C R v N H v T L S Q. P K I v K W D R D M 80 9 O Patent Application Publication Feb. 24, 2005 Sheet 2 of 2 US 2005/0042218A1 Clone C35 DNA Coding Sequence gcc gCg ATG AGC GGG GAG CCG GGG CAG ACG TCC GTA GCG CCC CCT CCC GAG GAG GTC GAG CCG GGC AGT GGG GTC CGC ATC GTG GTG GAG TAC TGT GAA CCC TGC GGC TTC GAG GCG ACC TAC CTG GAG CTG GCC AGT GCT GTG AAG GAG CAG TAT CCG GGC ATC GAG ATC GAG TCG CGC CTC GGG GGC ACA GGT GCC TTT GAG ATA GAG ATA AAT GGA CAG CTG GTG TTC TCC AAG CTG GAG AAT GGG GGC TTT CCC TAT GAG AAA GAT CTC ATT GAG GCC ATC CGA AGA GCC AGT AAT GGA GAA ACC CTA GAA AAG ATC ACC AAC AGC CGT CCT CCC TGC GTC ATC CTG TGA Figuela, C One C35 Protein Sequence MSGEPGQTSWAPPPEEVEPGSGVRIWVEYCEPCGFEATYLEL YEKDLIEARRASNGETLEKITNSRPPCVILASAVKEQYPGIEIESRLGGTGAFEIEINGQLVFSKLENGGFP US 2005/0042218 A1 Feb. 24, 2005 MHC CLASS - PEPTDE-ANTIBODY been shown to activate specific T cells in vitro (Hamad, A. CONJUGATES WITH MODIFIED R. A. et al., J. Exp. Med. 188: 1633-1640 (1998)). BETA2-MCROGLOBULIN 0008 Binding of peptide-MHC complexes to T cells is, in general, not Sufficient to induce T cell proliferation and CROSS-REFERENCE TO RELATED differentiation. Additional co-stimulatory Signals delivered APPLICATIONS through interactions between other membrane molecules of 0001. The present application claims priority benefit of the T cell and the antigen presenting cell are required for U.S. Provisional Appl. Nos. 60/485,716 filed Jul. 10, 2003 optimal T cell activation. Indeed, signaling through T cell and 60/513,043, filed Oct. 22, 2003, the disclosures of both antigen receptor alone in the absence of coStimulation can of which are incorporated by reference herein. result in tolerization rather than activation. 0009 Dendritic cells are a uniquely potent lineage of STATEMENT REGARDING professional antigen presenting cell that express high mem FEDERALLY SPONSORED RESEARCH AND brane levels of both MHC and co-stimulatory molecules. A DEVELOPMENT number of vaccine Strategies target antigen presentation by dendritic cells through eX Vivo introduction of antigen into 0002) Not applicable. dendritic cells or provision of GM-CSF and/or other cytok ines together with a Source of antigen in Vivo in order to BACKGROUND OF THE INVENTION promote recruitment and maturation of dendritic cells at the Site of antigen deposit. EX Vivo Strategies require complex 0003) 1. Field of the Invention manipulations of patient materials which are time consum 0004. The present invention relates to immunology. More ing and expensive. In Vivo manipulations are limited by the Specifically, the present invention relates to vaccines and efficiency with which dendritic cells are recruited and with methods for modifying immune responses. which they take up, process, and present antigenic peptide to 0005 2. Background Art Specific T cells. 0010 Both T cells and activated dendritic cells express 0006 T lymphocytes are both key effector cells and key membrane differentiation antigens that can be targeted by regulatory cells of the immune System. The ability to Stimu Specific antibodies. Some of the corresponding membrane late or inhibit specific T cell responses is a major goal for the molecules may deliver either positive or negative activation immunotherapy of cancer, infectious diseases, and autoim Signals to the T cell or dendritic cell precursor. These include mune diseases. T cell Specificity is mediated by a T cell the T cell markers CD28 and CTLA-4 (CD 152) which are, receptor (TCR) on the surface of the T cells. Each TCR is respectively, thought to mediate positive and negative co Specific for a complex of a unique peptide epitope of a Stimulator interactions. In contrast, the dendritic cell differ protein antigen associated with a major histocompatibility entiation markers CD83, CMRF-44 and