DOCSLIB.ORG

Cellular and Molecular Mechanisms of Photodynamic Hypericin Therapy for Nasopharyngeal Carcinoma Cells

Total Page：16

File Type：pdf, Size：1020Kb

Download full-text PDF Read full-text
Cellular and Molecular Mechanisms of Photodynamic Hypericin Therapy for Nasopharyngeal Carcinoma Cells Cellular and Molecular Mechanisms of Photodynamic Hypericin Therapy for Nasopharyngeal Carcinoma cells Xiaoli Wangb$, Yi Guoa$, Shu Yanga, Caihong Wangb, Xuping Fua, Jinling Wangb, Yumin Maoa, b* a* Junsong Zhang , Yao Li aState Key Laboratory of Genetic Engineering, Institute of Genetics, School of Life Science, Fudan University, Shanghai 200433, P.R.China bSchool of Applied Chemistry and Biological, Shenzhen Polytechnic, Shenzhen, Guangdong 518055, P.R.China. The Journal of Pharmacology and Experimental Therapeutics Supplement Table S1. Genes up-regulated in all experimental groups GeneID Genetic information Gene No. chromosome Ratio RN7SK Homo sapiens RNA, 7SK, nuclear (RN7SK) on chromosome 6. NR_001445.1 6 320.633 HIST2H3C Homo sapiens histone 2, H3c (HIST2H3C), mRNA. NM_021059.2 48.67 BP873537 Sugano cDNA library, embryonal kidney Homo sapiens cDNA clone 47.045 HS.562219 HKR13896, mRNA sequence BP873537 HIST1H4B Homo sapiens histone 1, H4b (HIST1H4B), mRNA. NM_003544.2 6 42.321 BX109218 Soares_fetal_lung_NbHL19W Homo sapiens cDNA clone 42.115 HS.245367 IMAGp998C03690, mRNA sequence BX109218 TRQ1 Homo sapiens tRNA glutamine 1 (TRQ1) on chromosome 17. NR_000037.1 15 38.195 HIST1H2AH Homo sapiens histone 1, H2ah (HIST1H2AH), mRNA. NM_080596.1 6 33.628 HS.545589 Human small nuclear RNA U6atac, partial sequence U62823 32.42 LOC440686 Homo sapiens similar to histone H2B histone family (LOC440686), mRNA. NM_001025303.1 1 32.014 RNU12 Homo sapiens RNA, U12 small nuclear (RNU12) on chromosome X. NR_000041.1 X 31.693 HIST1H1B Homo sapiens histone 1, H1b (HIST1H1B), mRNA. NM_005322.2 6 27.632 TRK1 Homo sapiens tRNA lysine 1 (TRK1) on chromosome 17. NR_001449.1 11 27.546 RPPH1 Homo sapiens ribonuclease P RNA component H1 (RPPH1) on chromosome 14. NR_002312.1 14 23.993 HIST1H2BG Homo sapiens histone 1, H2bg (HIST1H2BG), mRNA. NM_003518.3 6 16.779 BX093900 Soares placenta Nb2HP Homo sapiens cDNA clone IMAGp998M23189, 13.798 HS.443602 mRNA sequence BX093900 FOXD4L1 Homo sapiens forkhead box D4-like 1 (FOXD4L1), mRNA. NM_012184.3 2 13.36 HS.545112 Homo sapiens mRNA; cDNA DKFZp434F0472 (from clone DKFZp434F0472) AL137331 12.512 ws25d05.x1 NCI_CGAP_GC6 Homo sapiens cDNA clone IMAGE:2498217 3, mRNA 12.003 HS.197703 sequence AI989490 Homo sapiens inhibitor of DNA binding 2, dominant negative helix-loop-helix protein 9.983 ID2 (ID2), mRNA. NM_002166.4 2 tt27g09.x1 NCI_CGAP_GC6 Homo sapiens cDNA clone IMAGE:2242048 3, mRNA 9.793 HS.371006 sequence AI655567 TSPYL3 PREDICTED: Homo sapiens TSPY-like 3 (pseudogene) (TSPYL3), misc RNA. XR_001421.1 9.651 PREDICTED: Homo sapiens similar to Kinase suppressor of ras-1 (Kinase 9.336 LOC649456 suppressor of ras) (LOC649456), mRNA. XM_938534.1 PREDICTED: Homo sapiens similar to Bcl-2-associated transcription