DOCSLIB.ORG

Genetic Analyses of Epigenetic Predictors That Estimate Aging, 2 Metabolic Traits, and Lifespan 3 Khyobeni Mozhui 1, 2*, Ake T

Total Page：16

File Type：pdf, Size：1020Kb

Download full-text PDF Read full-text
Genetic Analyses of Epigenetic Predictors That Estimate Aging, 2 Metabolic Traits, and Lifespan 3 Khyobeni Mozhui 1, 2*, Ake T bioRxiv preprint doi: https://doi.org/10.1101/2021.06.23.449634; this version posted June 24, 2021. The copyright holder for this preprint (which was not certified by peer review) is the author/funder, who has granted bioRxiv a license to display the preprint in perpetuity. It is made available under aCC-BY 4.0 International license. 1 Genetic Analyses of Epigenetic Predictors that Estimate Aging, 2 Metabolic Traits, and Lifespan 3 Khyobeni Mozhui 1, 2*, Ake T. Lu3, Caesar Z Li 3, Amin Haghani 4, Jose Vladimir Sandoval-Sierra 1, 4 Robert W. Williams 2, Steve Horvath3, 4 5 6 1 Department of Preventive Medicine, University of Tennessee Health Science Center, College of 7 Medicine, Memphis, Tennessee, USA 8 2 Department of Genetics, Genomics and Informatics, University of Tennessee Health Science 9 Center, College of Medicine, Memphis, Tennessee, USA 10 3 Department of Human Genetics, David Geffen School of Medicine, University of California Los 11 Angeles, Los Angeles, CA, USA 12 4 Department of Biostatistics, Fielding School of Public Health, University of California Los 13 Angeles, Los Angeles, CA, USA 14 15 *Correspondence: 16 Khyobeni Mozhui 17 [email protected] 1 bioRxiv preprint doi: https://doi.org/10.1101/2021.06.23.449634; this version posted June 24, 2021. The copyright holder for this preprint (which was not certified by peer review) is the author/funder, who has granted bioRxiv a license to display the preprint in perpetuity. It is made available under aCC-BY 4.0 International license. 18 Abstract 19 DNA methylation (DNAm) clocks are accurate molecular biomarkers of aging. However, the 20 clock mechanisms remain unclear. Here, we used a pan-mammalian microarray to assay DNAm 21 in liver from 339 predominantly female mice belonging to the BXD family. We computed 22 epigenetic clocks and maximum lifespan predictor (predicted-maxLS), and examined 23 associations with DNAm entropy, diet, weight, metabolic traits, and genetic variation. The 24 epigenetic age acceleration (EAA) derived from the clocks, and predicted-maxLS were 25 correlated with lifespan of the BXD strains. Quantitative trait locus (QTL) analyses uncovered 26 significant QTLs on chromosome (Chr) 11 that encompasses the Erbb2/Her2 oncogenic region, 27 and on Chr19 that contains a cytochrome P450 cluster. Both loci harbor candidate genes 28 associated with EAA in humans (STXBP4, NKX2-3, CUTC). Transcriptome and proteome analyses 29 revealed enrichment in oxidation-reduction, metabolic, and mitotic genes. Our results highlight 30 loci that are concordant in human and mouse, and demonstrate intimate links between 31 metabolism, body weight, and epigenetic aging. 32 33 34 Keywords: epigenetic clock, lifespan, aging, DNA methylation, QTL, weight, diet 2 bioRxiv preprint doi: https://doi.org/10.1101/2021.06.23.449634; this version posted June 24, 2021. The copyright holder for this preprint (which was not certified by peer review) is the author/funder, who has granted bioRxiv a license to display the preprint in perpetuity. It is made available under aCC-BY 4.0 International license. 35 Introduction 36 Epigenetic clocks are widely used molecular biomarkers of aging1. These biological clocks are 37 based on the methylation status across an ensemble of “clock CpGs” that are collectively used 38 to derive a DNA methylation (DNAm) based estimate of age (DNAmAge). This estimate tracks 39 closely, but not perfectly, with an individual’s chronological age. How much the DNAmAge 40 deviates from the known chronological age is a measure of the rate of biological aging. Denoted 41 as epigenetic age acceleration (EAA), a more accelerated measure (positive EAA) suggests an 42 older biological age. While DNAmAge predicts age, its age-adjusted counterpart, EAA, is 43 associated with health, fitness, exposure to stressors, body mass index (BMI), and even life 44 expectancy2-6. 