CMRF-56 are not complex (MHC) molecule on the surface of a cell. There are known to have a specific function in membrane Signaling. two classes of MHC proteins which bind to TCRs in CD83, in particular, has been tested in a variety of experi conjunction with peptide antigens: MHC Class I proteins, ments and never found to have an effect beyond target cell which are found on the membranes of all nucleated cells, recognition. and MHC Class II proteins, which are found only on certain cells of the immune system. The two major classes of T 0011 Methods are available to target a specific ligand or cells, only on certain cells of the immune System. The two regulatory molecule to an antigen positive cell by geneti major classes of T cells, CD8+ and CD4+, are selected to be cally linking the Specificity domain of an antibody Specific Specific for peptide epitopes that associate, respectively, for that antigen to a particular ligand or cytokine. Fusion with MHC Class I and Class II molecules on the antigen proteins encoded in this fashion may retain both antigen presenting cell. Polymorphism within each class of MHC Specificity and ligand or cytokine function. Examples of molecule determines which peptide fragments bind with Such reagents have been described in which the ligand functional affinity to the MHC molecules expressed by a coding Sequence is linked to either the carboxyl or amino particular individual. terminus of an antibody chain which may itself be either 0007 Peptide-MHC complexes have a relatively fast whole or truncated (Morrison, S. L. et al., Clin. Chem. dissociation rate from the TCR. Multimeric peptide-MHC 34:1668-1675 (1988); Shin, S.U. and Morrison, S. L., Meth. complexes have, as expected, been shown to have slower in Enzymol. 178:459-476 (1989); Porto, J. D. et al., Proc. dissociation rates and are far more Suitable than Soluble Natl. AcadSci, USA 90:6671-6675 (1993); Shin, S.-U. et monomeric complex for binding to receptorS on a Specific T al., J. Immunol. 158:4797-4804 (1997)). A particularly flex cell. A technology for engineering tetrameric peptide-MHC ible construct has been described, in which an avidin mol complexes based on addition of biotin to the COOH-termi ecule is linked to the carboxyl-terminus of the heavy chain nus of the MHC Class I heavy chain and high affinity of an antibody that can target the transferrin receptor and association with tetrameric avidin has been developed (Alt can, in principle, deliver any biotinylated ligand to the target man, J. D., et al., Science 274:94-96 (1996)). A similar cell (Penichet, M. L. etal., J. Immunol. 163:4421 strategy has been adapted for MHC Class II molecules 4426(1993)). (Schmitt, L. et al., Proc. Natl Acad. Sci., USA.96:6581-6586 0012. The key requirements for construction of a delivery (1999); Zarutskie, J. A. et al., Biochemistry 38:5878-5887 System that can target Specific cells and tissues to deliver a (1999)). Such molecules are referred to as peptide-MHC ligand or cytokine are to identify an appropriate target tetramers and are widely employed for Staining of Specific T molecule, Select an antibody with a specificity domain with cells. A different form of dimeric peptide-MHC complex has high affinity for that target molecule, and to link an effective US 2005/0042218 A1 Feb. 24, 2005 concentration of ligand or cytokine to that antibody Speci 0019. Also provided are method of modulating, i.e., ficity domain. For the Specific purpose of vaccine delivery, either Stimulating or inhibiting, and immune response, com the relevant ligand is a specific peptide-MHC Class I com prising administering to an animal an effective amount of a pleX, preferably in dimeric or multimeric form.
Recommended publications
  • Supplementary Information Changes in the Plasma Proteome At

