Global Journal of Human Social Science

Total Page:16

File Type:pdf, Size:1020Kb

Load more

Online ISSN: 2249-460X Print ISSN: 0975-587X DOI: 10.17406/GJHSS AssessmentofPopulationGrowth NarrativesofEnvironmentalIssues IndigenousKhasiTribeofMeghalaya ArtefactsofViolenceoftheBronze VOLUME21ISSUE1VERSION1.0 Global Journal of Human-Social Science: B Geography, Geo-Sciences, Environmental Science & Disaster Management Global Journal of Human-Social Science: B Geography, Geo-Sciences, Environmental Science & Disaster Management Volume 2 1 Issue 1 (Ver. 1.0) Open Association of Research Society Global Journals Inc. *OREDO-RXUQDORI+XPDQ (A Delaware USA Incorporation with “Good Standing”; Reg. Number: 0423089) Social Sciences. 2021. Sponsors:Open Association of Research Society Open Scientific Standards $OOULJKWVUHVHUYHG 7KLVLVDVSHFLDOLVVXHSXEOLVKHGLQYHUVLRQ Publisher’s Headquarters office RI³*OREDO-RXUQDORI+XPDQ6RFLDO 6FLHQFHV´%\*OREDO-RXUQDOV,QF Global Journals ® Headquarters $OODUWLFOHVDUHRSHQDFFHVVDUWLFOHVGLVWULEXWHG XQGHU³*OREDO-RXUQDORI+XPDQ6RFLDO 945th Concord Streets, 6FLHQFHV´ Framingham Massachusetts Pin: 01701, 5HDGLQJ/LFHQVHZKLFKSHUPLWVUHVWULFWHGXVH United States of America (QWLUHFRQWHQWVDUHFRS\ULJKWE\RI³*OREDO -RXUQDORI+XPDQ6RFLDO6FLHQFHV´XQOHVV USA Toll Free: +001-888-839-7392 RWKHUZLVHQRWHGRQVSHFLILFDUWLFOHV USA Toll Free Fax: +001-888-839-7392 1RSDUWRIWKLVSXEOLFDWLRQPD\EHUHSURGXFHG Offset Typesetting RUWUDQVPLWWHGLQDQ\IRUPRUE\DQ\PHDQV HOHFWURQLFRUPHFKDQLFDOLQFOXGLQJ SKRWRFRS\UHFRUGLQJRUDQ\LQIRUPDWLRQ Global Journals Incorporated VWRUDJHDQGUHWULHYDOV\VWHPZLWKRXWZULWWHQ 2nd, Lansdowne, Lansdowne Rd., Croydon-Surrey, SHUPLVVLRQ Pin: CR9 2ER, United Kingdom 7KHRSLQLRQVDQGVWDWHPHQWVPDGHLQWKLV ERRNDUHWKRVHRIWKHDXWKRUVFRQFHUQHG 8OWUDFXOWXUHKDVQRWYHULILHGDQGQHLWKHU Packaging & Continental Dispatching FRQILUPVQRUGHQLHVDQ\RIWKHIRUHJRLQJDQG QRZDUUDQW\RUILWQHVVLVLPSOLHG Global Journals Pvt Ltd (QJDJHZLWKWKHFRQWHQWVKHUHLQDW\RXURZQ E-3130 Sudama Nagar, Near Gopur Square, ULVN Indore, M.P., Pin:452009, India 7KHXVHRIWKLVMRXUQDODQGWKHWHUPVDQG FRQGLWLRQVIRURXUSURYLGLQJLQIRUPDWLRQLV JRYHUQHGE\RXU'LVFODLPHU7HUPVDQG Find a correspondence nodal officer near you &RQGLWLRQVDQG3ULYDF\3ROLF\JLYHQRQRXU ZHEVLWHKWWSJOREDOMRXUQDOVus WHUPVDQG FRQGLWLRQPHQXLG1463/ To find nodal officer of your country, please email us at [email protected] %\UHIHUULQJXVLQJUHDGLQJDQ\W\SHRI DVVRFLDWLRQUHIHUHQFLQJWKLVMRXUQDOWKLV VLJQLILHVDQG\RXDFNQRZOHGJHWKDW\RXKDYH eContacts UHDGWKHPDQGWKDW\RXDFFHSWDQGZLOOEH ERXQGE\WKHWHUPVWKHUHRI Press Inquiries: [email protected] $OOLQIRUPDWLRQMRXUQDOVWKLVMRXUQDO DFWLYLWLHVXQGHUWDNHQPDWHULDOVVHUYLFHVDQG Investor Inquiries: [email protected] RXUZHEVLWHWHUPVDQGFRQGLWLRQVSULYDF\ Technical Support: [email protected] SROLF\DQGWKLVMRXUQDOLVVXEMHFWWRFKDQJH DQ\WLPHZLWKRXWDQ\SULRUQRWLFH Media & Releases: [email protected] Incorporation No.: 0423089 License No.: 42125/022010/1186 Registration No.: 430374 Import-Export Code: 1109007027 Pricing (E xcluding Air Parcel Charges): Employer Identification Number (EIN): USA Tax ID: 98-0673427 Yearly Subscription (Personal & Institutional) 250 USD (B/W) & 350 USD (Color) Editorial Board Global Journal of Human-Social Science Dr. Arturo Diaz Suarez Dr. Adrian