factor 1 (Btf), 8.578 LOC650759 transcript variant 1 (LOC650759), mRNA. XM_940798.1 BX110944 Soares placenta Nb2HP Homo sapiens cDNA clone IMAGp998E24200, 7.462 HS.297929 mRNA sequence BX110944 ta96c03.x1 NCI_CGAP_Lu26 Homo sapiens cDNA clone IMAGE:2051908 3, mRNA 7.292 HS.436134 sequence AI349750 AGENCOURT_14535501 NIH_MGC_191 Homo sapiens cDNA clone 5.816 HS.543887 IMAGE:30415823 5, mRNA sequence CD640673 HIST1H4H Homo sapiens histone 1, H4h (HIST1H4H), mRNA. NM_003543.3 6 5.726 HS.550111 AV647906 GLC Homo sapiens cDNA clone GLCBDC04 3, mRNA sequence AV647906 5.265 EOMES Homo sapiens eomesodermin homolog (Xenopus laevis) (EOMES), mRNA. NM_005442.2 3 4.905 RNU15B Homo sapiens RNA, U15b small nucleolar (RNU15B) on chromosome 11. NR_000025.1 11 4.8 KRT6E Homo sapiens keratin 6E (KRT6E), mRNA. NM_173086.2 12 4.702 TMEM70 Homo sapiens transmembrane protein 70 (TMEM70), mRNA. NM_017866.3 8 4.627 BX113978 Soares_pregnant_uterus_NbHPU Homo sapiens cDNA clone 4.607 HS.370110 IMAGp998N131206, mRNA sequence BX113978 POLR1B Homo sapiens polymerase (RNA) I polypeptide B, 128kDa (POLR1B), mRNA. NM_019014.3 2 4.474 C14ORF172 Homo sapiens chromosome 14 open reading frame 172 (C14orf172), mRNA. NM_152307.1 14 4.413 LOC648852 PREDICTED: Homo sapiens hypothetical protein LOC648852 (LOC648852), mRNA. XM_940430.1 4.323 JMJD4 Homo sapiens jumonji domain containing 4 (JMJD4), mRNA. NM_023007.1 1 4.294 Homo sapiens LanC lantibiotic synthetase component C-like 2 (bacterial) (LANCL2), 4.07 LANCL2 mRNA. NM_018697.3 7 NCOA5 Homo sapiens nuclear receptor coactivator 5 (NCOA5), mRNA. NM_020967.2 2 3.959 BY796152 Homo sapiens eye Homo sapiens cDNA clone 3.883 HS.544432 HEmEye2030G10_072.ab1 5, mRNA sequence BY796152 PUS3 Homo sapiens pseudouridylate synthase 3 (PUS3), mRNA. NM_031307.2 11 3.788 DDX51 Homo sapiens DEAD (Asp-Glu-Ala-Asp) box polypeptide 51 (DDX51), mRNA. NM_175066.2 12 3.724 PREDICTED: Homo sapiens similar to arginine/serine-rich splicing factor 6, transcript 3.614 LOC644422 variant 1 (LOC644422), mRNA. XM_930254.1 17 HUS1B Homo sapiens HUS1 checkpoint homolog b (S. pombe) (HUS1B), mRNA. NM_148959.2 6 3.588 C12ORF43 Homo sapiens chromosome 12 open reading frame 43 (C12orf43), mRNA. NM_022895.1 12 3.398 RWDD1 Homo sapiens RWD domain containing 1 (RWDD1), transcript variant 2, mRNA. NM_016104.2 6 3.387 PREDICTED: Homo sapiens similar to protein immuno-reactive with anti-PTH 3.351 LOC649841 polyclonal antibodies (LOC649841), mRNA. XM_938906.1 C7ORF36 Homo sapiens chromosome 7 open reading frame 36 (C7orf36), mRNA. NM_020192.1 7 3.342 Homo sapiens malignant fibrous histiocytoma amplified sequence 1 (MFHAS1), 3.301 MFHAS1 mRNA. NM_004225.1 8 Homo sapiens complement component 4 binding protein, beta (C4BPB), transcript 3.298 C4BPB variant 1, mRNA. NM_000716.3 1 MTG1 Homo sapiens mitochondrial GTPase 1 homolog (S. cerevisiae) (MTG1), mRNA. NM_138384.1 1 3.296 CGI-115 Homo sapiens CGI-115 protein (CGI-115), mRNA. NM_016052.2 1 3.264 ZNHIT2 Homo sapiens zinc finger, HIT type 2 (ZNHIT2), mRNA. NM_014205.2 11 3.204 GRWD1 Homo sapiens glutamate-rich WD