45 DNAm clocks were initially reported for humans7,8. Since then, the age estimator has been 46 extended to model organisms9-11, and different variants of human clocks have also been 47 developed. Some clocks are tissue specific, others are pan-tissue, and others perform well at 48 predicting health and life expectancy5,8,12-14. 49 A new microarray platform was recently developed to profile CpGs that have high conservation 50 across mammalian clades. This pan-mammalian DNAm array (HorvathMammalMethylChip40) 51 provides a common platform to measure DNAm, and has been used to build universal 52 epigenetic clocks that can estimate age across a variety of tissues and mammalian species15,16. 53 Another remarkable development with this array is the novel lifespan predictor that can 54 estimate the maximum lifespan of over 190 mammals at high accuracy17. 55 Here, we examine these novel clocks, lifespan predictor, and methylome entropy in a cohort of 56 mice belonging to the BXD family that were maintained on either normal chow or high-fat diet 57 (HFD)18,19. The BXDs are a well-established mouse genetic reference panel that were first 58 created as a family of recombinant inbred (RI) strains by crossing two inbred progenitors: 59 C57BL/6J (B6) and DBA/2J (D2). The family has been expanded to ~150 fully sequenced progeny 60 strains20,21. Members of the BXD family vary greatly in their metabolic profiles, aging rates, and 61 natural life expectancy18,19,22-24. The genetic variation, and the availability of accompanying 62 deep -omic data make the BXDs a unique experimental population for dissecting the genetic 63 modulators of epigenetic aging. Previously, we explored the aging methylome in a small 64 number of BXD cases and found that HFD and higher body weight were associated with higher 65 age-dependent changes in methylation25. In the present work, our goals were to (1) test the 66 accuracy of the DNAm measures in predicting age, lifespan, and association with diet and 67 metabolic characteristics, and (2) apply quantitative trait locus (QTL) mapping and gene 68 expression analyses to uncover loci and genes that contribute to these DNAm biomarkers. 69 Our results are consistent with a faster clock for cases on HFD, and with higher body weight. 70 Both the DNAmAge and lifespan predictors were correlated with the genotype-dependent life 71 expectancy of female BXDs. We report QTLs on chromosomes (Chrs) 11 and 19. A strong 72 candidate gene in the chromosome (Chr) 11 interval (referred to as Eaaq11) is Stxbp4, a gene 73 that has been consistently associated with EAA by human genome-wide association studies 74 (GWAS)26-28. The Chr19 QTL (Eaaq19) also harbors strong contenders including Cyp26a1, Myof, 75 Cutc, and Nkx2–3, and the conserved genes in humans have been associated with longevity and 3 bioRxiv preprint doi: https://doi.org/10.1101/2021.06.23.449634; this version posted June 24, 2021. The copyright holder for this preprint (which was not certified by peer review) is the author/funder, who has granted bioRxiv a license to display the preprint in perpetuity. It is made available under aCC-BY 4.0 International license. 76 EAA28-30. Eaaq19 may also have an effect on body weight change with age. We performed gene 77 expression analyses to clarify the physiology associated with the DNAm traits, and this, perhaps 78 unsurprisingly, highlighted metabolic networks as strong expression correlates of epigenetic 79 aging. 80 Results 81 Description of samples 82 The present study uses liver DNAm data from 339 predominantly female mice (18 males only) 83 belonging to 45 isogenic members of the BXD family, including F1 hybrids, and both parental 84 strains. Age ranged from 5.6 to 33.4 months. Mice were all weaned onto a normal chow 85 (control diet; CD) and a balanced subset of cases were then randomly assigned to the HFD (see 86 Roy et al for details 18). Tissues were collected at approximately six months intervals (see 87 Williams et al. 19). Individual-level data of cases used in this study are in Data S1. 