Armstrong Ed.D., Ph.D. in Physical Education Professor at BSc Geography, LSE, 1970 Ph.D. Geography University of Murcia, Spain (Geomorphology) Kings College London 1980 Ordained Priest, Church of England 1988 Taunton, Somerset, United Kingdom Dr. Prasad V Bidarkota Dr. Gisela Steins Ph.D., Department of Economics Florida International Ph.D. Psychology, University of Bielefeld, Germany University United States Professor, General and Social Psychology, University of Duisburg-Essen, Germany Dr. Alis Puteh Dr. Stephen E. Haggerty Ph.D. (Edu.Policy) UUM Sintok, Kedah, Malaysia M.Ed Ph.D. Geology & Geophysics, University of London (Curr. & Inst.) University of Houston, United States Associate Professor University of Massachusetts, United States Dr. André Luiz Pinto Dr. Helmut Digel Doctorate in Geology, PhD in Geosciences and Ph.D. University of Tbingen, Germany Honorary President Environment, Universidade Estadual Paulista Julio of German Athletic Federation (DLV), Germany de Mesuita Filho, UNESP, Sao Paulo, Brazil Dr. Tanyawat Khampa Dr. Hamada Hassanein Ph.d in Candidate (Social Development), MA. in Social Ph.D, MA in Linguistics, BA & Education in English, Development, BS. in Sociology and Anthropology, Department of English, Faculty of Education, Mansoura Naresuan University, Thailand University, Mansoura, Egypt Dr. Gomez-Piqueras, Pedro Dr. Asuncin Lpez-Varela Ph.D in Sport Sciences, University Castilla La Mancha, BA, MA (Hons), Ph.D. (Hons) Facultad de Filolog?a. Spain Universidad Complutense Madrid 29040 Madrid Spain Dr. Faisal G. Khamis Dr. Mohammed Nasser Al-Suqri Ph.D in Statistics, Faculty of Economics & Ph.D., M.S., B.A in Library and Information Management, Administrative Sciences / AL-Zaytoonah University of Sultan Qaboos University, Oman Jordan, Jordan Dr. Giaime Berti Dr. Vesna Stankovic Pejnovic Ph.D. School of Economics and Management University Ph. D. Philosophy Zagreb, Croatia Rusveltova, Skopje of Florence, Italy Macedonia Dr. Valerie Zawilski Dr. Raymond K. H. Chan Associate Professor, Ph.D., University of Toronto MA - Ph.D., Sociology, University of Essex, UK Associate Ontario Institute for Studies in Education, Canada Professor City University of Hong Kong, China Dr. Edward C. Hoang Dr. Tao Yang Ph.D., Department of Economics, University of Ohio State University M.S. Kansas State University B.E. Colorado United States Zhejiang University, China Dr. Intakhab Alam Khan Mr. Rahul Bhanubhai Chauhan Ph.D. in Doctorate of Philosophy in Education, King B.com., M.com., MBA, PhD (Pursuing), Assistant Professor, Abdul Aziz University, Saudi Arabia Parul Institute of Business Administration, Parul University, Baroda, India Dr. Kaneko Mamoru Dr. Rita Mano Ph.D., Tokyo Institute of Technology Structural Ph.D. Rand Corporation and University of California, Los Engineering Faculty of Political Science and Economics, Angeles, USA Dep. of Human Services, University of Haifa Waseda University, Tokyo, Japan Israel Dr. Joaquin Linne Dr. Cosimo Magazzino Ph. D in Social Sciences, University of Buenos Aires, Aggregate Professor, Roma Tre University Rome, 00145, Argentina Italy Dr. Hugo Nami Dr. S.R. Adlin Asha Johnson Ph.D.in Anthropological Sciences, Universidad of Ph.D, M. Phil., M. A., B. A