    Supplementary Information Changes in the Plasma Proteome At

    Supplementary Information Changes in the plasma proteome at asymptomatic and symptomatic stages of autosomal dominant Alzheimer’s disease Julia Muenchhoff1, Anne Poljak1,2,3, Anbupalam Thalamuthu1, Veer B. Gupta4,5, Pratishtha Chatterjee4,5,6, Mark Raftery2, Colin L. Masters7, John C. Morris8,9,10, Randall J. Bateman8,9, Anne M. Fagan8,9, Ralph N. Martins4,5,6, Perminder S. Sachdev1,11,* Supplementary Figure S1. Ratios of proteins differentially abundant in asymptomatic carriers of PSEN1 and APP Dutch mutations. Mean ratios and standard deviations of plasma proteins from asymptomatic PSEN1 mutation carriers (PSEN1) and APP Dutch mutation carriers (APP) relative to reference masterpool as quantified by iTRAQ. Ratios that significantly differed are marked with asterisks (* p < 0.05; ** p < 0.01). C4A, complement C4-A; AZGP1, zinc-α-2-glycoprotein; HPX, hemopexin; PGLYPR2, N-acetylmuramoyl-L-alanine amidase isoform 2; α2AP, α-2-antiplasmin; APOL1, apolipoprotein L1; C1 inhibitor, plasma protease C1 inhibitor; ITIH2, inter-α-trypsin inhibitor heavy chain H2. 2 A) ADAD)CSF) ADAD)plasma) B) ADAD)CSF) ADAD)plasma) (Ringman)et)al)2015)) (current)study)) (Ringman)et)al)2015)) (current)study)) ATRN↓,%%AHSG↑% 32028% 49% %%%%%%%%HC2↑,%%ApoM↓% 24367% 31% 10083%% %%%%TBG↑,%%LUM↑% 24256% ApoC1↓↑% 16565% %%AMBP↑% 11738%%% SERPINA3↓↑% 24373% C6↓↑% ITIH2% 10574%% %%%%%%%CPN2↓%% ↓↑% %%%%%TTR↑% 11977% 10970% %SERPINF2↓↑% CFH↓% C5↑% CP↓↑% 16566% 11412%% 10127%% %%ITIH4↓↑% SerpinG1↓% 11967% %%ORM1↓↑% SerpinC1↓% 10612% %%%A1BG↑%%% %%%%FN1↓% 11461% %%%%ITIH1↑% C3↓↑% 11027% 19325% 10395%% %%%%%%HPR↓↑% HRG↓% %%% 13814%% 10338%% %%% %ApoA1 % %%%%%%%%%GSN↑% ↓↑ %%%%%%%%%%%%ApoD↓% 11385% C4BPA↓↑% 18976%% %%%%%%%%%%%%%%%%%ApoJ↓↑% 23266%%%% %%%%%%%%%%%%%%%%%%%%%%ApoA2↓↑% %%%%%%%%%%%%%%%%%%%%%%%%%%%%A2M↓↑% IGHM↑,%%GC↓↑,%%ApoB↓↑% 13769% % FGA↓↑,%%FGB↓↑,%%FGG↓↑% AFM↓↑,%%CFB↓↑,%% 19143%% ApoH↓↑,%%C4BPA↓↑% ApoA4↓↑%%% LOAD/MCI)plasma) LOAD/MCI)plasma) LOAD/MCI)plasma) LOAD/MCI)plasma) (Song)et)al)2014)) (Muenchhoff)et)al)2015)) (Song)et)al)2014)) (Muenchhoff)et)al)2015)) Supplementary Figure S2.
  • Tests for the Evaluation of Preterm Labor and Premature Rupture of Membranes

    Tests for the Evaluation of Preterm Labor and Premature Rupture of Membranes

    Medical Coverage Policy Effective Date ............................................. 7/15/2021 Next Review Date ....................................... 7/15/2022 Coverage Policy Number .................................. 0099 Tests for the Evaluation of Preterm Labor and Premature Rupture of Membranes Table of Contents Related Coverage Resources Overview .............................................................. 1 Recurrent Pregnancy Loss: Diagnosis and Treatment Coverage Policy ................................................... 1 Ultrasound in Pregnancy (including 3D, 4D and 5D General Background ............................................ 2 Ultrasound) Medicare Coverage Determinations .................. 13 Coding/Billing Information .................................. 13 References ........................................................ 15 INSTRUCTIONS FOR USE The following Coverage Policy applies to health benefit plans administered by Cigna Companies. Certain Cigna Companies and/or lines of business only provide utilization review services to clients and do not make coverage determinations. References to standard benefit plan language and coverage determinations do not apply to those clients. Coverage Policies are intended to provide guidance in interpreting certain standard benefit plans administered by Cigna Companies. Please note, the terms of a customer’s particular benefit plan document [Group Service Agreement, Evidence of Coverage, Certificate of Coverage, Summary Plan Description (SPD) or similar plan document] may differ
  • Pathological Conditions Involving Extracellular Hemoglobin

