Produktinformation

Total Page:16

File Type:pdf, Size:1020Kb

Load more

Produktinformation Diagnostik & molekulare Diagnostik Laborgeräte & Service Zellkultur & Verbrauchsmaterial Forschungsprodukte & Biochemikalien Weitere Information auf den folgenden Seiten! See the following pages for more information! Lieferung & Zahlungsart Lieferung: frei Haus Bestellung auf Rechnung SZABO-SCANDIC Lieferung: € 10,- HandelsgmbH & Co KG Erstbestellung Vorauskassa Quellenstraße 110, A-1100 Wien T. +43(0)1 489 3961-0 Zuschläge F. +43(0)1 489 3961-7 [email protected] • Mindermengenzuschlag www.szabo-scandic.com • Trockeneiszuschlag • Gefahrgutzuschlag linkedin.com/company/szaboscandic • Expressversand facebook.com/szaboscandic AK3 purified MaxPab mouse polyclonal antibody (B01P) Catalog # : H00050808-B01P 規格 : [ 50 ug ] List All Specification Application Image Product Mouse polyclonal antibody raised against a full-length human AK3 Western Blot (Cell lysate) Description: protein. Immunogen: AK3 (NP_057366.2, 1 a.a. ~ 227 a.a) full-length human protein. Sequence: MGASARLLRAVIMGAPGSGKGTVSSRITTHFELKHLSSGDLLRDNMLRG TEIGVLAKAFIDQGKLIPDDVMTRLALHELKNLTQYSWLLDGFPRTLPQA enlarge EALDRAYQIDTVINLNVPFEVIKQRLTARWIHPASGRVYNIEFNPPKTVGID DLTGEPLIQREDDKPETVIKRLKAYEDQTKPVLEYYQKKGVLETFSGTET Western Blot (Cell lysate) NKIWPYVYAFLQTKVPQRSQKASVTP Host: Mouse Reactivity: Human, Mouse Quality Control Antibody reactive against mammalian transfected lysate. enlarge Testing: Western Blot (Cell lysate) Storage Buffer: In 1x PBS, pH 7.4 Storage Store at -20°C or lower. Aliquot to avoid repeated freezing and thawing. Instruction: MSDS: Download enlarge Datasheet: Download Western Blot (Transfected lysate) Applications Western Blot (Cell lysate) enlarge AK3 MaxPab polyclonal antibody. Western Blot analysis of AK3 expression in HepG2. Protocol Download Western Blot (Cell lysate) Page 1 of 3 2016/5/23 AK3 MaxPab polyclonal antibody. Western Blot analysis of AK3 expression in Raw 264.7. Protocol Download Western Blot (Cell lysate) AK3 MaxPab polyclonal antibody. Western Blot analysis of AK3 expression in NIH/3T3. Protocol Download Western Blot (Transfected lysate) Western Blot analysis of AK3 expression in transfected 293T cell line (H00050808-T02) by AK3 MaxPab polyclonal antibody. Lane 1: AK3 transfected lysate(24.97 KDa). Lane 2: Non-transfected lysate. Protocol Download Gene Information Entrez GeneID: 50808 GeneBank NM_016282.2 Accession#: Protein NP_057366.2 Accession#: Gene Name: AK3 Gene Alias: AK3L1,AK6,AKL3L,AKL3L1,FIX Page 2 of 3 2016/5/23 Gene adenylate kinase 3 Description: Omim ID: 609290 Gene Ontology: Hyperlink Other OTTHUMP00000021016,adenylate kinase 3 alpha like,adenylate kinase Designations: 3 like 1,adenylate kinase 6, adenylate kinase 3 like 1 Gene Pathway Pyrimidine metabolism 服務條款 | 隱私權政策 | 著作及商標 | 網站地圖 ©2016 亞諾法生技股份有限公司 Abnova Corporation. 版權所有. Page 3 of 3 2016/5/23.
Recommended publications
  • Gene Expression Polarization