in English Literature, Bharathiar Buenos Aires, Argentina, University of Buenos Aires, University, Coimbatore, India Argentina Dr. Luisa dall’Acqua Dr. Thierry Feuillet Ph.D. in Sociology (Decisional Risk sector), Master MU2, Ph.D in Geomorphology, Master’s Degree in College Teacher, in Philosophy (Italy), Edu-Research Geomorphology, University of Nantes, France Group, Zrich/Lugano Contents of the Issue i. Copyright Notice ii. Editorial Board Members iii. Chief Author and Dean iv. Contents of the Issue 1. Narratives of Environmental Issues at the Pradoso’s District of Vitória Da Conquista City in Bahia State/Brazil. 1-10 2. Artefacts of Violence of the Bronze and Copper Ages in the South of Western Siberia. 11-25 3. Assessment of Population Growth on Vegetation Cover in Numan, Demsa and Lamurde Lgas Areas of Adamawa State. 27-37 4. Analysis of Water Quality for Domestic use in Lafia Town, Nasarawa State, Nigeria. 39-47 5. Indigenous Khasi Tribe of Meghalaya and Environmental Sustainability: A Study. 49-53 v. Fellows vi. Auxiliary Memberships vii. Preferred Author Guidelines viii. Index Global Journal of HUMAN-SOCIAL SCIENCE: B Geography, Geo-Sciences, Environmental Science & Disaster Management Volume 21 Issue 1 Version 1.0 Year 2021 Type: Double Blind Peer Reviewed International Research Journal Publisher: Global Journals Online ISSN: 2249-460x & Print ISSN: 0975-587X Narratives of Environmental Issues at the Pradoso’s District of Vitória Da Conquista City in Bahia State/Brazil By Vânia Mendes Da Silva Novais & Luiz Artur Dos Santos Cestari University of Southwestern Bahia Abstract- This research will propose the appreciation of local knowledge that came from intellectuals of tradition living at the Pradoso’s district located in Vitória da Conquista-BA city, and it aims to understand an epistemology that expresses their specific aspects. It will point out the knowledge using an ecology that will take into an account at the same time the nonscientific understanding from these people and a theoretical standing against the epistemological practices from the dominant paradigm of modernity. The data were collected using narratives with older people in Pradoso's district as an empirical study of narrative inquiry about ways of life and environmental issues belonging to the culture of this peasant community. Hence, we believe the narratives offered a vital dialogue between emerged knowledge and scientific culture whose objective is describing the environmental issues at this community, valorizing traditional understanding and finding accordance with academic and scientific culture. Keywords: ecology of knowledge. intellectuals of tradition. narratives. GJHSS-B Classification: FOR Code: 050299 NarrativesofEnvironmentalIssuesatthePradososDistrictofVitriaDaConquistaCityinBahiaStateBrazil Strictly as per the compliance and regulations of: © 2021. Vânia Mendes Da Silva Novais & Luiz Artur Dos Santos Cestari. This is a research/review paper, distributed under the terms of the Creative Commons Attribution-Noncommercial 3.0 Unported License http://creativecommons.org/licenses/by-nc/ 3.0/), permitting all non-commercial
Recommended publications
  • 1557 the Impact of Holocene Climate on the Development