88 Correlation with chronological age 89 For biological age prediction, three different types of mouse DNAm clocks were computed, 90 each as a pair: liver-specific, and pan-tissue (Table 1). These are: (1) a general DNAm clock 91 (referred to simply as DNAmAge): clock trained without pre-selecting for any specific CpG 92 subsets; (2) developmental clock (dev.DNAmAge): built from CpGs that change during 93 development; and (3) interventional clock (int.DNAmAge): built from CpGs that change in 94 response to aging related interventions such as caloric restriction, HFD, or dwarfing alleles9,11,25. 95 These clocks were trained either in an independent mouse dataset that did not include the 96 BXDs and were therefore unbiased to BXD characteristics (unbiased mouse clocks), or trained in 97 a subset of the BXD CD mice and used to estimate age in the full BXD cohort (BXD-biased Table 1. Epigenetic predictors and correlation with chronological age and entropy Training DNAmAge r with age r with entropy Clock type Tissue set1 name (n=339) (n=339) Standard unbiased DNAmAge pan 0.89 0.50 Standard unbiased DNAmAge liver 0.92 0.51 Developmental unbiased dev.DNAmAge pan 0.87 0.46 Developmental unbiased dev.DNAmAge liver 0.91 0.45 Interventional unbiased int.DNAmAge pan 0.85 0.38 Interventional unbiased int.DNAmAge liver 0.86 0.49 Standard BXD DNAmAge pan 0.93 0.55 Standard BXD DNAmAge liver 0.97 0.54 Developmental BXD dev.DNAmAge pan 0.95 0.51 Developmental BXD dev.DNAmAge liver 0.96 0.51 Interventional BXD int.DNAmAge pan 0.89 0.43 Interventional BXD int.DNAmAge liver 0.94 0.53 Universal unbiased univ.DNAmAge pan 0.92 0.59 Predicted- LiFespan unbiased pan -0.07 (ns) -0.13 (p=0.02) maxLS 1 Unbiased denotes that the clocks were trained in a completely independent dataset.
Load more

Recommended publications
  • Analysis of Trans Esnps Infers Regulatory Network Architecture
    Analysis of trans eSNPs infers regulatory network architecture Anat Kreimer Submitted in partial fulfillment of the requirements for the degree of Doctor of Philosophy in the Graduate School of Arts and Sciences COLUMBIA UNIVERSITY 2014 © 2014 Anat Kreimer All rights reserved ABSTRACT Analysis of trans eSNPs infers regulatory network architecture Anat Kreimer eSNPs are genetic variants associated with transcript expression levels. The characteristics of such variants highlight their importance and present a unique opportunity for studying gene regulation. eSNPs affect most genes and their cell type specificity can shed light on different processes that are activated in each cell. They can identify functional variants by connecting SNPs that are implicated in disease to a molecular mechanism. Examining eSNPs that are associated with distal genes can provide insights regarding the inference of regulatory networks but also presents challenges due to the high statistical burden of multiple testing. Such association studies allow: simultaneous investigation of many gene expression phenotypes without assuming any prior knowledge and identification of unknown regulators of gene expression while uncovering directionality. This thesis will focus on such distal eSNPs to map regulatory interactions between different loci and expose the architecture of the regulatory network defined by such interactions. We develop novel computational approaches and apply them to genetics-genomics data in human. We go beyond pairwise interactions to define network motifs, including regulatory modules and bi-fan structures, showing them to be prevalent in real data and exposing distinct attributes of such arrangements. We project eSNP associations onto a protein-protein interaction network to expose topological properties of eSNPs and their targets and highlight different modes of distal regulation.