    Gene Expression Polarization

    Transcriptional Profiling of the Human Monocyte-to-Macrophage Differentiation and Polarization: New Molecules and Patterns of Gene Expression This information is current as of September 27, 2021. Fernando O. Martinez, Siamon Gordon, Massimo Locati and Alberto Mantovani J Immunol 2006; 177:7303-7311; ; doi: 10.4049/jimmunol.177.10.7303 http://www.jimmunol.org/content/177/10/7303 Downloaded from Supplementary http://www.jimmunol.org/content/suppl/2006/11/03/177.10.7303.DC1 Material http://www.jimmunol.org/ References This article cites 61 articles, 22 of which you can access for free at: http://www.jimmunol.org/content/177/10/7303.full#ref-list-1 Why The JI? Submit online. • Rapid Reviews! 30 days* from submission to initial decision by guest on September 27, 2021 • No Triage! Every submission reviewed by practicing scientists • Fast Publication! 4 weeks from acceptance to publication *average Subscription Information about subscribing to The Journal of Immunology is online at: http://jimmunol.org/subscription Permissions Submit copyright permission requests at: http://www.aai.org/About/Publications/JI/copyright.html Email Alerts Receive free email-alerts when new articles cite this article. Sign up at: http://jimmunol.org/alerts The Journal of Immunology is published twice each month by The American Association of Immunologists, Inc., 1451 Rockville Pike, Suite 650, Rockville, MD 20852 Copyright © 2006 by The American Association of Immunologists All rights reserved. Print ISSN: 0022-1767 Online ISSN: 1550-6606. The Journal of Immunology Transcriptional Profiling of the Human Monocyte-to-Macrophage Differentiation and Polarization: New Molecules and Patterns of Gene Expression1 Fernando O.
  • The Flagellar Arginine Kinase in Trypanosoma Brucei Is Important for Infection in Tsetse Flies

    The Flagellar Arginine Kinase in Trypanosoma Brucei Is Important for Infection in Tsetse Flies

    RESEARCH ARTICLE The Flagellar Arginine Kinase in Trypanosoma brucei Is Important for Infection in Tsetse Flies Cher-Pheng Ooi1¤, Brice Rotureau1, Simonetta Gribaldo2, Christina Georgikou1, Daria Julkowska1, Thierry Blisnick1, Sylvie Perrot1, Ines Subota1, Philippe Bastin1* 1 Trypanosome Cell Biology Unit, INSERM U1201, Institut Pasteur, 25 Rue du Docteur Roux, 75015, Paris, France, 2 Molecular Biology of Gene in Extremophiles Unit, Department of Microbiology, Institut Pasteur, 25 rue du Docteur Roux, 75015, Paris, France ¤ Current address: Department of Life Sciences, Sir Alexander Fleming Building, Imperial College-South Kensington, London, SW7 2AZ, United Kingdom * [email protected] Abstract OPEN ACCESS African trypanosomes are flagellated parasites that cause sleeping sickness. Parasites are Citation: Ooi C-P, Rotureau B, Gribaldo S, Georgikou C, Julkowska D, Blisnick T, et al. (2015) transmitted from one mammalian host to another by the bite of a tsetse fly. Trypanosoma The Flagellar Arginine Kinase in Trypanosoma brucei brucei possesses three different genes for arginine kinase (AK) including one (AK3) that Is Important for Infection in Tsetse Flies. PLoS ONE encodes a protein localised to the flagellum. AK3 is characterised by the presence of a 10(7): e0133676. doi:10.1371/journal.pone.0133676 unique amino-terminal insertion that specifies flagellar targeting. We show here a phyloge- Editor: Frank Voncken, University of Hull, UNITED netic analysis revealing that flagellar AK arose in two independent duplication events in KINGDOM T. brucei and T. congolense, the two species of African trypanosomes that infect the tsetse Received: April 11, 2015 midgut. In T. brucei, AK3 is detected in all stages of parasite development in the fly (in the Accepted: June 29, 2015 midgut and in the salivary glands) as well as in bloodstream cells, but with predominance at Published: July 28, 2015 insect stages.
  • Association of Gene Ontology Categories with Decay Rate for Hepg2 Experiments These Tables Show Details for All Gene Ontology Categories

    Association of Gene Ontology Categories with Decay Rate for Hepg2 Experiments These Tables Show Details for All Gene Ontology Categories