    1557 the Impact of Holocene Climate on the Development

    RADIOCARBON, Vol 52, Nr 4, 2010, p 1557–1569 © 2010 by the Arizona Board of Regents on behalf of the University of Arizona THE IMPACT OF HOLOCENE CLIMATE ON THE DEVELOPMENT OF PREHISTORIC SOCIETIES IN SOUTHERN SIBERIA Marianna Kulkova Department of Geology and Geoecology, Radiocarbon Lab, State Herzen Pedagogical University, St. Petersburg, Russia. Corresponding author. Email: [email protected]. Sergey Krasnienko Institute for the History of Material Culture Russian Academy of Science, St. Petersburg, Russia. ABSTRACT. Geochemical data of 10Be, 14C, 18O obtained from natural archives (tree rings, ice sheets, varves, corals) indi- cates that the climate during the Holocene was not stable. The cosmogenic isotope fluctuations are bound by the periodicity on solar activity and climatic changes. The sharpest and most abrupt climatic deteriorations are registered in the Early and Middle Holocene at 8200, 5800, 5400, 4300, and 2800 cal BP. These events are characterized by cold conditions. The impact of climate on human communities in steppe depressions in southern Siberia (Nazarovo, Minusinsk, and Turano-Uyuk) was noticeable. The differences of local landscape-climatic conditions in these depressions were connected with global climatic changes to determine the processes of occupation, development, and migrations of ancient societies during the Neolithic, Bronze Age, and Iron Age. The chronology of archaeological cultures was also correlated with the local and global climatic changes during the Early and Middle Holocene in southern Siberia. Here, we generalize the literature data about Holocene cli- matic changes and archaeological cultures in the southern Siberia region. INTRODUCTION Climatic fluctuations influenced the development of prehistoric societies. The Holocene period had one of the most favorable climates in human history.
  • Millet Consumption in Siberia Prior to Mid-Second

    Millet Consumption in Siberia Prior to Mid-Second

    Radiocarbon, Vol 00, Nr 00, 2021, p 1–8 DOI:10.1017/RDC.2021.53 © The Author(s), 2021. Published by Cambridge University Press on behalf of the Arizona Board of Regents on behalf of the University of Arizona. This is an Open Access article, distributed under the terms of the Creative Commons Attribution licence (http://creativecommons.org/licenses/by/4.0/), which permits unrestricted re-use, distribution, and reproduction in any medium, provided the original work is properly cited. MILLET CONSUMPTION IN SIBERIA PRIOR TO MID-SECOND MILLENNIUM BC? A REVIEW OF RECENT DEVELOPMENTS Svetlana V Svyatko1* • Rick J Schulting2 • Dmitriy Papin3,4 • Paula J Reimer1 1Queen’s University Belfast, 14Chrono Centre for Climate, the Environment, and Chronology, Belfast BT7 1NN UK 2University of Oxford, School of Archaeology, 1 South Parks Road, Oxford, UK 3Altay State University, Barnaul Laboratory of Archaeology and Ethnography of South Siberia, Barnaul, Russia 4Siberian Branch of the Russian Academy of Sciences, Institute of Archaeology and Ethnography, Novosibirsk, Russia ABSTRACT. In this paper we discuss recent developments in documenting the spread of millet across the Eurasian steppes. We emphasize that, despite a recent proposal that millet consumption in southern Siberia can be attributed to the Early Bronze Age (i.e., the late third to early second millennium BC), at present there are no direct data for southern Siberia indicating the consumption of millet prior to the Late Bronze Age, from the 14th century BC. We also present in full the combined stable isotope and 14C datasets from the Minusinsk Basin to support this conclusion. KEYWORDS: Bronze Age, millet, Minusinsk Basin, radiocarbon dating, stable isotopes.
  • 191693318.Pdf

    191693318.Pdf

    RADIOCARBON, Vol 51, Nr 1, 2009, p 243–273 © 2009 by the Arizona Board of Regents on behalf of the University of Arizona NEW RADIOCARBON DATES AND A REVIEW OF THE CHRONOLOGY OF PREHISTORIC POPULATIONS FROM THE MINUSINSK BASIN, SOUTHERN SIBERIA, RUSSIA Svetlana V Svyatko1,2 • James P Mallory1 • Eileen M Murphy1 • Andrey V Polyakov3 • Paula J Reimer1 • Rick J Schulting4 ABSTRACT. The results are presented of a new program of radiocarbon dating undertaken on 88 human skeletons. The indi- viduals derived from Eneolithic to Early Iron Age sites—Afanasievo, Okunevo, Andronovo (Fedorovo), Karasuk, and Tagar cultures—in the Minusinsk Basin of Southern Siberia. All the new dates have been acquired from human bone, which is in contrast to some of the previous dates for this region obtained from wood and thus possibly unreliable due to old-wood effects or re-use of the timber. The new data are compared with the existing 14C chronology for the region, thereby enabling a clearer understanding to be gained concerning the chronology of these cultures and their place within the prehistory of the Eurasian steppes. INTRODUCTION The results of radiocarbon dating are of particular importance for the establishment of the chronol- ogy of cultures not recorded in written sources, as is the case for most of the cultures of prehistoric Southern Siberia. Some of the first 14C dates obtained for the prehistoric complexes of Southern Siberia (Scythian monuments of the Altai Mountain region) were published in Radiocarbon in 1965 (Butomo 1965), and since then the various aspects of the area’s 14C chronology have been presented and discussed in its pages (e.g.
  • Siberia) Over the Last 8000 Years and Their Impact on the Types of Economic Life of the Population