    Pathological Conditions Involving Extracellular Hemoglobin

    Pathological Conditions Involving Extracellular Hemoglobin: Molecular Mechanisms, Clinical Significance, and Novel Therapeutic Opportunities for alpha(1)-Microglobulin Gram, Magnus; Allhorn, Maria; Bülow, Leif; Hansson, Stefan; Ley, David; Olsson, Martin L; Schmidtchen, Artur; Åkerström, Bo Published in: Antioxidants & Redox Signaling DOI: 10.1089/ars.2011.4282 2012 Link to publication Citation for published version (APA): Gram, M., Allhorn, M., Bülow, L., Hansson, S., Ley, D., Olsson, M. L., Schmidtchen, A., & Åkerström, B. (2012). Pathological Conditions Involving Extracellular Hemoglobin: Molecular Mechanisms, Clinical Significance, and Novel Therapeutic Opportunities for alpha(1)-Microglobulin. Antioxidants & Redox Signaling, 17(5), 813-846. https://doi.org/10.1089/ars.2011.4282 Total number of authors: 8 General rights Unless other specific re-use rights are stated the following general rights apply: Copyright and moral rights for the publications made accessible in the public portal are retained by the authors and/or other copyright owners and it is a condition of accessing publications that users recognise and abide by the legal requirements associated with these rights. • Users may download and print one copy of any publication from the public portal for the purpose of private study or research. • You may not further distribute the material or use it for any profit-making activity or commercial gain • You may freely distribute the URL identifying the publication in the public portal Read more about Creative commons licenses: https://creativecommons.org/licenses/ Take down policy If you believe that this document breaches copyright please contact us providing details, and we will remove access to the work immediately and investigate your claim.
  • An Evolutionary Perspective on Human Cross-Sensitivity to Tree Nut and Seed Allergens," Aliso: a Journal of Systematic and Evolutionary Botany: Vol

    An Evolutionary Perspective on Human Cross-Sensitivity to Tree Nut and Seed Allergens," Aliso: a Journal of Systematic and Evolutionary Botany: Vol

    Aliso: A Journal of Systematic and Evolutionary Botany Volume 33 | Issue 2 Article 3 2015 An Evolutionary Perspective on Human Cross- sensitivity to Tree Nut and Seed Allergens Amanda E. Fisher Rancho Santa Ana Botanic Garden, Claremont, California, [email protected] Annalise M. Nawrocki Pomona College, Claremont, California, [email protected] Follow this and additional works at: http://scholarship.claremont.edu/aliso Part of the Botany Commons, Evolution Commons, and the Nutrition Commons Recommended Citation Fisher, Amanda E. and Nawrocki, Annalise M. (2015) "An Evolutionary Perspective on Human Cross-sensitivity to Tree Nut and Seed Allergens," Aliso: A Journal of Systematic and Evolutionary Botany: Vol. 33: Iss. 2, Article 3. Available at: http://scholarship.claremont.edu/aliso/vol33/iss2/3 Aliso, 33(2), pp. 91–110 ISSN 0065-6275 (print), 2327-2929 (online) AN EVOLUTIONARY PERSPECTIVE ON HUMAN CROSS-SENSITIVITY TO TREE NUT AND SEED ALLERGENS AMANDA E. FISHER1-3 AND ANNALISE M. NAWROCKI2 1Rancho Santa Ana Botanic Garden and Claremont Graduate University, 1500 North College Avenue, Claremont, California 91711 (Current affiliation: Department of Biological Sciences, California State University, Long Beach, 1250 Bellflower Boulevard, Long Beach, California 90840); 2Pomona College, 333 North College Way, Claremont, California 91711 (Current affiliation: Amgen Inc., [email protected]) 3Corresponding author ([email protected]) ABSTRACT Tree nut allergies are some of the most common and serious allergies in the United States. Patients who are sensitive to nuts or to seeds commonly called nuts are advised to avoid consuming a variety of different species, even though these may be distantly related in terms of their evolutionary history.
  • Tissue Distribution of Human Α1 -Microglobulin