    Supplementary Table 1: Association of Gene Ontology Categories with Decay Rate for HepG2 Experiments These tables show details for all Gene Ontology categories. Inferences for manual classification scheme shown at the bottom. Those categories used in Figure 1A are highlighted in bold. Standard Deviations are shown in parentheses. P-values less than 1E-20 are indicated with a "0". Rate r (hour^-1) Half-life < 2hr. Decay % GO Number Category Name Probe Sets Group Non-Group Distribution p-value In-Group Non-Group Representation p-value GO:0006350 transcription 1523 0.221 (0.009) 0.127 (0.002) FASTER 0 13.1 (0.4) 4.5 (0.1) OVER 0 GO:0006351 transcription, DNA-dependent 1498 0.220 (0.009) 0.127 (0.002) FASTER 0 13.0 (0.4) 4.5 (0.1) OVER 0 GO:0006355 regulation of transcription, DNA-dependent 1163 0.230 (0.011) 0.128 (0.002) FASTER 5.00E-21 14.2 (0.5) 4.6 (0.1) OVER 0 GO:0006366 transcription from Pol II promoter 845 0.225 (0.012) 0.130 (0.002) FASTER 1.88E-14 13.0 (0.5) 4.8 (0.1) OVER 0 GO:0006139 nucleobase, nucleoside, nucleotide and nucleic acid metabolism3004 0.173 (0.006) 0.127 (0.002) FASTER 1.28E-12 8.4 (0.2) 4.5 (0.1) OVER 0 GO:0006357 regulation of transcription from Pol II promoter 487 0.231 (0.016) 0.132 (0.002) FASTER 6.05E-10 13.5 (0.6) 4.9 (0.1) OVER 0 GO:0008283 cell proliferation 625 0.189 (0.014) 0.132 (0.002) FASTER 1.95E-05 10.1 (0.6) 5.0 (0.1) OVER 1.50E-20 GO:0006513 monoubiquitination 36 0.305 (0.049) 0.134 (0.002) FASTER 2.69E-04 25.4 (4.4) 5.1 (0.1) OVER 2.04E-06 GO:0007050 cell cycle arrest 57 0.311 (0.054) 0.133 (0.002)
  • Role and Regulation of the P53-Homolog P73 in the Transformation of Normal Human Fibroblasts

    Role and Regulation of the P53-Homolog P73 in the Transformation of Normal Human Fibroblasts

    Role and regulation of the p53-homolog p73 in the transformation of normal human fibroblasts Dissertation zur Erlangung des naturwissenschaftlichen Doktorgrades der Bayerischen Julius-Maximilians-Universität Würzburg vorgelegt von Lars Hofmann aus Aschaffenburg Würzburg 2007 Eingereicht am Mitglieder der Promotionskommission: Vorsitzender: Prof. Dr. Dr. Martin J. Müller Gutachter: Prof. Dr. Michael P. Schön Gutachter : Prof. Dr. Georg Krohne Tag des Promotionskolloquiums: Doktorurkunde ausgehändigt am Erklärung Hiermit erkläre ich, dass ich die vorliegende Arbeit selbständig angefertigt und keine anderen als die angegebenen Hilfsmittel und Quellen verwendet habe. Diese Arbeit wurde weder in gleicher noch in ähnlicher Form in einem anderen Prüfungsverfahren vorgelegt. Ich habe früher, außer den mit dem Zulassungsgesuch urkundlichen Graden, keine weiteren akademischen Grade erworben und zu erwerben gesucht. Würzburg, Lars Hofmann Content SUMMARY ................................................................................................................ IV ZUSAMMENFASSUNG ............................................................................................. V 1. INTRODUCTION ................................................................................................. 1 1.1. Molecular basics of cancer .......................................................................................... 1 1.2. Early research on tumorigenesis ................................................................................. 3 1.3. Developing
  • Next-Generation Sequencing, FISH Mapping and Synteny- Based Modeling Reveal Mechanisms of Decreasing Dysploidy in Cucumis

    Next-Generation Sequencing, FISH Mapping and Synteny- Based Modeling Reveal Mechanisms of Decreasing Dysploidy in Cucumis