    Siberia) Over the Last 8000 Years and Their Impact on the Types of Economic Life of the Population

    Quaternary Science Reviews 163 (2017) 152e161 Contents lists available at ScienceDirect Quaternary Science Reviews journal homepage: www.elsevier.com/locate/quascirev Environmental dynamics of the Baraba forest-steppe (Siberia) over the last 8000 years and their impact on the types of economic life of the population * Snezhana Zhilich a, c, Natalia Rudaya a, b, d, g, , Sergei Krivonogov b, c, Larisa Nazarova d, e, f, Dmitry Pozdnyakov a, g a Institute of Archaeology and Ethnography SB RAS, Prospekt Ak. Lavrentieva 17, Novosibirsk, 630090, Russia b Novosibirsk State University, Ul. Pirogova 2, Novosibirsk, 630090, Russia c Institute of Geology and Mineralogy SB RAS, Prospekt Ak. Koptyuga 3, Novosibirsk, 630090, Russia d Kazan State University, Ul. Kremlyovskaya 18, Kazan, 420000, Russia e UniversitatPotsdam,€ Karl-Liebknecht-Straße 24e25, Golm, 14476, Potsdam, Germany f Alfred Wegener Institute, Helmholtz Center for Polar and Marine Research, Department of Periglacial Research, 14473, Telegrafenberg A43 Potsdam, Germany g Altai State University, Str. Lenina, 61, Barnaul, 656049, Russia article info abstract Article history: This article offers a reconstruction of the vegetation and climate of the south-western Siberian Baraba Received 16 February 2017 forest-steppe area during the last ca. 8000 years. The analysis of palynological data from the sediment Received in revised form core of Lake Bolshie Toroki using quantitative methods has made it possible to reconstruct changes of the 22 March 2017 dominant types of vegetation and mean July air temperatures. Coniferous forests grew in the vicinity of Accepted 22 March 2017 the lake, and mean July air temperatures were similar to present-day ones between 7.9 and 7.0 kyr BP.
  • New Radiocarbon Dates and a Review of the Chronology of Prehistoric Populations from the Minusinsk Basin, Southern Siberia, Russia

    New Radiocarbon Dates and a Review of the Chronology of Prehistoric Populations from the Minusinsk Basin, Southern Siberia, Russia

    RADIOCARBON, Vol 51, Nr 1, 2009, p 243–273 © 2009 by the Arizona Board of Regents on behalf of the University of Arizona NEW RADIOCARBON DATES AND A REVIEW OF THE CHRONOLOGY OF PREHISTORIC POPULATIONS FROM THE MINUSINSK BASIN, SOUTHERN SIBERIA, RUSSIA Svetlana V Svyatko1,2 • James P Mallory1 • Eileen M Murphy1 • Andrey V Polyakov3 • Paula J Reimer1 • Rick J Schulting4 ABSTRACT. The results are presented of a new program of radiocarbon dating undertaken on 88 human skeletons. The indi- viduals derived from Eneolithic to Early Iron Age sites—Afanasievo, Okunevo, Andronovo (Fedorovo), Karasuk, and Tagar cultures—in the Minusinsk Basin of Southern Siberia. All the new dates have been acquired from human bone, which is in contrast to some of the previous dates for this region obtained from wood and thus possibly unreliable due to old-wood effects or re-use of the timber. The new data are compared with the existing 14C chronology for the region, thereby enabling a clearer understanding to be gained concerning the chronology of these cultures and their place within the prehistory of the Eurasian steppes. INTRODUCTION The results of radiocarbon dating are of particular importance for the establishment of the chronol- ogy of cultures not recorded in written sources, as is the case for most of the cultures of prehistoric Southern Siberia. Some of the first 14C dates obtained for the prehistoric complexes of Southern Siberia (Scythian monuments of the Altai Mountain region) were published in Radiocarbon in 1965 (Butomo 1965), and since then the various aspects of the area’s 14C chronology have been presented and discussed in its pages (e.g.
  • Radiocarbon Chronology of Occupation of the Site Chicha And