repeat containing 1 (GRWD1), mRNA. NM_031485.2 19 3.184 LCMT2 Homo sapiens leucine carboxyl methyltransferase 2 (LCMT2), mRNA. NM_014793.3 15 3.147 GPATC3 Homo sapiens G patch domain containing 3 (GPATC3), mRNA. NM_022078.1 1 3.138 Homo sapiens tRNA 5-methylaminomethyl-2-thiouridylate methyltransferase 3.129 TRMU (TRMU), nuclear gene encoding mitochondrial protein, transcript variant 5, mRNA. NM_001008571.1 22 Homo sapiens piggyBac transposable element derived 2 (PGBD2), transcript variant 3.089 PGBD2 1, mRNA. NM_170725.2 1 KIAA0133 Homo sapiens KIAA0133 (KIAA0133), mRNA. NM_014777.1 1 3.064 LOC221710 PREDICTED: Homo sapiens hypothetical protein LOC221710 (LOC221710), mRNA. XM_927609.1 6 3.043 ALKBH8 Homo sapiens alkB, alkylation repair homolog 8 (E. coli) (ALKBH8), mRNA. NM_138775.1 11 3.036 FLJ20516 Homo sapiens timeless-interacting protein (FLJ20516), mRNA. NM_017858.1 15 3.027 MGC5242 Homo sapiens hypothetical protein MGC5242 (MGC5242), mRNA. NM_024033.1 7 3.018 Homo sapiens serpin peptidase inhibitor, clade B (ovalbumin), member 8 2.993 SERPINB8 (SERPINB8), transcript variant 3, mRNA. NM_001031848.1 18 C1ORF33 Homo sapiens chromosome 1 open reading frame 33 (C1orf33), mRNA. NM_016183.2 1 2.99 HSF2BP Homo sapiens heat shock transcription factor 2 binding protein (HSF2BP), mRNA. NM_007031.1 21 2.962 LOC644790 PREDICTED: Homo sapiens similar to ribosomal protein S15a (LOC644790), mRNA. XM_927887.1 1 2.91 P2RY11 Homo sapiens purinergic receptor P2Y, G-protein coupled, 11 (P2RY11), mRNA. NM_002566.4 19 2.9 KIAA0690 Homo sapiens KIAA0690 (KIAA0690), mRNA. NM_015179.2 1 2.888 TXNL1 Homo sapiens thioredoxin-like 1 (TXNL1), mRNA. NM_004786.1 18 2.879 DNAJC5 Homo sapiens DnaJ (Hsp40) homolog, subfamily C, member 5 (DNAJC5), mRNA. NM_025219.1 2 2.871 C17ORF32 Homo sapiens chromosome 17 open reading frame 32 (C17orf32), mRNA. NM_152464.1 17 2.85 BX111520 Soares placenta Nb2HP Homo sapiens cDNA clone IMAGp998L15208, 2.829 HS.16515 mRNA sequence BX111520 DLEU1 PREDICTED: Homo sapiens deleted in lymphocytic leukemia, 1 (DLEU1), misc RNA. XR_001515.1 13 2.82 KLHL18 Homo sapiens kelch-like 18 (Drosophila) (KLHL18), mRNA. NM_025010.2 3 2.815 MSTO1 Homo sapiens misato homolog 1 (Drosophila) (MSTO1), mRNA. NM_018116.2 1 2.781 Homo sapiens ribonuclease P/MRP 38kDa subunit (RPP38), transcript variant 1, 2.778 RPP38 mRNA. NM_183005.1 1 PINX1 Homo sapiens PIN2-interacting protein 1 (PINX1), mRNA. NM_017884.3 8 2.759 IRX5 Homo sapiens iroquois homeobox protein 5 (IRX5), mRNA. NM_005853.4 16 2.758 PREDICTED: Homo sapiens similar to paraspeckle protein 1, transcript variant 2 2.73 LOC642395 (LOC642395), mRNA. XM_930623.1 13 C12ORF45 Homo sapiens chromosome 12 open reading frame 45 (C12orf45), mRNA. NM_152318.1 12 2.724 TMEM79 Homo sapiens transmembrane protein 79 (TMEM79), mRNA. NM_032323.1 1 2.721 Homo sapiens ankyrin repeat and SOCS box-containing 7 (ASB7), transcript variant 2.712 ASB7 1, mRNA. NM_024708.2 15 C6ORF157 Homo sapiens chromosome 6 open reading frame 157 (C6orf157), mRNA. NM_198920.1 6 2.702 HS.535360 Homo sapiens cDNA clone IMAGE:6250506 