    [Show full text]
  • Alterations of Genetic Variants and Transcriptomic Features of Response to Tamoxifen in the Breast Cancer Cell Line
    Alterations of Genetic Variants and Transcriptomic Features of Response to Tamoxifen in the Breast Cancer Cell Line Mahnaz Nezamivand-Chegini Shiraz University Hamed Kharrati-Koopaee Shiraz University https://orcid.org/0000-0003-2345-6919 seyed taghi Heydari ( [email protected] ) Shiraz University of Medical Sciences https://orcid.org/0000-0001-7711-1137 Hasan Giahi Shiraz University Ali Dehshahri Shiraz University of Medical Sciences Mehdi Dianatpour Shiraz University of Medical Sciences Kamran Bagheri Lankarani Shiraz University of Medical Sciences Research Keywords: Tamoxifen, breast cancer, genetic variants, RNA-seq. Posted Date: August 17th, 2021 DOI: https://doi.org/10.21203/rs.3.rs-783422/v1 License: This work is licensed under a Creative Commons Attribution 4.0 International License. Read Full License Page 1/33 Abstract Background Breast cancer is one of the most important causes of mortality in the world, and Tamoxifen therapy is known as a medication strategy for estrogen receptor-positive breast cancer. In current study, two hypotheses of Tamoxifen consumption in breast cancer cell line (MCF7) were investigated. First, the effect of Tamoxifen on genes expression prole at transcriptome level was evaluated between the control and treated samples. Second, due to the fact that Tamoxifen is known as a mutagenic factor, there may be an association between the alterations of genetic variants and Tamoxifen treatment, which can impact on the drug response. Methods In current study, the whole-transcriptome (RNA-seq) dataset of four investigations (19 samples) were derived from European Bioinformatics Institute (EBI). At transcriptome level, the effect of Tamoxifen was investigated on gene expression prole between control and treatment samples.
    [Show full text]
  • Role and Regulation of the P53-Homolog P73 in the Transformation of Normal Human Fibroblasts
    Role and regulation of the p53-homolog p73 in the transformation of normal human fibroblasts Dissertation zur Erlangung des naturwissenschaftlichen Doktorgrades der Bayerischen Julius-Maximilians-Universität Würzburg vorgelegt von Lars Hofmann aus Aschaffenburg Würzburg 2007 Eingereicht am Mitglieder der Promotionskommission: Vorsitzender: Prof. Dr. Dr. Martin J. Müller Gutachter: Prof. Dr. Michael P. Schön Gutachter : Prof. Dr. Georg Krohne Tag des Promotionskolloquiums: Doktorurkunde ausgehändigt am Erklärung Hiermit erkläre ich, dass ich die vorliegende Arbeit selbständig angefertigt und keine anderen als die angegebenen Hilfsmittel und Quellen verwendet habe. Diese Arbeit wurde weder in gleicher noch in ähnlicher Form in einem anderen Prüfungsverfahren vorgelegt. Ich habe früher, außer den mit dem Zulassungsgesuch urkundlichen Graden, keine weiteren akademischen Grade erworben und zu erwerben gesucht. Würzburg, Lars Hofmann Content SUMMARY ................................................................................................................ IV ZUSAMMENFASSUNG ............................................................................................. V 1. INTRODUCTION ................................................................................................. 1 1.1. Molecular basics of cancer .......................................................................................... 1 1.2. Early research on tumorigenesis ................................................................................. 3 1.3. Developing
    [Show full text]
  • MOCHI Enables Discovery of Heterogeneous Interactome Modules in 3D Nucleome
    Downloaded from genome.cshlp.org on October 4, 2021 - Published by Cold Spring Harbor Laboratory Press MOCHI enables discovery of heterogeneous interactome modules in 3D nucleome Dechao Tian1,# , Ruochi Zhang1,# , Yang Zhang1, Xiaopeng Zhu1, and Jian Ma1,* 1Computational Biology Department, School of Computer Science, Carnegie Mellon University, Pittsburgh, PA 15213, USA #These two authors contributed equally *Correspondence: [email protected] Contact To whom correspondence should be addressed: Jian Ma School of Computer Science Carnegie Mellon University 7705 Gates-Hillman Complex 5000 Forbes Avenue Pittsburgh, PA 15213 Phone: +1 (412) 268-2776 Email: [email protected] 1 Downloaded from genome.cshlp.org on October 4, 2021 - Published by Cold Spring Harbor Laboratory Press Abstract The composition of the cell nucleus is highly heterogeneous, with different constituents forming complex interactomes. However, the global patterns of these interwoven heterogeneous interactomes remain poorly understood. Here we focus on two different interactomes, chromatin interaction network and gene regulatory network, as a proof-of-principle, to identify heterogeneous interactome modules (HIMs), each of which represents a cluster of gene loci that are in spatial contact more frequently than expected and that are regulated by the same group of transcription factors. HIM integrates transcription factor binding and 3D genome structure to reflect “transcriptional niche” in the nucleus. We develop a new algorithm MOCHI to facilitate the discovery of HIMs based on network motif clustering in heterogeneous interactomes. By applying MOCHI to five different cell types, we found that HIMs have strong spatial preference within the nucleus and exhibit distinct functional properties. Through integrative analysis, this work demonstrates the utility of MOCHI to identify HIMs, which may provide new perspectives on the interplay between transcriptional regulation and 3D genome organization.
