PCGF6 Rabbit Polyclonal Antibody – TA330481 | Origene

Total Page：16

File Type：pdf, Size：1020Kb

PCGF6 Rabbit Polyclonal Antibody – TA330481 | Origene

OriGene Technologies, Inc. 9620 Medical Center Drive, Ste 200 Rockville, MD 20850, US Phone: +1-888-267-4436 [email protected] EU: [email protected] CN: [email protected] Product datasheet for TA330481 PCGF6 Rabbit Polyclonal Antibody Product data: Product Type: Primary Antibodies Applications: WB Recommended Dilution: WB Reactivity: Human Host: Rabbit Isotype: IgG Clonality: Polyclonal Immunogen: The immunogen for anti-PCGF6 antibody: synthetic peptide directed towards the middle region of human PCGF6. Synthetic peptide located within the following region: TQPLYNISANEGTGHFKPLEKKFVRVSGEATIGHVEKFLRRKMGLDPACQ Formulation: Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose. Note that this product is shipped as lyophilized powder to China customers. Conjugation: Unconjugated Storage: Store at -20°C as received. Stability: Stable for 12 months from date of receipt. Predicted Protein Size: 30 kDa Gene Name: polycomb group ring finger 6 Database Link: NP_115530 Entrez Gene 84108 Human Q9BYE7 Background: The protein encoded by this gene contains a RING finger motif, which is most closely related to those of polycomb group (PcG) proteins RNF110/MEL-18 and BMI1. PcG proteins are known to form protein complexes and function as transcription repressors. This protein has been shown to interact with some PcG proteins and act as a transcription repressor. The activity of this protein is found to be regulated by cell cycle dependent phosphorylation. Alternatively spliced transcript variants encoding different isoforms have been identified. Synonyms: MBLR; RNF134 This product is to be used for laboratory only. Not for diagnostic or therapeutic use. View online » ©2021 OriGene Technologies, Inc., 9620 Medical Center Drive, Ste 200, Rockville, MD 20850, US 1 / 2 PCGF6 Rabbit Polyclonal Antibody – TA330481 Note: Immunogen sequence homology: Human: 100% Protein Families: Transcription Factors Product images: WB Suggested Anti-PCGF6 Antibody Titration: 0.2- 1 ug/ml; ELISA Titer: 1:62500; Positive Control: NCI-H226 cell lysate This product is to be used for laboratory only. Not for diagnostic or therapeutic use. ©2021 OriGene Technologies, Inc., 9620 Medical Center Drive, Ste 200, Rockville, MD 20850, US 2 / 2.

Copy Link

Recommended publications

Analysis of Trans Esnps Infers Regulatory Network Architecture
Analysis of trans eSNPs infers regulatory network architecture Anat Kreimer Submitted in partial fulfillment of the requirements for the degree of Doctor of Philosophy in the Graduate School of Arts and Sciences COLUMBIA UNIVERSITY 2014 © 2014 Anat Kreimer All rights reserved ABSTRACT Analysis of trans eSNPs infers regulatory network architecture Anat Kreimer eSNPs are genetic variants associated with transcript expression levels. The characteristics of such variants highlight their importance and present a unique opportunity for studying gene regulation. eSNPs affect most genes and their cell type specificity can shed light on different processes that are activated in each cell. They can identify functional variants by connecting SNPs that are implicated in disease to a molecular mechanism. Examining eSNPs that are associated with distal genes can provide insights regarding the inference of regulatory networks but also presents challenges due to the high statistical burden of multiple testing. Such association studies allow: simultaneous investigation of many gene expression phenotypes without assuming any prior knowledge and identification of unknown regulators of gene expression while uncovering directionality. This thesis will focus on such distal eSNPs to map regulatory interactions between different loci and expose the architecture of the regulatory network defined by such interactions. We develop novel computational approaches and apply them to genetics-genomics data in human. We go beyond pairwise interactions to define network motifs, including regulatory modules and bi-fan structures, showing them to be prevalent in real data and exposing distinct attributes of such arrangements. We project eSNP associations onto a protein-protein interaction network to expose topological properties of eSNPs and their targets and highlight different modes of distal regulation.