BC080616 2.698 Homo sapiens RRS1 ribosome biogenesis regulator homolog (S. cerevisiae) (RRS1), 2.695 RRS1 mRNA. NM_015169.3 8 MYL5 Homo sapiens myosin, light polypeptide 5, regulatory (MYL5), mRNA. NM_002477.1 4 2.688 ZC3H8 Homo sapiens zinc finger CCCH-type containing 8 (ZC3H8), mRNA. NM_032494.1 2 2.681 ANXA3 Homo sapiens annexin A3 (ANXA3), mRNA. NM_005139.1 4 2.672 C1ORF163 Homo sapiens chromosome 1 open reading frame 163 (C1orf163), mRNA. NM_023077.1 1 2.667 ZNF207 Homo sapiens zinc finger protein 207 (ZNF207), transcript variant 1, mRNA. NM_003457.2 17 2.667 ZNF232 Homo sapiens zinc finger protein 232 (ZNF232), mRNA. NM_014519.2 17 2.667 FLJ20309 Homo sapiens hypothetical protein FLJ20309 (FLJ20309), mRNA. NM_017759.2 2 2.643 EIF5A2 Homo sapiens eukaryotic translation initiation factor 5A2 (EIF5A2), mRNA. NM_020390.5 3 2.631 Homo sapiens M-phase phosphoprotein 10 (U3 small nucleolar ribonucleoprotein) 2.599 MPHOSPH10 (MPHOSPH10), mRNA. NM_005791.1 2 REP15 Homo sapiens Rab15 effector protein (REP15), mRNA. NM_001029874.1 12 2.599 C12ORF5 Homo sapiens chromosome 12 open reading frame 5 (C12orf5), mRNA.
Load more

Recommended publications
  • ABSTRACT ANGSTADT, ANDREA Y. Evaluation of the Genomic
    ABSTRACT ANGSTADT, ANDREA Y. Evaluation of the Genomic Aberrations in Canine Osteosarcoma and Their Resemblance to the Human Counterpart. (Under the direction of Dr. Matthew Breen). In the last decade the domestic dog has emerged as an ideal biomedical model of complex genetic diseases such as cancers. Cancer in the dog occurs spontaneously and several studies have concluded that human and canine cancers have similar characteristics such as presentation of disease, rate of metastases, genetic dysregulation, and survival rates. Furthermore, in the genomic era the dog genome was found more homologous in sequence conservation to humans than mice, making it a valuable model organism for genetic study in addition to pathophysiological analysis. Osteosarcoma (OS), the most commonly diagnosed malignant bone tumor in humans and dogs, is one such cancer that would benefit from comparative genomic analysis. In humans, OS is a rare cancer diagnosed in fewer than 1,000 people per year in the USA, while in the domestic dog population the annual number of new cases is estimated to far exceed 10,000. This high rate of disease occurrence in dogs provides a unique opportunity to study the genomic imbalances in canine OS and their translational value to human OS as a means to identify important alterations involved in disease etiology. OS in humans is characterized by extremely complex karyotypes which contain both structural changes (translocations and/or rearrangements) and DNA copy number changes. Metaphase and array comparative genomic hybridization (aCGH) has assisted in uncovering the genetic imbalances that are associated with human OS phenotype. In dog OS, previous low-resolution (10-20Mb) aCGH analysis identified a wide range of recurrent copy number aberrations (CNAs), indicative of a similar level of genomic instability to human OS.