    [Show full text]
  • Two DNA Binding Domains of Mga Act in Combination to Suppress Ectopic Activation
    bioRxiv preprint doi: https://doi.org/10.1101/2020.07.21.215079; this version posted July 22, 2020. The copyright holder for this preprint (which was not certified by peer review) is the author/funder. All rights reserved. No reuse allowed without permission. Two DNA binding domains of Mga act in combination to suppress ectopic activation of meiosis-related genes in mouse embryonic stem cells Kousuke Uranishi1, Masataka Hirasaki2, Yuka Kitamura1, Yosuke Mizuno3, Masazumi Nishimoto1,3, Ayumu Suzuki1*, Akihiko Okuda1* 1Division of Biomedical Sciences, Research Center for Genomic Medicine, 2Department of Clinical Cancer Genomics, International Medical Center, 3Biomedical Research Center, Saitama Medical University, 1397-1, Yamane Hidaka, Saitama 350-1241, Japan *Corresponding authors Ayumu Suzuki: [email protected] Akihiko Okuda: [email protected] Running title: Roles of two DNA binding domains of Mga in ESCs AUTHOR CONTRIBUTIONS K.U.: performed the experiments, data analysis, and manuscript writing; Y.K., M.H., and Y.M.: performed the experiments and data analysis; M.N.: performed the data analysis, and commented on the manuscript; A.S.: performed the experiments and data analysis, conception and design; A.O.: conception and design, financial support, manuscript writing, and final approval of manuscript. 1 bioRxiv preprint doi: https://doi.org/10.1101/2020.07.21.215079; this version posted July 22, 2020. The copyright holder for this preprint (which was not certified by peer review) is the author/funder. All rights reserved. No reuse allowed without permission. SUMMARY Mouse embryonic stem cells (ESCs) have high potential for meiotic entry, like germ cells. Although the physiological meaning of this potential is not known, it is certain that a rigid safeguarding system is required to prevent ectopic onset of meiosis.
    [Show full text]
  • The Central Role of EED in the Orchestration of Polycomb Group Complexes
    ARTICLE Received 22 Aug 2013 | Accepted 16 Dec 2013 | Published 24 Jan 2014 DOI: 10.1038/ncomms4127 The central role of EED in the orchestration of polycomb group complexes Qi Cao1,2,3,4, Xiaoju Wang1,2, Meng Zhao5, Rendong Yang5, Rohit Malik1,2, Yuanyuan Qiao1,2, Anton Poliakov1,2, Anastasia K. Yocum1, Yong Li1, Wei Chen1,6, Xuhong Cao1,7, Xia Jiang1,2, Arun Dahiya1, Clair Harris8, Felix Y. Feng1,6,9, Sundeep Kalantry8, Zhaohui S. Qin5,10, Saravana M. Dhanasekaran1,2 & Arul M. Chinnaiyan1,2,7,9,11 Polycomb repressive complexes 1 and 2 (PRC1 and 2) play a critical role in the epigenetic regulation of transcription during cellular differentiation, stem cell pluripotency and neoplastic progression. Here we show that the polycomb group protein EED, a core component of PRC2, physically interacts with and functions as part of PRC1. Components of PRC1 and PRC2 compete for EED binding. EED functions to recruit PRC1 to H3K27me3 loci and enhances PRC1-mediated H2A ubiquitin E3 ligase activity. Taken together, we suggest an integral role for EED as an epigenetic exchange factor coordinating the activities of PRC1 and 2. 1 Michigan Center for Translational Pathology, University of Michigan Medical School, Ann Arbor, Michigan 48109, USA. 2 Department of Pathology, University of Michigan Medical School, Ann Arbor, Michigan 48109, USA. 3 Center for Inflammation and Epigenetics, Houston Methodist Research Institute, Houston, Texas 77030, USA. 4 Cancer Center, Houston Methodist Research Institute, Houston, Texas 77030, USA. 5 Department of Biostatistics and Bioinformatics, Emory University, Atlanta, Georgia 30329, USA. 6 Department of Radiation Oncology, University of Michigan Medical School, Ann Arbor, Michigan 48109, USA.