[Show full text]
Two DNA Binding Domains of Mga Act in Combination to Suppress Ectopic Activation
bioRxiv preprint doi: https://doi.org/10.1101/2020.07.21.215079; this version posted July 22, 2020. The copyright holder for this preprint (which was not certified by peer review) is the author/funder. All rights reserved. No reuse allowed without permission. Two DNA binding domains of Mga act in combination to suppress ectopic activation of meiosis-related genes in mouse embryonic stem cells Kousuke Uranishi1, Masataka Hirasaki2, Yuka Kitamura1, Yosuke Mizuno3, Masazumi Nishimoto1,3, Ayumu Suzuki1*, Akihiko Okuda1* 1Division of Biomedical Sciences, Research Center for Genomic Medicine, 2Department of Clinical Cancer Genomics, International Medical Center, 3Biomedical Research Center, Saitama Medical University, 1397-1, Yamane Hidaka, Saitama 350-1241, Japan *Corresponding authors Ayumu Suzuki: [email protected] Akihiko Okuda: [email protected] Running title: Roles of two DNA binding domains of Mga in ESCs AUTHOR CONTRIBUTIONS K.U.: performed the experiments, data analysis, and manuscript writing; Y.K., M.H., and Y.M.: performed the experiments and data analysis; M.N.: performed the data analysis, and commented on the manuscript; A.S.: performed the experiments and data analysis, conception and design; A.O.: conception and design, financial support, manuscript writing, and final approval of manuscript. 1 bioRxiv preprint doi: https://doi.org/10.1101/2020.07.21.215079; this version posted July 22, 2020. The copyright holder for this preprint (which was not certified by peer review) is the author/funder. All rights reserved. No reuse allowed without permission. SUMMARY Mouse embryonic stem cells (ESCs) have high potential for meiotic entry, like germ cells. Although the physiological meaning of this potential is not known, it is certain that a rigid safeguarding system is required to prevent ectopic onset of meiosis.
[Show full text]
The Central Role of EED in the Orchestration of Polycomb Group Complexes
ARTICLE Received 22 Aug 2013 | Accepted 16 Dec 2013 | Published 24 Jan 2014 DOI: 10.1038/ncomms4127 The central role of EED in the orchestration of polycomb group complexes Qi Cao1,2,3,4, Xiaoju Wang1,2, Meng Zhao5, Rendong Yang5, Rohit Malik1,2, Yuanyuan Qiao1,2, Anton Poliakov1,2, Anastasia K. Yocum1, Yong Li1, Wei Chen1,6, Xuhong Cao1,7, Xia Jiang1,2, Arun Dahiya1, Clair Harris8, Felix Y. Feng1,6,9, Sundeep Kalantry8, Zhaohui S. Qin5,10, Saravana M. Dhanasekaran1,2 & Arul M. Chinnaiyan1,2,7,9,11 Polycomb repressive complexes 1 and 2 (PRC1 and 2) play a critical role in the epigenetic regulation of transcription during cellular differentiation, stem cell pluripotency and neoplastic progression. Here we show that the polycomb group protein EED, a core component of PRC2, physically interacts with and functions as part of PRC1. Components of PRC1 and PRC2 compete for EED binding. EED functions to recruit PRC1 to H3K27me3 loci and enhances PRC1-mediated H2A ubiquitin E3 ligase activity. Taken together, we suggest an integral role for EED as an epigenetic exchange factor coordinating the activities of PRC1 and 2. 1 Michigan Center for Translational Pathology, University of Michigan Medical School, Ann Arbor, Michigan 48109, USA. 2 Department of Pathology, University of Michigan Medical School, Ann Arbor, Michigan 48109, USA. 3 Center for Inﬂammation and Epigenetics, Houston Methodist Research Institute, Houston, Texas 77030, USA. 4 Cancer Center, Houston Methodist Research Institute, Houston, Texas 77030, USA. 5 Department of Biostatistics and Bioinformatics, Emory University, Atlanta, Georgia 30329, USA. 6 Department of Radiation Oncology, University of Michigan Medical School, Ann Arbor, Michigan 48109, USA.