    [Show full text]
  • Histone Isoform H2A1H Promotes Attainment of Distinct Physiological
    Bhattacharya et al. Epigenetics & Chromatin (2017) 10:48 DOI 10.1186/s13072-017-0155-z Epigenetics & Chromatin RESEARCH Open Access Histone isoform H2A1H promotes attainment of distinct physiological states by altering chromatin dynamics Saikat Bhattacharya1,4,6, Divya Reddy1,4, Vinod Jani5†, Nikhil Gadewal3†, Sanket Shah1,4, Raja Reddy2,4, Kakoli Bose2,4, Uddhavesh Sonavane5, Rajendra Joshi5 and Sanjay Gupta1,4* Abstract Background: The distinct functional efects of the replication-dependent histone H2A isoforms have been dem- onstrated; however, the mechanistic basis of the non-redundancy remains unclear. Here, we have investigated the specifc functional contribution of the histone H2A isoform H2A1H, which difers from another isoform H2A2A3 in the identity of only three amino acids. Results: H2A1H exhibits varied expression levels in diferent normal tissues and human cancer cell lines (H2A1C in humans). It also promotes cell proliferation in a context-dependent manner when exogenously overexpressed. To uncover the molecular basis of the non-redundancy, equilibrium unfolding of recombinant H2A1H-H2B dimer was performed. We found that the M51L alteration at the H2A–H2B dimer interface decreases the temperature of melting of H2A1H-H2B by ~ 3 °C as compared to the H2A2A3-H2B dimer. This diference in the dimer stability is also refected in the chromatin dynamics as H2A1H-containing nucleosomes are more stable owing to M51L and K99R substitu- tions. Molecular dynamic simulations suggest that these substitutions increase the number of hydrogen bonds and hydrophobic interactions of H2A1H, enabling it to form more stable nucleosomes. Conclusion: We show that the M51L and K99R substitutions, besides altering the stability of histone–histone and histone–DNA complexes, have the most prominent efect on cell proliferation, suggesting that the nucleosome sta- bility is intimately linked with the physiological efects observed.
    [Show full text]
  • University of California, San Diego
    UNIVERSITY OF CALIFORNIA, SAN DIEGO The post-terminal differentiation fate of RNAs revealed by next-generation sequencing A dissertation submitted in partial satisfaction of the requirements for the degree Doctor of Philosophy in Biomedical Sciences by Gloria Kuo Lefkowitz Committee in Charge: Professor Benjamin D. Yu, Chair Professor Richard Gallo Professor Bruce A. Hamilton Professor Miles F. Wilkinson Professor Eugene Yeo 2012 Copyright Gloria Kuo Lefkowitz, 2012 All rights reserved. The Dissertation of Gloria Kuo Lefkowitz is approved, and it is acceptable in quality and form for publication on microfilm and electronically: __________________________________________________________________ __________________________________________________________________ __________________________________________________________________ __________________________________________________________________ __________________________________________________________________ Chair University of California, San Diego 2012 iii DEDICATION Ma and Ba, for your early indulgence and support. Matt and James, for choosing more practical callings. Roy, my love, for patiently sharing the ups and downs of this journey. iv EPIGRAPH It is foolish to tear one's hair in grief, as though sorrow would be made less by baldness. ~Cicero v TABLE OF CONTENTS Signature Page .............................................................................................................. iii Dedication ....................................................................................................................
    [Show full text]
  • Translational Control in Cancer Etiology
    Downloaded from http://cshperspectives.cshlp.org/ on October 1, 2021 - Published by Cold Spring Harbor Laboratory Press Translational Control in Cancer Etiology Davide Ruggero Helen Diller Cancer Center, School of Medicine, University of California, San Francisco, California 94158 Correspondence: [email protected] The link between perturbations in translational control and cancer etiology is becoming a primary focus in cancer research. It has now been established that genetic alterations in several components of the translational apparatus underlie spontaneous cancers as well as an entire class of inherited syndromes known as “ribosomopathies” associated with in- creased cancer susceptibility. These discoveries have illuminated the importance of dereg- ulations in translational control to very specific cellular processes that contribute to cancer etiology. In addition, a growing body of evidence supports the view that deregulation of translational control is a common mechanism by which diverse oncogenic pathways promote cellular transformation and tumor development. Indeed, activation of these key oncogenic pathways induces rapid and dramatic translational reprogramming both by in- creasing overall protein synthesis and by modulating specific mRNA networks. These trans- lational changes promote cellular transformation, impacting almost every phase of tumor development. This paradigm represents a new frontier in the multihit model of cancer for- mation and offers significant promise for innovative cancer therapies. Current research,
    [Show full text]
  • Analysis of Trans Esnps Infers Regulatory Network Architecture
    Analysis of trans eSNPs infers regulatory network architecture Anat Kreimer Submitted in partial fulfillment of the requirements for the degree of Doctor of Philosophy in the Graduate School of Arts and Sciences COLUMBIA UNIVERSITY 2014 © 2014 Anat Kreimer All rights reserved ABSTRACT Analysis of trans eSNPs infers regulatory network architecture Anat Kreimer eSNPs are genetic variants associated with transcript expression levels. The characteristics of such variants highlight their importance and present a unique opportunity for studying gene regulation. eSNPs affect most genes and their cell type specificity can shed light on different processes that are activated in each cell. They can identify functional variants by connecting SNPs that are implicated in disease to a molecular mechanism. Examining eSNPs that are associated with distal genes can provide insights regarding the inference of regulatory networks but also presents challenges due to the high statistical burden of multiple testing. Such association studies allow: simultaneous investigation of many gene expression phenotypes without assuming any prior knowledge and identification of unknown regulators of gene expression while uncovering directionality. This thesis will focus on such distal eSNPs to map regulatory interactions between different loci and expose the architecture of the regulatory network defined by such interactions. We develop novel computational approaches and apply them to genetics-genomics data in human. We go beyond pairwise interactions to define network motifs, including regulatory modules and bi-fan structures, showing them to be prevalent in real data and exposing distinct attributes of such arrangements. We project eSNP associations onto a protein-protein interaction network to expose topological properties of eSNPs and their targets and highlight different modes of distal regulation.