    [Show full text]
  • Mammalian PRC1 Complexes: Compositional Complexity and Diverse Molecular Mechanisms
    International Journal of Molecular Sciences Review Mammalian PRC1 Complexes: Compositional Complexity and Diverse Molecular Mechanisms Zhuangzhuang Geng 1 and Zhonghua Gao 1,2,3,* 1 Departments of Biochemistry and Molecular Biology, Penn State College of Medicine, Hershey, PA 17033, USA; [email protected] 2 Penn State Hershey Cancer Institute, Hershey, PA 17033, USA 3 The Stem Cell and Regenerative Biology Program, Penn State College of Medicine, Hershey, PA 17033, USA * Correspondence: [email protected] Received: 6 October 2020; Accepted: 5 November 2020; Published: 14 November 2020 Abstract: Polycomb group (PcG) proteins function as vital epigenetic regulators in various biological processes, including pluripotency, development, and carcinogenesis. PcG proteins form multicomponent complexes, and two major types of protein complexes have been identified in mammals to date, Polycomb Repressive Complexes 1 and 2 (PRC1 and PRC2). The PRC1 complexes are composed in a hierarchical manner in which the catalytic core, RING1A/B, exclusively interacts with one of six Polycomb group RING finger (PCGF) proteins. This association with specific PCGF proteins allows for PRC1 to be subdivided into six distinct groups, each with their own unique modes of action arising from the distinct set of associated proteins. Historically, PRC1 was considered to be a transcription repressor that deposited monoubiquitylation of histone H2A at lysine 119 (H2AK119ub1) and compacted local chromatin. More recently, there is increasing evidence that demonstrates the transcription activation role of PRC1. Moreover, studies on the higher-order chromatin structure have revealed a new function for PRC1 in mediating long-range interactions. This provides a different perspective regarding both the transcription activation and repression characteristics of PRC1.
    [Show full text]
  • Genetic Analyses of Epigenetic Predictors That Estimate Aging, 2 Metabolic Traits, and Lifespan 3 Khyobeni Mozhui 1, 2*, Ake T
    bioRxiv preprint doi: https://doi.org/10.1101/2021.06.23.449634; this version posted June 24, 2021. The copyright holder for this preprint (which was not certified by peer review) is the author/funder, who has granted bioRxiv a license to display the preprint in perpetuity. It is made available under aCC-BY 4.0 International license. 1 Genetic Analyses of Epigenetic Predictors that Estimate Aging, 2 Metabolic Traits, and Lifespan 3 Khyobeni Mozhui 1, 2*, Ake T. Lu3, Caesar Z Li 3, Amin Haghani 4, Jose Vladimir Sandoval-Sierra 1, 4 Robert W. Williams 2, Steve Horvath3, 4 5 6 1 Department of Preventive Medicine, University of Tennessee Health Science Center, College of 7 Medicine, Memphis, Tennessee, USA 8 2 Department of Genetics, Genomics and Informatics, University of Tennessee Health Science 9 Center, College of Medicine, Memphis, Tennessee, USA 10 3 Department of Human Genetics, David Geffen School of Medicine, University of California Los 11 Angeles, Los Angeles, CA, USA 12 4 Department of Biostatistics, Fielding School of Public Health, University of California Los 13 Angeles, Los Angeles, CA, USA 14 15 *Correspondence: 16 Khyobeni Mozhui 17 [email protected] 1 bioRxiv preprint doi: https://doi.org/10.1101/2021.06.23.449634; this version posted June 24, 2021. The copyright holder for this preprint (which was not certified by peer review) is the author/funder, who has granted bioRxiv a license to display the preprint in perpetuity. It is made available under aCC-BY 4.0 International license. 18 Abstract 19 DNA methylation (DNAm) clocks are accurate molecular biomarkers of aging.