[Show full text]
Mammalian PRC1 Complexes: Compositional Complexity and Diverse Molecular Mechanisms
International Journal of Molecular Sciences Review Mammalian PRC1 Complexes: Compositional Complexity and Diverse Molecular Mechanisms Zhuangzhuang Geng 1 and Zhonghua Gao 1,2,3,* 1 Departments of Biochemistry and Molecular Biology, Penn State College of Medicine, Hershey, PA 17033, USA; [email protected] 2 Penn State Hershey Cancer Institute, Hershey, PA 17033, USA 3 The Stem Cell and Regenerative Biology Program, Penn State College of Medicine, Hershey, PA 17033, USA * Correspondence: [email protected] Received: 6 October 2020; Accepted: 5 November 2020; Published: 14 November 2020 Abstract: Polycomb group (PcG) proteins function as vital epigenetic regulators in various biological processes, including pluripotency, development, and carcinogenesis. PcG proteins form multicomponent complexes, and two major types of protein complexes have been identified in mammals to date, Polycomb Repressive Complexes 1 and 2 (PRC1 and PRC2). The PRC1 complexes are composed in a hierarchical manner in which the catalytic core, RING1A/B, exclusively interacts with one of six Polycomb group RING finger (PCGF) proteins. This association with specific PCGF proteins allows for PRC1 to be subdivided into six distinct groups, each with their own unique modes of action arising from the distinct set of associated proteins. Historically, PRC1 was considered to be a transcription repressor that deposited monoubiquitylation of histone H2A at lysine 119 (H2AK119ub1) and compacted local chromatin. More recently, there is increasing evidence that demonstrates the transcription activation role of PRC1. Moreover, studies on the higher-order chromatin structure have revealed a new function for PRC1 in mediating long-range interactions. This provides a different perspective regarding both the transcription activation and repression characteristics of PRC1.
[Show full text]
Anti-PCGF6 Antibody (ARG40118)
Product datasheet [email protected] ARG40118 Package: 100 μl anti-PCGF6 antibody Store at: -20°C Summary Product Description Rabbit Polyclonal antibody recognizes PCGF6 Tested Reactivity Hu, Rat Predict Reactivity Ms Tested Application WB Host Rabbit Clonality Polyclonal Isotype IgG Target Name PCGF6 Antigen Species Human Immunogen KLH-conjugated synthetic peptide corresponding to aa. 190-217 of Human PCGF6. Conjugation Un-conjugated Alternate Names RING finger protein 134; Mel18 and Bmi1-like RING finger; RNF134; Polycomb group RING finger protein 6; MBLR Application Instructions Application table Application Dilution WB 1:1000 Application Note * The dilutions indicate recommended starting dilutions and the optimal dilutions or concentrations should be determined by the scientist. Positive Control Rat testis Calculated Mw 39 kDa Properties Form Liquid Purification Purification with Protein A and immunogen peptide. Buffer PBS and 0.09% (W/V) Sodium azide. Preservative 0.09% (W/V) Sodium azide. Storage instruction For continuous use, store undiluted antibody at 2-8°C for up to a week. For long-term storage, aliquot and store at -20°C or below. Storage in frost free freezers is not recommended. Avoid repeated freeze/thaw cycles. Suggest spin the vial prior to opening. The antibody solution should be gently mixed before use. Note For laboratory research only, not for drug, diagnostic or other use. www.arigobio.com 1/2 Bioinformation Gene Symbol PCGF6 Gene Full Name polycomb group ring finger 6 Background The protein encoded by this gene contains a RING finger motif, which is most closely related to those of polycomb group (PcG) proteins RNF110/MEL-18 and BMI1.
[Show full text]
Identifying Proteins Bound to Native Mitotic ESC Chromosomes Reveals Chromatin Repressors Are Important for Compaction
ARTICLE https://doi.org/10.1038/s41467-020-17823-z OPEN Identifying proteins bound to native mitotic ESC chromosomes reveals chromatin repressors are important for compaction Dounia Djeghloul 1, Bhavik Patel2, Holger Kramer 3, Andrew Dimond 1, Chad Whilding4, Karen Brown1, Anne-Céline Kohler1, Amelie Feytout1, Nicolas Veland 1, James Elliott2, Tanmay A. M. Bharat 5, Abul K. Tarafder5, Jan Löwe 6, Bee L. Ng 7, Ya Guo1, Jacky Guy 8, Miles K. Huseyin 9, Robert J. Klose9, ✉ Matthias Merkenschlager 1 & Amanda G. Fisher 1 1234567890():,; Epigenetic information is transmitted from mother to daughter cells through mitosis. Here, to identify factors that might play a role in conveying epigenetic memory through cell division, we report on the isolation of unfixed, native chromosomes from metaphase-arrested cells using flow cytometry and perform LC-MS/MS to identify chromosome-bound proteins. A quantitative proteomic comparison between metaphase-arrested cell lysates and chromosome-sorted samples reveals a cohort of proteins that were significantly enriched on mitotic ESC chromosomes. These include pluripotency-associated transcription factors, repressive chromatin-modifiers such as PRC2 and DNA methyl-transferases, and proteins governing chromosome architecture. Deletion of PRC2, Dnmt1/3a/3b or Mecp2 in ESCs leads to an increase in the size of individual mitotic chromosomes, consistent with de- condensation. Similar results were obtained by the experimental cleavage of cohesin. Thus, we identify chromosome-bound factors in pluripotent stem cells during mitosis and reveal that PRC2, DNA methylation and Mecp2 are required to maintain chromosome compaction. 1 Lymphocyte Development Group, MRC London Institute of Medical Sciences, Imperial College London, Hammersmith Hospital Campus, Du Cane Road, London W12 0NN, UK.