    [Show full text]
  • PRODUCT SPECIFICATION Anti-C12orf43
    Anti-C12orf43 Product Datasheet Polyclonal Antibody PRODUCT SPECIFICATION Product Name Anti-C12orf43 Product Number HPA046148 Gene Description chromosome 12 open reading frame 43 Clonality Polyclonal Isotype IgG Host Rabbit Antigen Sequence Recombinant Protein Epitope Signature Tag (PrEST) antigen sequence: AWGLEQRPHVAGKPRAGAANSQLSTSQPSLRHKVNEHEQDGNELQTTPEF RAHVAKKLGALLDSFITISEAAKEPAKAKVQKVALEDDGFRLFFTSVPGG REKEESPQPR Purification Method Affinity purified using the PrEST antigen as affinity ligand Verified Species Human Reactivity Recommended IHC (Immunohistochemistry) Applications - Antibody dilution: 1:50 - 1:200 - Retrieval method: HIER pH6 WB (Western Blot) - Working concentration: 0.04-0.4 µg/ml ICC-IF (Immunofluorescence) - Fixation/Permeabilization: PFA/Triton X-100 - Working concentration: 0.25-2 µg/ml Characterization Data Available at atlasantibodies.com/products/HPA046148 Buffer 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative. Concentration Lot dependent Storage Store at +4°C for short term storage. Long time storage is recommended at -20°C. Notes Gently mix before use. Optimal concentrations and conditions for each application should be determined by the user. For protocols, additional product information, such as images and references, see atlasantibodies.com. Product of Sweden. For research use only. Not intended for pharmaceutical development, diagnostic, therapeutic or any in vivo use. No products from Atlas Antibodies may be resold, modified for resale or used to manufacture commercial products without prior written approval from Atlas Antibodies AB. Warranty: The products supplied by Atlas Antibodies are warranted to meet stated product specifications and to conform to label descriptions when used and stored properly. Unless otherwise stated, this warranty is limited to one year from date of sales for products used, handled and stored according to Atlas Antibodies AB's instructions.
    [Show full text]
  • Table S1. 49 Histone Variants Were Identified with High Sequence Coverage Through LC-MS/MS Analysis Electronic Supplementary
    Electronic Supplementary Material (ESI) for Analytical Methods. This journal is © The Royal Society of Chemistry 2020 Table S1. 49 histone variants were identified with high sequence coverage through LC-MS/MS analysis Sequence Uniprot IDs Protein Name Protein Description Coverage Ratio E2+/E2- RSD P07305 H10_HUMAN 67.5% Histone H1.0 OS=Homo sapiens GN=H1F0 PE=1 SV=3 4.85 23.3% Histone H1.1 OS=Homo sapiens GN=HIST1H1A PE=1 Q02539 H11_HUMAN 74.4% SV=3 0.35 92.6% Histone H1.2 OS=Homo sapiens GN=HIST1H1C PE=1 P16403 H12_HUMAN 67.1% SV=2 0.73 80.6% Histone H1.3 OS=Homo sapiens GN=HIST1H1D PE=1 P16402 H13_HUMAN 63.8% SV=2 0.75 77.7% Histone H1.4 OS=Homo sapiens GN=HIST1H1E PE=1 P10412 H14_HUMAN 69.0% SV=2 0.70 80.3% Histone H1.5 OS=Homo sapiens GN=HIST1H1B PE=1 P16401 H15_HUMAN 79.6% SV=3 0.29 98.3% Testis-specific H1 histone OS=Homo sapiens GN=H1FNT Q75WM6 H1FNT_HUMAN 7.8% \ \ PE=2 SV=3 Histone H1oo OS=Homo sapiens GN=H1FOO PE=2 Q8IZA3 H1FOO_HUMAN 5.2% \ \ SV=1 Histone H1t OS=Homo sapiens GN=HIST1H1T PE=2 P22492 H1T_HUMAN 31.4% SV=4 1.42 65.0% Q92522 H1X_HUMAN 82.6% Histone H1x OS=Homo sapiens GN=H1FX PE=1 SV=1 1.15 33.2% Histone H2A type 1 OS=Homo sapiens GN=HIST1H2AG P0C0S8 H2A1_HUMAN 99.2% PE=1 SV=2 0.57 26.8% Q96QV6 H2A1A_HUMAN 58.0% Histone H2A type 1-A OS=Homo sapiens 0.90 11.2% GN=HIST1H2AA PE=1 SV=3 Histone H2A type 1-B/E OS=Homo sapiens P04908 H2A1B_HUMAN 99.2% GN=HIST1H2AB PE=1 SV=2 0.92 30.2% Histone H2A type 1-C OS=Homo sapiens Q93077 H2A1C_HUMAN 100.0% GN=HIST1H2AC PE=1 SV=3 0.76 27.6% Histone H2A type 1-D OS=Homo sapiens P20671