    [Show full text]
  • Anti-PCGF6 Antibody (ARG40118)
    Product datasheet [email protected] ARG40118 Package: 100 μl anti-PCGF6 antibody Store at: -20°C Summary Product Description Rabbit Polyclonal antibody recognizes PCGF6 Tested Reactivity Hu, Rat Predict Reactivity Ms Tested Application WB Host Rabbit Clonality Polyclonal Isotype IgG Target Name PCGF6 Antigen Species Human Immunogen KLH-conjugated synthetic peptide corresponding to aa. 190-217 of Human PCGF6. Conjugation Un-conjugated Alternate Names RING finger protein 134; Mel18 and Bmi1-like RING finger; RNF134; Polycomb group RING finger protein 6; MBLR Application Instructions Application table Application Dilution WB 1:1000 Application Note * The dilutions indicate recommended starting dilutions and the optimal dilutions or concentrations should be determined by the scientist. Positive Control Rat testis Calculated Mw 39 kDa Properties Form Liquid Purification Purification with Protein A and immunogen peptide. Buffer PBS and 0.09% (W/V) Sodium azide. Preservative 0.09% (W/V) Sodium azide. Storage instruction For continuous use, store undiluted antibody at 2-8°C for up to a week. For long-term storage, aliquot and store at -20°C or below. Storage in frost free freezers is not recommended. Avoid repeated freeze/thaw cycles. Suggest spin the vial prior to opening. The antibody solution should be gently mixed before use. Note For laboratory research only, not for drug, diagnostic or other use. www.arigobio.com 1/2 Bioinformation Gene Symbol PCGF6 Gene Full Name polycomb group ring finger 6 Background The protein encoded by this gene contains a RING finger motif, which is most closely related to those of polycomb group (PcG) proteins RNF110/MEL-18 and BMI1.
    [Show full text]
  • Identifying Proteins Bound to Native Mitotic ESC Chromosomes Reveals Chromatin Repressors Are Important for Compaction
    ARTICLE https://doi.org/10.1038/s41467-020-17823-z OPEN Identifying proteins bound to native mitotic ESC chromosomes reveals chromatin repressors are important for compaction Dounia Djeghloul 1, Bhavik Patel2, Holger Kramer 3, Andrew Dimond 1, Chad Whilding4, Karen Brown1, Anne-Céline Kohler1, Amelie Feytout1, Nicolas Veland 1, James Elliott2, Tanmay A. M. Bharat 5, Abul K. Tarafder5, Jan Löwe 6, Bee L. Ng 7, Ya Guo1, Jacky Guy 8, Miles K. Huseyin 9, Robert J. Klose9, ✉ Matthias Merkenschlager 1 & Amanda G. Fisher 1 1234567890():,; Epigenetic information is transmitted from mother to daughter cells through mitosis. Here, to identify factors that might play a role in conveying epigenetic memory through cell division, we report on the isolation of unfixed, native chromosomes from metaphase-arrested cells using flow cytometry and perform LC-MS/MS to identify chromosome-bound proteins. A quantitative proteomic comparison between metaphase-arrested cell lysates and chromosome-sorted samples reveals a cohort of proteins that were significantly enriched on mitotic ESC chromosomes. These include pluripotency-associated transcription factors, repressive chromatin-modifiers such as PRC2 and DNA methyl-transferases, and proteins governing chromosome architecture. Deletion of PRC2, Dnmt1/3a/3b or Mecp2 in ESCs leads to an increase in the size of individual mitotic chromosomes, consistent with de- condensation. Similar results were obtained by the experimental cleavage of cohesin. Thus, we identify chromosome-bound factors in pluripotent stem cells during mitosis and reveal that PRC2, DNA methylation and Mecp2 are required to maintain chromosome compaction. 1 Lymphocyte Development Group, MRC London Institute of Medical Sciences, Imperial College London, Hammersmith Hospital Campus, Du Cane Road, London W12 0NN, UK.