[Show full text]
Molecular Targeting and Enhancing Anticancer Efficacy of Oncolytic HSV-1 to Midkine Expressing Tumors
University of Cincinnati Date: 12/20/2010 I, Arturo R Maldonado , hereby submit this original work as part of the requirements for the degree of Doctor of Philosophy in Developmental Biology. It is entitled: Molecular Targeting and Enhancing Anticancer Efficacy of Oncolytic HSV-1 to Midkine Expressing Tumors Student's name: Arturo R Maldonado This work and its defense approved by: Committee chair: Jeffrey Whitsett Committee member: Timothy Crombleholme, MD Committee member: Dan Wiginton, PhD Committee member: Rhonda Cardin, PhD Committee member: Tim Cripe 1297 Last Printed:1/11/2011 Document Of Defense Form Molecular Targeting and Enhancing Anticancer Efficacy of Oncolytic HSV-1 to Midkine Expressing Tumors A dissertation submitted to the Graduate School of the University of Cincinnati College of Medicine in partial fulfillment of the requirements for the degree of DOCTORATE OF PHILOSOPHY (PH.D.) in the Division of Molecular & Developmental Biology 2010 By Arturo Rafael Maldonado B.A., University of Miami, Coral Gables, Florida June 1993 M.D., New Jersey Medical School, Newark, New Jersey June 1999 Committee Chair: Jeffrey A. Whitsett, M.D. Advisor: Timothy M. Crombleholme, M.D. Timothy P. Cripe, M.D. Ph.D. Dan Wiginton, Ph.D. Rhonda D. Cardin, Ph.D. ABSTRACT Since 1999, cancer has surpassed heart disease as the number one cause of death in the US for people under the age of 85. Malignant Peripheral Nerve Sheath Tumor (MPNST), a common malignancy in patients with Neurofibromatosis, and colorectal cancer are midkine- producing tumors with high mortality rates. In vitro and preclinical xenograft models of MPNST were utilized in this dissertation to study the role of midkine (MDK), a tumor-specific gene over- expressed in these tumors and to test the efficacy of a MDK-transcriptionally targeted oncolytic HSV-1 (oHSV).
[Show full text]
PCGF6 Regulates Stem Cell Pluripotency As a Transcription Activator Via Super-Enhancer Dependent Chromatin Interactions
Protein Cell https://doi.org/10.1007/s13238-019-0629-9 Protein & Cell RESEARCH ARTICLE PCGF6 regulates stem cell pluripotency as a transcription activator via super-enhancer dependent chromatin interactions Xiaona Huang1,2,3,4 , Chao Wei1,2,3,4, Fenjie Li1,2,3,4, Lumeng Jia5, Pengguihang Zeng1,2,3, Jiahe Li1,2,3, Jin Tan1,2,3, Tuanfeng Sun1,2,3, Shaoshuai Jiang1,2,3, Jia Wang1,2,3, Xiuxiao Tang1,2,3, Qingquan Zhao1,2,3, Bin Liu6, Limin Rong6, Cheng Li5, Junjun Ding1,2,3,4,7& 1 RNA Biomedical Institute, Sun Yat-Sen Memorial Hospital, Zhongshan School of Medicine, Sun Yat-Sen University, Guangzhou 510080, China 2 Center for Stem Cell Biology and Tissue Engineering, Key Laboratory for Stem Cells and Tissue Engineering, Ministry of Cell Education, Sun Yat-Sen University, Guangzhou 510080, China & 3 Department of Cell Biology, Zhongshan School of Medicine, Sun Yat-sen University, Guangzhou 510080, China 4 Program in Stem Cell and Regenerative Medicine, The Third Afﬁliated Hospital of Sun Yat-sen University, Zhongshan School of Medicine, Sun Yat-Sen University, Guangzhou, China 5 Center for Bioinformatics, School of Life Sciences, Peking University, Beijing 100871, China 6 Department of Spine Surgery, The Third Afﬁliated Hospital of Sun Yat-sen University, Guangzhou 510630, China Protein 7 Department of Histology and Embryology, School of Basic Medical Sciences, Guangzhou Medical University, Guangzhou 511436, China & Correspondence: [email protected] (J. Ding) Received January 18, 2019 Accepted April 15, 2019 ABSTRACT pluripotency, and provide a research basis for the ther- apeutic application of pluripotent stem cells.