    The Plant Journal (2014) 77, 16–30 doi: 10.1111/tpj.12355 Next-generation sequencing, FISH mapping and synteny- based modeling reveal mechanisms of decreasing dysploidy in Cucumis Luming Yang1,†, Dal-Hoe Koo1,†, Dawei Li1,2, Tao Zhang1, Jiming Jiang1, Feishi Luan3, Susanne S. Renner4, Elizabeth Henaff 5, Walter Sanseverino6, Jordi Garcia-Mas6, Josep Casacuberta5, Douglas A. Senalik1,7, Philipp W. Simon1,7, Jinfeng Chen8 and Yiqun Weng1,7,* 1Horticulture Department, University of Wisconsin, Madison, WI 53706, USA, 2Horticulture College, Northwest A & F University, Yangling 712100, China, 3Horticulture College, Northeast Agricultural University, Harbin 150030, China, 4Department of Biology, University of Munich, 80638 Munich, Germany, 5Centre for Research in Agricultural Genomics Consejo Superior de Investigaciones Cientı´ficas-Institut de Recerca i Tecnolo- gia Agroalimenta` ries-Universitat Auto` noma de Barcelona-Universitat de Barcelona, 08193 Barcelona, Spain, 6Institut de Recerca i Tecnologia Agroalimenta` ries, Centre for Research in Agricultural Genomics Consejo Superior de Inves- tigaciones Cientı´ficas-Institut de Recerca i Tecnologia Agroalimenta` ries-Universitat Auto` noma de Barcelona-Universitat de Barcelona, 08193 Barcelona, Spain, 7US Department of Agriculture/Agricultural Research Service, Vegetable Crops Research Unit, 1575 Linden Drive, Madison, WI 53706, USA, and 8College of Horticulture, Nanjing Agricultural University, Nanjing 210095, China Received 27 July 2013; revised 7 October 2013; accepted 10 October 2013; published online 15 October 2013. *For correspondence (e-mail [email protected]). †These authors contributed equally to this work. SUMMARY In the large Cucurbitaceae genus Cucumis, cucumber (C. sativus) is the only species with 2n = 2x = 14 chro- mosomes. The majority of the remaining species, including melon (C.
  • Adenylate Kinase 4 Promotes Inflammatory Gene Expression Via

    Adenylate Kinase 4 Promotes Inflammatory Gene Expression Via

    ORIGINAL RESEARCH published: 15 March 2021 doi: 10.3389/fimmu.2021.630318 Adenylate Kinase 4 Promotes Inflammatory Gene Expression via Hif1α and AMPK in Macrophages Wei-Yao Chin 1, Chi-Ying He 1, Tsun Wai Chow 1, Qi-You Yu 2, Liang-Chuan Lai 2,3 and Shi-Chuen Miaw 1* 1 Graduate Institute of Immunology, National Taiwan University College of Medicine, Taipei, Taiwan, 2 Bioinformatics and Biostatistics Core, Center of Genomic and Precision Medicine, National Taiwan University, Taipei, Taiwan, 3 College of Medicine, Graduate Institute of Physiology, National Taiwan University, Taipei, Taiwan Macrophages comprise the front line of defense against various pathogens. Classically activated macrophages (M1), induced by IFN-γ and LPS, highly express inflammatory cytokines and contribute to inflammatory processes. By contrast, alternatively activated macrophages (M2) are induced by IL-4 and IL-13, produce IL-10, and display anti-inflammatory activity. Adenylate kinase 4 (Ak4), an enzyme that transfers phosphate group among ATP/GTP, AMP, and ADP, is a key modulator of ATP and maintains the homeostasis of cellular nucleotides which is essential for cell functions. However, its Edited by: role in regulating the function of macrophages is not fully understood. Here we report Guo-Chang Fan, University of Cincinnati, United States that Ak4 expression is induced in M1 but not M2 macrophages. Suppressing the Reviewed by: expression of Ak4 in M1 macrophages with shRNA or siRNA enhances ATP production Yutian Li, and decreases ROS production, bactericidal ability and glycolysis in M1 cells. Moreover, University of Cincinnati, United States Ak4 regulates the expression of inflammation genes, including Il1b, Il6, Tnfa, Nos2, Nox2, Frederick J.
  • An Adenylate Kinase Localized to the Cell Nucleus