    Radiocarbon Chronology of Occupation of the Site Chicha And

    Radiocarbon chronology of occupation of the site Chicha and Bayesian statistics for the assessment of a discontinuous transition from Late Bronze to Early Iron Age (West Siberia) Schneeweiss, J., Becker, F., Molodin, V. I., Parzinger, H., Marchenko, Z. V., & Svyatko, S. V. (2018). Radiocarbon chronology of occupation of the site Chicha and Bayesian statistics for the assessment of a discontinuous transition from Late Bronze to Early Iron Age (West Siberia). Russian Geology and Geophysics, 59(6), 635-651. https://doi.org/10.1016/j.rgg.2018.05.004 Published in: Russian Geology and Geophysics Document Version: Peer reviewed version Queen's University Belfast - Research Portal: Link to publication record in Queen's University Belfast Research Portal Publisher rights Copyright 2018 Elsevier. This manuscript is distributed under a Creative Commons Attribution-NonCommercial-NoDerivs License (https://creativecommons.org/licenses/by-nc-nd/4.0/), which permits distribution and reproduction for non-commercial purposes, provided the author and source are cited. General rights Copyright for the publications made accessible via the Queen's University Belfast Research Portal is retained by the author(s) and / or other copyright owners and it is a condition of accessing these publications that users recognise and abide by the legal requirements associated with these rights. Take down policy The Research Portal is Queen's institutional repository that provides access to Queen's research output. Every effort has been made to ensure that content in the Research Portal does not infringe any person's rights, or applicable UK laws. If you discover content in the Research Portal that you believe breaches copyright or violates any law, please contact [email protected].
  • 7 X 11.5 Double Line.P65

    7 X 11.5 Double Line.P65

    Cambridge University Press 978-0-521-82928-1 - The Urals and Western Siberia in the Bronze and Iron Ages Ludmila Koryakova and Andrej Vladimirovich Epimakhov Index More information INDEX Italics indicate figures Abashevo context, 180 Alanya, 228. See Yagn-Tsai Abashevo cultural area, 33, 57 Alexander the Great, 223, 225, 229 Abashevo cultural intercommunity, 180, 340n3 Altai, 27, 42, 53, 104, 108, 139, 161, 169, 170, 175, Abashevo culture, 57, 58, 79, 83, 97, 111, 136, 187, 188, 230, 231, 241, 292, 311 , 340n4 178 cassiterite deposits, 42 animals, 64 frozen tombs, 216 burial grounds, 61 tin, 323 elite kurgans, 65 Altai, mountains, 6, 27, 43, 108, 285, 31 0 , 331 funeral tradition, 63 area, 40, 41 groups, 122 Amu-Darya, river, 112, 228 influence, 66 Ananyino burial ground, 252 metal, 34, 35, 60, 62 Ananyino cosmological model, 260 ornaments, 60 Ananyino cultural groups, 194 pottery, 60, 74, 86 Ananyino culture, 195, 195, 196, 251, 253, 258, 259, settlement material, 60 312 , 330 settlements, 59, 60 animals, 257 living architecture, 60 burials, 254 territory, 109 pottery, 257 Abashevo groups, 45, 66, 99 settlements, 254, 276 Abashevo metallurgical center, 37 Ananyino intercommunity, 251, 276 Abashevo sites, 34, 36, 57, 62, 112 Ananyino metallurgical center, 194, 200 Abashevo tradition, 59, 319 Ananyino metallurgy, 195, 196, 200 Achaemenid, 225, 236, 238, 304, 305 influence, 194 adzes, 34, 37, 41, 42, 50, 93, 189, 196 Ananyino sites, 194, 252, 258 Aegean, 91, 96 Ananyino society, 258 Afanasyevo culture, 53, 123, 188, 343n2 symbolic system of,
  • Ancient Pottery of the Late Bronze Period in Western Siberia and Kazakhstan