    Tissue Distribution of Human Α1 -Microglobulin

    Tissue Distribution of Human α1-Microglobulin Kimiteru Takagi, … , Toshihiko Shimoda, Toshio Shikata J Clin Invest. 1979;63(2):318-325. https://doi.org/10.1172/JCI109305. Research Article Human α1-microglobulin was isolated from the urine of patients with tubular proteinuria, and its molecular weight was established by sodium dodecyl sulfate-polyacrylamide gel electrophoresis at 33,000 daltons. The carbohydrate content was 21.7%. Anti-α1-microglobulin serum was prepared and observed to react monospecifically in gel diffusion to purified α1-microglobulin, as well as to normal human serum and urine. Sera from the domestic chicken, mouse, rat, rabbit, dog, calf, cow, goat, sheep, and horse, however, did not react to anti-α1-microglobulin serum in immunodiffusion. The lymphocyte culture supernate was found to contain α1-microglobulin. Both thymus-derived(T)- and bone marrow- derived(B)-lymphocyte culture media clearly displayed a specific precipitin line against anti-α1-microglobulin serum when tested with the Ouchterlony immunodiffusion method. The tissue distribution of α1-microglobulin was studied under immunofluorescence, and a positive staining was recognized on the lymphocyte surface. Identical staining patterns were noted on both T and B lymphocytes, though B lymphocytes took a more intense stain. It would thus seem quite possible that lymphocytes are the primary source of α1-microglobulin and that this is filtered through the glomerular basement membrane and partly reabsorbed by the renal tubules. This, then, would suggest the possibility
  • The Double-Edged Sword of Beta2-Microglobulin in Antibacterial Properties and Amyloid Fibril-Mediated Cytotoxicity

    The Double-Edged Sword of Beta2-Microglobulin in Antibacterial Properties and Amyloid Fibril-Mediated Cytotoxicity

    International Journal of Molecular Sciences Review The Double-Edged Sword of Beta2-Microglobulin in Antibacterial Properties and Amyloid Fibril-Mediated Cytotoxicity Shean-Jaw Chiou 1,2,*, Huey-Jiun Ko 1,2, Chi-Ching Hwang 1,2 and Yi-Ren Hong 1,2,3,4,* 1 Department of Biochemistry, Faculty of Medicine, College of Medicine, Kaohsiung Medical University, Kaohsiung 807, Taiwan; [email protected] (H.-J.K.); [email protected] (C.-C.H.) 2 Department of Medical Research, Kaohsiung Medical University Hospital, Kaohsiung 807, Taiwan 3 Graduate Institute of Medicine, College of Medicine, Kaohsiung Medical University, Kaohsiung 807, Taiwan 4 Department of Biological Sciences, National Sun Yat-Sen University, Kaohsiung 804, Taiwan * Correspondence: [email protected] (S.-J.C.); [email protected] (Y.-R.H.) Abstract: Beta2-microglobulin (B2M) a key component of major histocompatibility complex class I molecules, which aid cytotoxic T-lymphocyte (CTL) immune response. However, the majority of studies of B2M have focused only on amyloid fibrils in pathogenesis to the neglect of its role of antimicrobial activity. Indeed, B2M also plays an important role in innate defense and does not only function as an adjuvant for CTL response. A previous study discovered that human aggregated B2M binds the surface protein structure in Streptococci, and a similar study revealed that sB2M-9, derived from native B2M, functions as an antibacterial chemokine that binds Staphylococcus aureus. An investigation of sB2M-9 exhibiting an early lymphocyte recruitment in the human respiratory epithelium with bacterial challenge may uncover previously unrecognized aspects of B2M in the Citation: Chiou, S.-J.; Ko, H.-J.; body’s innate defense against Mycobactrium tuberculosis.
  • Breakdown of Supersaturation Barrier Links Protein Folding to Amyloid Formation