    An Adenylate Kinase Localized to the Cell Nucleus

    The crystal structure of human adenylate kinase 6: An adenylate kinase localized to the cell nucleus Hui Ren*†‡, Liya Wang‡§, Matthew Bennett*‡, Yuhe Liang*, Xiaofeng Zheng†, Fei Lu¶, Lanfen Li*†, Jie Nan†, Ming Luo†ʈ, Staffan Eriksson§, Chuanmao Zhang¶, and Xiao-Dong Su*†** *National Laboratory of Protein Engineering and Plant Genetic Engineering and Departments of †Biochemistry and Molecular Biology and ¶Cell Biology and Genetics, College of Life Sciences, Peking University, Beijing 100871, China; §Department of Molecular Biosciences, Section of Veterinary Medical Biochemistry, Swedish University of Agricultural Sciences, Uppsala Biomedicinska Centrum, P.O. Box 575, SE-751 23 Uppsala, Sweden; and ʈDepartment of Microbiology, University of Alabama at Birmingham, Birmingham, AL, 35294 Edited by Pamela J. Bjorkman, California Institute of Technology, Pasadena, CA, and approved November 29, 2004 (received for review October 7, 2004) Adenylate kinases (AKs) play important roles in nucleotide metab- human AD-004 (also referred to as AK6) has been described in olism in all organisms and in cellular energetics by means of ref. 10. Crystals of AK6 were obtained at room temperature phosphotransfer networks in eukaryotes. The crystal structure of within 2 weeks from conditions containing 1.44 M Li2SO4 in a human AK named AK6 was determined by in-house sulfur 0.1M Hepes, pH 7.5, by using the hanging-drop vapor diffusion single-wavelength anomalous dispersion phasing methods and method. The crystals belong to the space group P61 with unit cell refined to 2.0-Å resolution with a free R factor of 21.8%. Sequence parameters a ϭ b ϭ 99.56 Å and c ϭ 57.19 Å.
  • The Flagellar Arginine Kinase in Trypanosoma Brucei

    The Flagellar Arginine Kinase in Trypanosoma Brucei

    The Flagellar Arginine Kinase in Trypanosoma brucei Is Important for Infection in Tsetse Flies Cher-Pheng Ooi, Brice Rotureau, Simonetta Gribaldo, Christina Georgikou, Daria Julkowska, Thierry Blisnick, Sylvie Perrot, Ines Subota, Philippe Bastin To cite this version: Cher-Pheng Ooi, Brice Rotureau, Simonetta Gribaldo, Christina Georgikou, Daria Julkowska, et al.. The Flagellar Arginine Kinase in Trypanosoma brucei Is Important for Infection in Tsetse Flies. PLoS ONE, Public Library of Science, 2015, 10 (7), pp. e0133676. 10.1371/journal.pone.0133676. pasteur-01301205 HAL Id: pasteur-01301205 https://hal-pasteur.archives-ouvertes.fr/pasteur-01301205 Submitted on 11 Apr 2016 HAL is a multi-disciplinary open access L’archive ouverte pluridisciplinaire HAL, est archive for the deposit and dissemination of sci- destinée au dépôt et à la diffusion de documents entific research documents, whether they are pub- scientifiques de niveau recherche, publiés ou non, lished or not. The documents may come from émanant des établissements d’enseignement et de teaching and research institutions in France or recherche français ou étrangers, des laboratoires abroad, or from public or private research centers. publics ou privés. Distributed under a Creative Commons Attribution| 4.0 International License RESEARCH ARTICLE The Flagellar Arginine Kinase in Trypanosoma brucei Is Important for Infection in Tsetse Flies Cher-Pheng Ooi1¤, Brice Rotureau1, Simonetta Gribaldo2, Christina Georgikou1, Daria Julkowska1, Thierry Blisnick1, Sylvie Perrot1, Ines Subota1, Philippe Bastin1* 1 Trypanosome Cell Biology Unit, INSERM U1201, Institut Pasteur, 25 Rue du Docteur Roux, 75015, Paris, France, 2 Molecular Biology of Gene in Extremophiles Unit, Department of Microbiology, Institut Pasteur, 25 rue du Docteur Roux, 75015, Paris, France ¤ Current address: Department of Life Sciences, Sir Alexander Fleming Building, Imperial College-South Kensington, London, SW7 2AZ, United Kingdom * [email protected] Abstract OPEN ACCESS African trypanosomes are flagellated parasites that cause sleeping sickness.
  • WO 2016/040794 Al 17 March 2016 (17.03.2016) P O P C T