    Ancient Pottery of the Late Bronze Period in Western Siberia and Kazakhstan

    Opción, Año 35, No.89 (2019): 913-931 ISSN 1012-1587/ISSNe: 2477-9385 Ancient pottery of the late bronze period in western Siberia and Kazakhstan Dubyagina Y. Al-Farabi Kazakh National University (Almaty, Kazakhstan) [email protected] Abstract The article discusses the characteristics of ancient ceramics of the Late Bronze period in the territory of Western Siberia and Kazakhstan. The research methodology includes both traditional for archeology methods of studying sources, and methods borrowed from the arsenal of natural and exact sciences. As a result, the comparative characteristics of Western Siberia and Kazakhstan in the late Bronze period clearly show cultural and historical differences in the formation of these communities. In conclusion, fragments of ceramics with the inclusion of small pieces of ore and slag were found. Keywords: Ceramics, Late Bronze, Culture, Archeology. Recibido: 10-11-2018 Aceptado: 10-03-2019 914 Dubyagina Y. Opción, Año 35, No.89 (2019): 913-931 Cerámica antigua de la Cerámica antigua al final de la Edad de Bronce en Siberia Occidental y Kazajstán Resumen El artículo analiza las características de las cerámicas antiguas del Bronce Tardío en el territorio de Siberia Occidental y Kazajstán. La metodología de investigación incluye métodos tradicionales de arqueología para el estudio de las fuentes y métodos tomados del arsenal de las ciencias naturales y exactas. Como resultado, las características comparativas de Siberia Occidental y Kazajstán en el período del Bronce tardío muestran claramente diferencias culturales e históricas en la formación de estas comunidades. En conclusión, se encontraron fragmentos de cerámica con la inclusión de pequeños trozos de mineral y escoria.
  • 7 17 2019 Main Manuscript FINAL Dr

    7 17 2019 Main Manuscript FINAL Dr

    Supplementary Materials The Formation of Human Populations in South and Central Asia Table of Contents S1 Description of Four Online Tables and the Online Data Visualizer ........................... 7 S2 Archeological descriptions of 523 newly reported ancient individuals .................... 12 S2.1 Overview ............................................................................................................................. 12 S2.2 Individuals from the Forest Zone / Steppe ....................................................................... 13 S2.2.1 Individuals from the Forest Zone in the Neolithic period ........................................................ 13 S2.2.1.1 West Siberian Hunter-Gatherers .......................................................................................... 13 S2.2.1.1.1 Sosnoviy-Ostrov, Tyumen Oblast, western Siberia, Russia (n=1) ................................ 13 S2.2.1.1.2 Mergen Settlements, Tyumen Oblast, western Siberia, Russia (n=2) ........................... 14 S2.2.2 Sites from the Steppe Zone in Early to Middle Bronze Age Cemeteries ................................. 16 S2.2.2.1 Kumsay (Kyryk Oba), Kazakhstan (n=4) ............................................................................ 16 S2.2.2.2 Mereke, Kazakhstan (n=3) ................................................................................................... 17 S2.2.2.3 Dali, Bayan-Zherek Valley, Kazakhstan (n=1) .................................................................... 18 S2.2.2.4 Yamnaya Pastoralists
  • A General Revision of the Chronology of the Tagisken North Burial Ground

    A General Revision of the Chronology of the Tagisken North Burial Ground

    Ancient Civilizations from Scythia to Siberia 24 (2018) 307-330 brill.com/acss A General Revision of the Chronology of the Tagisken North Burial Ground Gian Luca Bonora* ismeo [email protected] Abstract The burial ground of Tagisken North, characterised by seven monumental mau- solea and other adjoining structures made of mud brick and rammed earth, was excavated and studied by members of the “Khorezm Expedition” (KhAEE) in the 60’s and dated to the beginning of the 1st millennium BC (9th-8th centuries BC). This cemetery boasts a significant amount of artefacts pertaining to the Late Andronovo period. In light of new archaeological findings and recent chronological refinements, and thanks to improved scientific cooperation within the academic world, greater accu- racy in determining the chronology of steppe cultures through abundant radiocarbon dating and better research standards, the time has now come for a general revision of the chronology of this burial ground. The radiocarbon sequence for the Andronovo culture is notably a subject of heated debate, due to the wide range of absolute dating. The differences between the chronological frames of Central Asia proposed by Russian-Central Asian and foreign archaeologists are considerable. Calibrated dates have, of course, extended the tradi- tional periodization leading to alternative “high” chronologies, i.e. 300-500 years earlier than the traditional chronologies based on cross-cultural analogies and formal com- parisons. Steppe and Pre-Aral materials may now be unquestionably linked to artefacts from Middle Asia. In the best of circumstances, the latter may in turn be linked to historical chronologies established for the Ancient Near and Middle East.
  • Millet Consumption in Siberia