    Breakdown of Supersaturation Barrier Links Protein Folding to Amyloid Formation

    ARTICLE https://doi.org/10.1038/s42003-020-01641-6 OPEN Breakdown of supersaturation barrier links protein folding to amyloid formation Masahiro Noji1,11, Tatsushi Samejima1, Keiichi Yamaguchi1,12, Masatomo So 1, Keisuke Yuzu2, Eri Chatani2, Yoko Akazawa-Ogawa3, Yoshihisa Hagihara3, Yasushi Kawata4, Kensuke Ikenaka5, Hideki Mochizuki5, ✉ József Kardos6, Daniel E. Otzen 7, Vittorio Bellotti 8,9, Johannes Buchner 10 & Yuji Goto 1,12 1234567890():,; The thermodynamic hypothesis of protein folding, known as the “Anfinsen’s dogma” states that the native structure of a protein represents a free energy minimum determined by the amino acid sequence. However, inconsistent with the Anfinsen’s dogma, globular proteins can misfold to form amyloid fibrils, which are ordered aggregates associated with diseases such as Alzheimer’s and Parkinson’s diseases. Here, we present a general concept for the link between folding and misfolding. We tested the accessibility of the amyloid state for various proteins upon heating and agitation. Many of them showed Anfinsen-like reversible unfolding upon heating, but formed amyloid fibrils upon agitation at high temperatures. We show that folding and amyloid formation are separated by the supersaturation barrier of a protein. Its breakdown is required to shift the protein to the amyloid pathway. Thus, the breakdown of supersaturation links the Anfinsen’s intramolecular folding universe and the intermolecular misfolding universe. 1 Institute for Protein Research, Osaka University, Yamadaoka 3-2, Suita, Osaka 565-0871, Japan. 2 Department of Chemistry, Graduate School of Science, Kobe University, Hyogo 657-8501, Japan. 3 National Institute of Advanced Industrial Science and Technology (AIST), 1-8-31 Midorigaoka, Ikeda, Osaka 563- 8577, Japan.
  • (12) United States Patent (10) Patent No.: US 7,537,914 B1 Roux Et Al

    (12) United States Patent (10) Patent No.: US 7,537,914 B1 Roux Et Al

    USOO7537914B1 (12) United States Patent (10) Patent No.: US 7,537,914 B1 ROux et al. (45) Date of Patent: May 26, 2009 (54) NUCLEICACID AND ALLERGENIC (58) Field of Classification Search ................ 435/69.1, POLYPEPTIDESENCODED THEREBY IN 435/252.3,320.1; 530/350; 536/23.5 CASHEW NUTS (ANACARDIUM See application file for complete search history. OCCIDENTALE) (56) References Cited (75) Inventors: Kenneth Roux, Tallahassee, FL (US); U.S. PATENT DOCUMENTS Shridhar K. Sathe, Tallahassee, FL (US); Jason M. Robotham, Tallahassee, 6,362,399 B1* 3/2002 Kinney et al. ............... 800/312 FL (US); Suzanne S. Teuber, Davis, CA (US) OTHER PUBLICATIONS Wang etal, J Allergy Clin Immunol 110: 160-6, 2002.* (73) Assignee: Florida State University Research Chica et al. Curr Opin Biotechnol 16(4):378-84. Aug. 2005.* Foundation, Inc., Tallahassee, FL (US) Witkowski et al. Biochemistry 38(36): 11643-50, Sep. 7, 1999.* Stanley et al. Arch Biochem Biophys 342(2): 244-53, Jun. 1997.* (*) Notice: Subject to any disclaimer, the term of this patent is extended or adjusted under 35 * cited by examiner U.S.C. 154(b) by 323 days. Primary Examiner Phuong Huynh (74) Attorney, Agent, or Firm Allen, Dyer, Doppelt, (21) Appl. No.: 10/529,602 Milbrath & Gilchrist, PA. (22) PCT Filed: Nov. 4, 2003 (57) ABSTRACT (86). PCT No.: PCT/USO3F34960 The invention describes an isolated nucleic acid sequence S371 (c)(1), comprising the nucleotide sequence of SEQ ID NO:1 or a (2), (4) Date: Mar. 30, 2005 degenerate variant of SEQ ID NO:1. The nucleic acid sequence encodes an Ig-Ebinding immunogenic polypeptide (87) PCT Pub.
  • Regina Qu'appelle Health Region Tests