[Show full text]
Novel and Highly Recurrent Chromosomal Alterations in Se´Zary Syndrome
Research Article Novel and Highly Recurrent Chromosomal Alterations in Se´zary Syndrome Maarten H. Vermeer,1 Remco van Doorn,1 Remco Dijkman,1 Xin Mao,3 Sean Whittaker,3 Pieter C. van Voorst Vader,4 Marie-Jeanne P. Gerritsen,5 Marie-Louise Geerts,6 Sylke Gellrich,7 Ola So¨derberg,8 Karl-Johan Leuchowius,8 Ulf Landegren,8 Jacoba J. Out-Luiting,1 Jeroen Knijnenburg,2 Marije IJszenga,2 Karoly Szuhai,2 Rein Willemze,1 and Cornelis P. Tensen1 Departments of 1Dermatology and 2Molecular Cell Biology, Leiden University Medical Center, Leiden, the Netherlands; 3Department of Dermatology, St Thomas’ Hospital, King’s College, London, United Kingdom; 4Department of Dermatology, University Medical Center Groningen, Groningen, the Netherlands; 5Department of Dermatology, Radboud University Nijmegen Medical Center, Nijmegen, the Netherlands; 6Department of Dermatology, Gent University Hospital, Gent, Belgium; 7Department of Dermatology, Charite, Berlin, Germany; and 8Department of Genetics and Pathology, Rudbeck Laboratory, University of Uppsala, Uppsala, Sweden Abstract Introduction This study was designed to identify highly recurrent genetic Se´zary syndrome (Sz) is an aggressive type of cutaneous T-cell alterations typical of Se´zary syndrome (Sz), an aggressive lymphoma/leukemia of skin-homing, CD4+ memory T cells and is cutaneous T-cell lymphoma/leukemia, possibly revealing characterized by erythroderma, generalized lymphadenopathy, and pathogenetic mechanisms and novel therapeutic targets. the presence of neoplastic T cells (Se´zary cells) in the skin, lymph High-resolution array-based comparative genomic hybridiza- nodes, and peripheral blood (1). Sz has a poor prognosis, with a tion was done on malignant T cells from 20 patients. disease-specific 5-year survival of f24% (1).
[Show full text]
Integrative Framework for Identification of Key Cell Identity Genes Uncovers
Integrative framework for identification of key cell PNAS PLUS identity genes uncovers determinants of ES cell identity and homeostasis Senthilkumar Cinghua,1, Sailu Yellaboinaa,b,c,1, Johannes M. Freudenberga,b, Swati Ghosha, Xiaofeng Zhengd, Andrew J. Oldfielda, Brad L. Lackfordd, Dmitri V. Zaykinb, Guang Hud,2, and Raja Jothia,b,2 aSystems Biology Section and dStem Cell Biology Section, Laboratory of Molecular Carcinogenesis, and bBiostatistics Branch, National Institute of Environmental Health Sciences, National Institutes of Health, Research Triangle Park, NC 27709; and cCR Rao Advanced Institute of Mathematics, Statistics, and Computer Science, Hyderabad, Andhra Pradesh 500 046, India Edited by Norbert Perrimon, Harvard Medical School and Howard Hughes Medical Institute, Boston, MA, and approved March 17, 2014 (received for review October 2, 2013) Identification of genes associated with specific biological pheno- (mESCs) for genes essential for the maintenance of ESC identity types is a fundamental step toward understanding the molecular resulted in only ∼8% overlap (8, 9), although many of the unique basis underlying development and pathogenesis. Although RNAi- hits in each screen were known or later validated to be real. The based high-throughput screens are routinely used for this task, lack of concordance suggest that these screens have not reached false discovery and sensitivity remain a challenge. Here we describe saturation (14) and that additional genes of importance remain a computational framework for systematic integration of published to be discovered. gene expression data to identify genes defining a phenotype of Motivated by the need for an alternative approach for iden- interest. We applied our approach to rank-order all genes based on tification of key cell identity genes, we developed a computa- their likelihood of determining ES cell (ESC) identity.