    Millet Consumption in Siberia

    Radiocarbon, Vol 00, Nr 00, 2021, p 1–8 DOI:10.1017/RDC.2021.53 © The Author(s), 2021. Published by Cambridge University Press on behalf of the Arizona Board of Regents on behalf of the University of Arizona. This is an Open Access article, distributed under the terms of the Creative Commons Attribution licence (http://creativecommons.org/licenses/by/4.0/), which permits unrestricted re-use, distribution, and reproduction in any medium, provided the original work is properly cited. MILLET CONSUMPTION IN SIBERIA PRIOR TO MID-SECOND MILLENNIUM BC? A REVIEW OF RECENT DEVELOPMENTS Svetlana V Svyatko1* • Rick J Schulting2 • Dmitriy Papin3,4 • Paula J Reimer1 1Queen’s University Belfast, 14Chrono Centre for Climate, the Environment, and Chronology, Belfast BT7 1NN UK 2University of Oxford, School of Archaeology, 1 South Parks Road, Oxford, UK 3Altay State University, Barnaul Laboratory of Archaeology and Ethnography of South Siberia, Barnaul, Russia 4Siberian Branch of the Russian Academy of Sciences, Institute of Archaeology and Ethnography, Novosibirsk, Russia ABSTRACT. In this paper we discuss recent developments in documenting the spread of millet across the Eurasian steppes. We emphasize that, despite a recent proposal that millet consumption in southern Siberia can be attributed to the Early Bronze Age (i.e., the late third to early second millennium BC), at present there are no direct data for southern Siberia indicating the consumption of millet prior to the Late Bronze Age, from the 14th century BC. We also present in full the combined stable isotope and 14C datasets from the Minusinsk Basin to support this conclusion. KEYWORDS: Bronze Age, millet, Minusinsk Basin, radiocarbon dating, stable isotopes.
  • Teoriya Practika 3(31) 2020.Pdf

    Teoriya Practika 3(31) 2020.Pdf

    ISSN 2307-2539 ̨ ̄ LJƺǃDžƽǔƽDŽDžƵƿLJƽƿƵ ƵDžNJƺǃǀǃƸƽnjƺdžƿƽNJ ƽdždžǀƺƹǃƷƵǂƽƾ ƸǠǕǗǢǰǞǥǚǙǕǟǧǣǥ Журнал основан в 2005 г., А.А. Тишкин, д-р ист. наук, профессор с 2016 г. выходит 4 раза в год. DžǚǙǕǟǫǝǣǢǢǕǴǟǣǠǠǚǘǝǴ Учредителем издания является В.В. Горбунов (зам. главного редактора), ФГБОУ ВО «Алтайский д-р ист. наук, доцент; государственный университет». С.П. Грушин, д-р ист. наук, доцент; Н.Н. Крадин, д-р ист. наук, профессор, чл.-корр. РАН; А.И. Кривошапкин, д-р ист. наук, профессор, чл.-корр. РАН; А.Л. Кунгуров, канд. ист. наук, доцент; Д.В. Папин (отв. секретарь), канд. ист. наук; Н.Н. Серегин (отв. секретарь), д-р ист. наук; С.С. Тур, канд. ист. наук; А.В. Харинский, д-р ист. наук, профессор; Ю.С. Худяков, д-р ист. наук, профессор DžǚǙǕǟǫǝǣǢǢǰǞǦǣǗǚǧǛǨǥǢǕǠǕ Ю.Ф. Кирюшин (председатель), д-р ист. наук, профессор (Россия); Д.Д. Андерсон, Ph.D., профессор (Великобритания); А. Бейсенов, канд. ист. наук (Казахстан); У. Бросседер, Ph.D. (Германия); А.П. Деревянко, д-р ист. наук, профессор, Утвержден к печати академик РАН (Россия); Объединенным И.В. Ковтун, д-р ист. наук (Россия); научно-тех ническим советом АГУ. Д.С. Коробов, д-р ист. наук, профессор (Россия); Все права защищены. Л.С. Марсадолов, д-р культурологии (Россия); Ни одна из частей журнала либо Д.Г. Савинов, д-р ист. наук, профессор (Россия); издание в целом не могут быть А.Г. Ситдиков, д-р ист. наук, доцент (Россия); перепечатаны без письменного И. Фодор, д-р археологии, профессор (Венгрия); разрешения авторов или издателя. М.Д. Фрачетти, Ph.D., профессор (США); Л. Чжан, Ph.D., профессор (Китай); Печатное издание «Теория и практи- Т.А.