    [Show full text]
  • UNIVERSITY of CALIFORNIA, SAN DIEGO Functional Analysis of Sall4
    UNIVERSITY OF CALIFORNIA, SAN DIEGO Functional analysis of Sall4 in modulating embryonic stem cell fate A dissertation submitted in partial satisfaction of the requirements for the degree Doctor of Philosophy in Molecular Pathology by Pei Jen A. Lee Committee in charge: Professor Steven Briggs, Chair Professor Geoff Rosenfeld, Co-Chair Professor Alexander Hoffmann Professor Randall Johnson Professor Mark Mercola 2009 Copyright Pei Jen A. Lee, 2009 All rights reserved. The dissertation of Pei Jen A. Lee is approved, and it is acceptable in quality and form for publication on microfilm and electronically: ______________________________________________________________ ______________________________________________________________ ______________________________________________________________ ______________________________________________________________ Co-Chair ______________________________________________________________ Chair University of California, San Diego 2009 iii Dedicated to my parents, my brother ,and my husband for their love and support iv Table of Contents Signature Page……………………………………………………………………….…iii Dedication…...…………………………………………………………………………..iv Table of Contents……………………………………………………………………….v List of Figures…………………………………………………………………………...vi List of Tables………………………………………………….………………………...ix Curriculum vitae…………………………………………………………………………x Acknowledgement………………………………………………….……….……..…...xi Abstract………………………………………………………………..…………….....xiii Chapter 1 Introduction ..…………………………………………………………………………….1 Chapter 2 Materials and Methods……………………………………………………………..…12
    [Show full text]
  • Supplementary Table 1. Primer Sequences Used in RT-PCR Analysis
    Supplementary Table 1. Primer sequences used in RT-PCR analysis L32 Forward TGAAGCAGGCATCTGAGGG Reverse CGAAGGTGGAAGAG TGGGAG LIFR Forward CTCTCAGGCCAGAGTTGAGC Reverse GCTGTTCAGTCAGCCCTCTC CCR2 Forward TGTCTTCCCTGAATTGAGCC Reverse AAACGCATTAGTGGACAGGG IL12R Forward CGCAATACGTCGTGCGCTGC Reverse CACTCTGACTCCCACGCGCC CSF1R Forward GCTGGTGCGGATTCGAGGGG Reverse TTCGGCGTTAGTGGCCGAGC TGFbR1 Forward ACGCGCTGACATCTATGCAA Reverse CGTCGAGCAATTTCCCAGAA TGFbR2 Forward GCGCATCGCCAGCACGATCC Reverse TGGGCTTCCATTTCCACATCCGA CXCR1 Forward TCCTCCTGCCGCTGCTCACT Reverse CATGCGCAGTGTGAGCCCGT CXCR2 Forward CCTCGTGCCGCTGCTCATCA Reverse GGTGCGCAGTGTGAACCCGT CXCR3 Forward GGTCGCACTGCTCTGCGTGT Reverse GGGGCAGCAGGAAACCAGCC CXCR4 Forward GAGGCGTTTGGTGCTCCGGT Reverse TCGGTTCCATGGCAACACTCGC VEGFR1 (Flt1) Forward CGCGTGAAGAGTGGGTCCT Reverse CACATGCACGGAGGTGTTG VEGFR2 (Flk1) Forward AGCCCAGACTGTGTCCCGCA Reverse GGTGTCCGCGGAATCGGGTC VEGFR3 (Flt4) Forward GCCCGAGGACGAGGGTGACT Reverse CCTGGCTGCGCCTATCCTGC human Flt1 Forward GCACGTCAGCGAAGGCAAGC Reverse CCAGCTCAGCGTGGTCGTAGG Supplementary Table 2. List of putative miR-200 target genes amplified in human cancers amplified in cancers (Tumorscape)a Gene Symbol Title various cancers NSCLC PCT Errfi1 ERBB receptor feedback inhibitor 1 - yes 0.94 D11Bwg0517e DNA segment, Chr 11, Brigham & Women's Genetics 0517 expressed - yes 0.91 Pvrl4 poliovirus receptor-related 4 yes - 0.91 Mecp2 methyl CpG binding protein 2 yes yes 0.9 Jun Jun oncogene yes - 0.88 Prdm16 PR domain containing 16 - yes 0.88 Flt1 FMS-like tyrosine kinase 1 yes