    Regina Qu'appelle Health Region Tests

    Regina Qu'Appelle Health Region Tests Acetaminophen Haptoglobin Alpha-Feto Protein (AFP) HbA1C AGBM Hemoglobin Electrophoresis Albumin Hemosiderin (urine) Alkaline Phosphatase (ALP) Kleihauer-Betke Test Alpha-1 Antitrypsin Lactate Alanine Aminotransferase (ALT) Luteinizing Hormone (LH) Amylase Lipid Panel (Chol, Trig, HDL, LDL ) Anti-mitochondrial antibodies Lithium Anti-RNP Liver Panel (Bili, ALT, ALP) Anti-scleroderma-70 antibodies Magnesium Anti-smooth muscle antibodies Malaria Blood Smear APTT - fresh specimen Methemalbumin Aspartate aminotransferase (AST) Microalbumin Bence Jones Protein (50-100mls 24 hour urine) Microalbumin/Creatinine Ratio Beta HCG Hypercoagulation Studies Direct Bilirubin Osmolality (Serum and Urine) Total Bilirubin Peripheral Smear review by pathologist CA-125 Phenobarbital Calcium Phenytoin (Dilantin) Carbamazepine (Tegretol) Phosphorus CBC Prolactin Carcinoembryonic Antigen (CEA) Prostate Specific Antigen (PSA) Cholinesterase w/ Dibucaine # Prothrombin Time Creatine kinase (CK) Protein Electrophoresis (PE, SPE) Creatinine (Serum and Urine) Protein Creatinine Clearance Renal Panel Cryoglobulin Reticulocyte Count Cyclosporin Sickle Cell Screen D-Dimer Sirolimus Digoxin (Lanoxin) Tacrolimus Electrolytes Theophylline Estradiol Thyroid Screen (TSH) Ferritin Tobramycin FSH Urea G-6-PD Uric Acid Gentamycin Valproic Acid (Epival, Depakene) G-Glutamyl Transferase (GGT) Vancomycin Glucose Viscosity Frozen Specimens Amikacin Factor Assays Lupus Anticoagulant Ammonia Fibrinogen Protein C Anticardiolipin Ab Heparin Assay Protein S Antiphospholipid Ab Hypercoagulation Screen Von Willebrand's Factor Anti-thrombin III H. Pylori Beta-2 Microglobulin Lactic Acid For more information refer to the RQHR Laboratory Services Manual or access the link below: RQHR Laboratory Specimen Requirements LABLisOP2002A3 RQHR Tests Laboratory Services, Regina Qu'Appelle Health Region 03/05/2016.
  • Impact of High Pressure Processing on Immunoreactivity and Some Physico-Chemical Properties of Almond Milk THESIS Presented in P

    Impact of High Pressure Processing on Immunoreactivity and Some Physico-Chemical Properties of Almond Milk THESIS Presented in P

    Impact of High Pressure Processing on Immunoreactivity and Some Physico-chemical Properties of Almond Milk THESIS Presented in Partial Fulfillment of the Requirements for the Degree Master of Science in the Graduate School of The Ohio State University By Santosh Dhakal Graduate Program in Food Science and Technology The Ohio State University 2013 Master's Examination Committee: Professor V. M. Balasubramaniam, Advisor Professor Sheryl Barringer Professor Monica Giusti Copyrighted by Santosh Dhakal 2013 ABSTRACT Almond milk as a beverage has recently gained attention with increase in consumer awareness about health benefits of plant based beverages. The objective of this research was to investigate the influence of high pressure processing (HPP) on residual mmunoreactivity, protein solubility, and other selected quality attributes. Almond milk was prepared by disintegrating 10% almonds with water and were subjected to high pressure processing (HPP; 450 and 600 MPa at 30oC up to 600 s) and thermal processing (TP; 72, 85 and 99 oC, 0.1 MPa up to 600 s). After HPP (for all holding times), amandin, a key thermally resistant almond allergen, can no longer be detected by the anti-conformational epitopes MAb in ELISA while signal generated from the anti-linear epitopes MAb was reduced by half (P < 0.05). On the other hand, most TP samples did not show significant reductions in immunoreactivity (P > 0.05) unless processed at 85 and 99 °C for 300 s. Western blot (applicable for soluble proteins) and dot blot (applicable for soluble and insoluble proteins) also confirmed the loss of immunoreactivity by both antibodies for HPP almond milk.
  • Gene Duplication and an Accelerated Evolutionary Rate in 11S Globulin Genes Are Associated with Higher Protein Synthesis in Dicots As Compared to Monocots