    WO 2016/040794 Al 17 March 2016 (17.03.2016) P O P C T

    (12) INTERNATIONAL APPLICATION PUBLISHED UNDER THE PATENT COOPERATION TREATY (PCT) (19) World Intellectual Property Organization International Bureau (10) International Publication Number (43) International Publication Date WO 2016/040794 Al 17 March 2016 (17.03.2016) P O P C T (51) International Patent Classification: AO, AT, AU, AZ, BA, BB, BG, BH, BN, BR, BW, BY, C12N 1/19 (2006.01) C12Q 1/02 (2006.01) BZ, CA, CH, CL, CN, CO, CR, CU, CZ, DE, DK, DM, C12N 15/81 (2006.01) C07K 14/47 (2006.01) DO, DZ, EC, EE, EG, ES, FI, GB, GD, GE, GH, GM, GT, HN, HR, HU, ID, IL, IN, IR, IS, JP, KE, KG, KN, KP, KR, (21) International Application Number: KZ, LA, LC, LK, LR, LS, LU, LY, MA, MD, ME, MG, PCT/US20 15/049674 MK, MN, MW, MX, MY, MZ, NA, NG, NI, NO, NZ, OM, (22) International Filing Date: PA, PE, PG, PH, PL, PT, QA, RO, RS, RU, RW, SA, SC, 11 September 2015 ( 11.09.201 5) SD, SE, SG, SK, SL, SM, ST, SV, SY, TH, TJ, TM, TN, TR, TT, TZ, UA, UG, US, UZ, VC, VN, ZA, ZM, ZW. (25) Filing Language: English (84) Designated States (unless otherwise indicated, for every (26) Publication Language: English kind of regional protection available): ARIPO (BW, GH, (30) Priority Data: GM, KE, LR, LS, MW, MZ, NA, RW, SD, SL, ST, SZ, 62/050,045 12 September 2014 (12.09.2014) US TZ, UG, ZM, ZW), Eurasian (AM, AZ, BY, KG, KZ, RU, TJ, TM), European (AL, AT, BE, BG, CH, CY, CZ, DE, (71) Applicant: WHITEHEAD INSTITUTE FOR BIOMED¬ DK, EE, ES, FI, FR, GB, GR, HR, HU, IE, IS, IT, LT, LU, ICAL RESEARCH [US/US]; Nine Cambridge Center, LV, MC, MK, MT, NL, NO, PL, PT, RO, RS, SE, SI, SK, Cambridge, Massachusetts 02142-1479 (US).
  • REPORT on the First International Workshop on Chromosome 9 Held at Girton College Cambridge, UK, 22-24 March, 1992

    UC Irvine UC Irvine Previously Published Works Title Report and abstracts of the First International Workshop on Chromosome 9. Held at Girton College Cambridge, UK, 22-24 March, 1992. Permalink https://escholarship.org/uc/item/5k97g95t Journal Annals of human genetics, 56(3) ISSN 0003-4800 Authors Povey, S Smith, M Haines, J et al. Publication Date 1992-07-01 DOI 10.1111/j.1469-1809.1992.tb01145.x License https://creativecommons.org/licenses/by/4.0/ 4.0 Peer reviewed eScholarship.org Powered by the California Digital Library University of California Ann. Hum. Genet. (1992), 56, 167-221 167 Printd in &eat Britain REPORT on the First International Workshop on Chromosome 9 held at Girton College Cambridge, UK, 22-24 March, 1992 Prepared by: S. POVEY, M. SMITH, J. HAINES, D. KWIATKOWSKI, J. FOUNTAIN, A. BALE, C. ABBOTT, I. JACKSON, M. LAWRIE and M. HULTEN The meeting was attended by 70 participants whose names and addresses are included in an appendix to this report. Fifty-four abstracts were received and the data presented on posters. The main role of the meeting was seen as the construction of a consensus map of chromosome 9, together with a sharing of knowledge about resources such as hybrids, libraries and new polymorphisms. The group divided into separate working parties to consider 9p, 9cen-9q32, 9q33-9qter, global problems and comparative mapping. The findings of each of these groups are included in this report. There was a separate discussion of resources which is also summarized. Two databases were discussed and demonstrated (GDB by Bonnie Maidak and ldb by Andy Collins).
  • Dynamics of Nucleotide Metabolism As a Supporter of Life Phenomena