[Show full text]
BMI1 Is a Context-Dependent Tumor Suppressor That Is a Barrier to Dedifferentiation in Non-Small Cell Lung Adenocarcinoma
BMI1 is a context-dependent tumor suppressor that is a barrier to dedifferentiation in non-small cell lung adenocarcinoma by Rachit Neupane B.A. Biology Bard College Submitted to the Department of Biology in partial fulfillment of the requirements for the degree of Doctor of Philosophy in Biology at the Massachusetts Institute of Technology May 2019 © Massachusetts Institute of Technology All Rights Reserved Signature of the Author _________________________________________________________ Rachit Neupane Department of Biology May 23, 2019 Certified by __________________________________________________________________ Jacqueline A. Lees Professor of Biology May 23, 2019 Accepted by __________________________________________________________________ Amy Keating Professor of Biology Chairman, Graduate Committee May 23, 2019 0 BMI1 is a context-dependent tumor suppressor that is a barrier to dedifferentiation in non-small cell lung adenocarcinoma by Rachit Neupane Submitted to the Department of Biology on May 24, 2019 in Partial Fulfillment of the Requirements for the Degree of Doctor of Philosophy in Biology ABSTRACT Predictive value is expected when preclinical models of disease are used for research. However, not all models appropriately mimic the disease progression or the treatment paradigm in the clinic. This thesis addresses an epigenetic regulator, Bmi1, which acts in stem cells to maintain their proliferative and self-renewal capacity primarily through silencing of the Ink4a/Arf locus. Bmi1 has been proposed as a good therapeutic candidate in cancer because of its presumed role in maintaining tumor propagating cells (TPCs). This conclusion is based on the observed tumor suppressive effects of Bmi1 deletion in in vitro cell culture models, in vivo transplant models, and autochthonous models in which Bmi1 was absent throughout development.
[Show full text]
PCGF5 Is Required for Neural Differentiation of Embryonic Stem Cells
ARTICLE DOI: 10.1038/s41467-018-03781-0 OPEN PCGF5 is required for neural differentiation of embryonic stem cells Mingze Yao1,2, Xueke Zhou1,2, Jiajian Zhou 3, Shixin Gong1,2, Gongcheng Hu1,2, Jiao Li 1,2, Kaimeng Huang 1,2, Ping Lai1,2, Guang Shi1,2, Andrew P. Hutchins 4, Hao Sun 3, Huating Wang5 & Hongjie Yao 1,2 Polycomb repressive complex 1 (PRC1) is an important regulator of gene expression and 1234567890():,; development. PRC1 contains the E3 ligases RING1A/B, which monoubiquitinate lysine 119 at histone H2A (H2AK119ub1), and has been sub-classified into six major complexes based on the presence of a PCGF subunit. Here, we report that PCGF5, one of six PCGF paralogs, is an important requirement in the differentiation of mouse embryonic stem cells (mESCs) towards a neural cell fate. Although PCGF5 is not required for mESC self-renewal, its loss blocks mESC neural differentiation by activating the SMAD2/TGF-β signaling pathway. PCGF5 loss- of-function impairs the reduction of H2AK119ub1 and H3K27me3 around neural specific genes and keeps them repressed. Our results suggest that PCGF5 might function as both a repressor for SMAD2/TGF-β signaling pathway and a facilitator for neural differentiation. Together, our findings reveal a critical context-specific function for PCGF5 in directing PRC1 to control cell fate. 1 CAS Key Laboratory of Regenerative Biology, Joint School of Life Sciences, Guangzhou Institutes of Biomedicine and Health, Chinese Academy of Sciences, Guangzhou Medical University, Guangzhou 510530, China. 2 Guangdong Provincial Key Laboratory of Stem Cell and Regenerative Medicine, CAS Center for Excellence in Molecular Cell Science, Guangzhou Institutes of Biomedicine and Health, Chinese Academy of Sciences, Guangzhou 510530, China.
[Show full text]