    Gene Duplication and an Accelerated Evolutionary Rate in 11S Globulin Genes Are Associated with Higher Protein Synthesis in Dicots As Compared to Monocots

    Gene duplication and an accelerated evolutionary rate in 11S globulin genes are associated with higher protein synthesis in dicots as compared to monocots Article Published Version Li, C., Li, M., Dunwell, J. and Zhang, Y.-M. (2012) Gene duplication and an accelerated evolutionary rate in 11S globulin genes are associated with higher protein synthesis in dicots as compared to monocots. BMC Evolutionary Biology, 12 (15). ISSN 1471-2148 doi: https://doi.org/10.1186/1471- 2148-12-15 Available at http://centaur.reading.ac.uk/26292/ It is advisable to refer to the publisher’s version if you intend to cite from the work. See Guidance on citing . To link to this article DOI: http://dx.doi.org/10.1186/1471-2148-12-15 Publisher: BioMed Central Ltd All outputs in CentAUR are protected by Intellectual Property Rights law, including copyright law. Copyright and IPR is retained by the creators or other copyright holders. Terms and conditions for use of this material are defined in the End User Agreement . www.reading.ac.uk/centaur CentAUR Central Archive at the University of Reading Reading’s research outputs online Li et al. BMC Evolutionary Biology 2012, 12:15 http://www.biomedcentral.com/1471-2148/12/15 RESEARCHARTICLE Open Access Gene duplication and an accelerated evolutionary rate in 11S globulin genes are associated with higher protein synthesis in dicots as compared to monocots Chun Li1,2†, Meng Li1†, Jim M Dunwell3 and Yuan-Ming Zhang1* Abstract Background: Seed storage proteins are a major source of dietary protein, and the content of such proteins determines both the quantity and quality of crop yield.
  • Structural Characterization of Bacterial Defense Complex Marko Nedeljković

    Structural Characterization of Bacterial Defense Complex Marko Nedeljković

    Structural characterization of bacterial defense complex Marko Nedeljković To cite this version: Marko Nedeljković. Structural characterization of bacterial defense complex. Biomolecules [q-bio.BM]. Université Grenoble Alpes, 2017. English. NNT : 2017GREAV067. tel-03085778 HAL Id: tel-03085778 https://tel.archives-ouvertes.fr/tel-03085778 Submitted on 22 Dec 2020 HAL is a multi-disciplinary open access L’archive ouverte pluridisciplinaire HAL, est archive for the deposit and dissemination of sci- destinée au dépôt et à la diffusion de documents entific research documents, whether they are pub- scientifiques de niveau recherche, publiés ou non, lished or not. The documents may come from émanant des établissements d’enseignement et de teaching and research institutions in France or recherche français ou étrangers, des laboratoires abroad, or from public or private research centers. publics ou privés. THÈSE Pour obtenir le grade de DOCTEUR DE LA COMMUNAUTE UNIVERSITE GRENOBLE ALPES Spécialité : Biologie Structurale et Nanobiologie Arrêté ministériel : 25 mai 2016 Présentée par Marko NEDELJKOVIĆ Thèse dirigée par Andréa DESSEN préparée au sein du Laboratoire Institut de Biologie Structurale dans l'École Doctorale Chimie et Sciences du Vivant Caractérisation structurale d'un complexe de défense bactérienne Structural characterization of a bacterial defense complex Thèse soutenue publiquement le 21 décembre 2017, devant le jury composé de : Monsieur Herman VAN TILBEURGH Professeur, Université Paris Sud, Rapporteur Monsieur Laurent TERRADOT Directeur de Recherche, Institut de Biologie et Chimie des Protéines, Rapporteur Monsieur Patrice GOUET Professeur, Université Lyon 1, Président Madame Montserrat SOLER-LOPEZ Chargé de Recherche, European Synchrotron Radiation Facility, Examinateur Madame Andréa DESSEN Directeur de Recherche, Institut de Biologie Structurale , Directeur de These 2 Contents ABBREVIATIONS ..............................................................................................................................