    Dynamics of Nucleotide Metabolism As a Supporter of Life Phenomena

    View metadata, citation and similar papers at core.ac.uk brought to you by CORE provided by Tokushima University Institutional Repository 127 REVIEW Dynamics of nucleotide metabolism as a supporter of life phenomena Takafumi Noma Department of Molecular Biology, Institute of Health Biosciences, The University of Tokushima Graduate School, Tokushima, Japan Abstract : Adenylate kinase (hereinafter referred to as AK) catalyzes a reversible high-energy phosphoryl transfer reaction between adenine nucleotides. The enzyme contributes to the homeostasis of cellular adenine nucleotide composition in addition to the nucleotide bio- synthesis. So far, six AK isozymes, AK1, AK2, AK3, AK4, AK5, and AK6, were identified. AK1 is localized in neuronal processes, sperm tail and on the cytoskeleton in cardiac cells at high concentrations, suggesting its regulatory function as a high-energy !-phosphoryl transfer chain from ATP-synthesizing sites to the ATP-utilizing sites in the cell. AK2, AK3 and AK4 are mitochondrial proteins. AK2 is expressed in the intermembrane space, while AK3 and AK4 are localized in the mitochondrial matrix. AK3 is expressed in all tissues except for red blood cells indicating that AK3 gene is a housekeeping-type gene. On the other hand, AK4 is tissue- specifically expressed mainly in kidney, brain, heart, and liver although its enzymatic activity is not yet detected. AK5 is solely expressed in a limited area of brain. AK6 is recently identified in nucleus, suggesting its role in nuclear nucleotide metabolism. All data, so far reported, indicated the function of AK is associated with the mechanism of efficient transfer of high-energy phosphate in micro-compartment within the cell.
  • (12) United States Patent (10) Patent No.: US 9,073,982 B2 Demore Et Al

    (12) United States Patent (10) Patent No.: US 9,073,982 B2 Demore Et Al

    US009073982B2 (12) United States Patent (10) Patent No.: US 9,073,982 B2 DeMore et al. (45) Date of Patent: *Jul. 7, 2015 (54) TARGETS FOR REGULATION OF (56) References Cited ANGIOGENESIS U.S. PATENT DOCUMENTS (71) Applicant: The University of North Carolina at 5,885,808 A 3/1999 Spooner et al. Chapel Hill, Chapel Hill, NC (US) 6,017,949 A 1/2000 D'Amato et al. 7,026,445 B2 4/2006 LaVallie et al. 7,304,071 B2 12/2007 Cochran et al. (72) Inventors: Nancy Klauber DeMore, Durham, NC 7,348,335 B2 3/2008 Bethliel et al. (US); Cam Patterson, Chapel Hill, NC 7,348,418 B2 3/2008 Singh et al. (US); Rajendra Bhati. Durham, NC 7.465,449 B2 12/2008 Violette et al. 8,734,789 B2* 5/2014 DeMore et al. ............ 424,130.1 (US); Bradley G. Bone, Apex, NC (US) 2001 OO18186 A1 8, 2001 Hirth 2002fOOO6966 A1 1/2002 Arbiser (73) Assignee: The University of North Carolina at 2002fOO19382 A1 2/2002 Snyder et al. 2002fOO86341 A1 7/2002 Nguyen Chapel Hill, Chapel Hill, NC (US) 2004/OOO9541 A1 1/2004 Singh et al. 2004/OO77544 A1 4/2004 Varner 2005/025O163 A1 11/2005 Lorens et al. (*) Notice: Subject to any disclaimer, the term of this 2006,0166251 A1 7/2006 Archambault patent is extended or adjusted under 35 2006/0269921 A1 11/2006 Segara et al. U.S.C. 154(b) by 0 days. 2007/0054271 A1 3/2007 Polyak et al. 2007/0O87365 A1 4/2007 Van Criekinge et al.