    [Show full text]
  • Molecular Targeting and Enhancing Anticancer Efficacy of Oncolytic HSV-1 to Midkine Expressing Tumors
    University of Cincinnati Date: 12/20/2010 I, Arturo R Maldonado , hereby submit this original work as part of the requirements for the degree of Doctor of Philosophy in Developmental Biology. It is entitled: Molecular Targeting and Enhancing Anticancer Efficacy of Oncolytic HSV-1 to Midkine Expressing Tumors Student's name: Arturo R Maldonado This work and its defense approved by: Committee chair: Jeffrey Whitsett Committee member: Timothy Crombleholme, MD Committee member: Dan Wiginton, PhD Committee member: Rhonda Cardin, PhD Committee member: Tim Cripe 1297 Last Printed:1/11/2011 Document Of Defense Form Molecular Targeting and Enhancing Anticancer Efficacy of Oncolytic HSV-1 to Midkine Expressing Tumors A dissertation submitted to the Graduate School of the University of Cincinnati College of Medicine in partial fulfillment of the requirements for the degree of DOCTORATE OF PHILOSOPHY (PH.D.) in the Division of Molecular & Developmental Biology 2010 By Arturo Rafael Maldonado B.A., University of Miami, Coral Gables, Florida June 1993 M.D., New Jersey Medical School, Newark, New Jersey June 1999 Committee Chair: Jeffrey A. Whitsett, M.D. Advisor: Timothy M. Crombleholme, M.D. Timothy P. Cripe, M.D. Ph.D. Dan Wiginton, Ph.D. Rhonda D. Cardin, Ph.D. ABSTRACT Since 1999, cancer has surpassed heart disease as the number one cause of death in the US for people under the age of 85. Malignant Peripheral Nerve Sheath Tumor (MPNST), a common malignancy in patients with Neurofibromatosis, and colorectal cancer are midkine- producing tumors with high mortality rates. In vitro and preclinical xenograft models of MPNST were utilized in this dissertation to study the role of midkine (MDK), a tumor-specific gene over- expressed in these tumors and to test the efficacy of a MDK-transcriptionally targeted oncolytic HSV-1 (oHSV).
    [Show full text]
  • PCGF6 Rabbit Polyclonal Antibody – TA330481 | Origene
    OriGene Technologies, Inc. 9620 Medical Center Drive, Ste 200 Rockville, MD 20850, US Phone: +1-888-267-4436 [email protected] EU: [email protected] CN: [email protected] Product datasheet for TA330481 PCGF6 Rabbit Polyclonal Antibody Product data: Product Type: Primary Antibodies Applications: WB Recommended Dilution: WB Reactivity: Human Host: Rabbit Isotype: IgG Clonality: Polyclonal Immunogen: The immunogen for anti-PCGF6 antibody: synthetic peptide directed towards the middle region of human PCGF6. Synthetic peptide located within the following region: TQPLYNISANEGTGHFKPLEKKFVRVSGEATIGHVEKFLRRKMGLDPACQ Formulation: Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose. Note that this product is shipped as lyophilized powder to China customers. Conjugation: Unconjugated Storage: Store at -20°C as received. Stability: Stable for 12 months from date of receipt. Predicted Protein Size: 30 kDa Gene Name: polycomb group ring finger 6 Database Link: NP_115530 Entrez Gene 84108 Human Q9BYE7 Background: The protein encoded by this gene contains a RING finger motif, which is most closely related to those of polycomb group (PcG) proteins RNF110/MEL-18 and BMI1. PcG proteins are known to form protein complexes and function as transcription repressors. This protein has been shown to interact with some PcG proteins and act as a transcription repressor. The activity of this protein is found to be regulated by cell cycle dependent phosphorylation. Alternatively spliced transcript variants encoding
    [Show full text]