    [Show full text]
  • A Computational Approach for Defining a Signature of Β-Cell Golgi Stress in Diabetes Mellitus
    Page 1 of 781 Diabetes A Computational Approach for Defining a Signature of β-Cell Golgi Stress in Diabetes Mellitus Robert N. Bone1,6,7, Olufunmilola Oyebamiji2, Sayali Talware2, Sharmila Selvaraj2, Preethi Krishnan3,6, Farooq Syed1,6,7, Huanmei Wu2, Carmella Evans-Molina 1,3,4,5,6,7,8* Departments of 1Pediatrics, 3Medicine, 4Anatomy, Cell Biology & Physiology, 5Biochemistry & Molecular Biology, the 6Center for Diabetes & Metabolic Diseases, and the 7Herman B. Wells Center for Pediatric Research, Indiana University School of Medicine, Indianapolis, IN 46202; 2Department of BioHealth Informatics, Indiana University-Purdue University Indianapolis, Indianapolis, IN, 46202; 8Roudebush VA Medical Center, Indianapolis, IN 46202. *Corresponding Author(s): Carmella Evans-Molina, MD, PhD ([email protected]) Indiana University School of Medicine, 635 Barnhill Drive, MS 2031A, Indianapolis, IN 46202, Telephone: (317) 274-4145, Fax (317) 274-4107 Running Title: Golgi Stress Response in Diabetes Word Count: 4358 Number of Figures: 6 Keywords: Golgi apparatus stress, Islets, β cell, Type 1 diabetes, Type 2 diabetes 1 Diabetes Publish Ahead of Print, published online August 20, 2020 Diabetes Page 2 of 781 ABSTRACT The Golgi apparatus (GA) is an important site of insulin processing and granule maturation, but whether GA organelle dysfunction and GA stress are present in the diabetic β-cell has not been tested. We utilized an informatics-based approach to develop a transcriptional signature of β-cell GA stress using existing RNA sequencing and microarray datasets generated using human islets from donors with diabetes and islets where type 1(T1D) and type 2 diabetes (T2D) had been modeled ex vivo. To narrow our results to GA-specific genes, we applied a filter set of 1,030 genes accepted as GA associated.
    [Show full text]
  • Download Download
    Supplementary Figure S1. Results of flow cytometry analysis, performed to estimate CD34 positivity, after immunomagnetic separation in two different experiments. As monoclonal antibody for labeling the sample, the fluorescein isothiocyanate (FITC)- conjugated mouse anti-human CD34 MoAb (Mylteni) was used. Briefly, cell samples were incubated in the presence of the indicated MoAbs, at the proper dilution, in PBS containing 5% FCS and 1% Fc receptor (FcR) blocking reagent (Miltenyi) for 30 min at 4 C. Cells were then washed twice, resuspended with PBS and analyzed by a Coulter Epics XL (Coulter Electronics Inc., Hialeah, FL, USA) flow cytometer. only use Non-commercial 1 Supplementary Table S1. Complete list of the datasets used in this study and their sources. GEO Total samples Geo selected GEO accession of used Platform Reference series in series samples samples GSM142565 GSM142566 GSM142567 GSM142568 GSE6146 HG-U133A 14 8 - GSM142569 GSM142571 GSM142572 GSM142574 GSM51391 GSM51392 GSE2666 HG-U133A 36 4 1 GSM51393 GSM51394 only GSM321583 GSE12803 HG-U133A 20 3 GSM321584 2 GSM321585 use Promyelocytes_1 Promyelocytes_2 Promyelocytes_3 Promyelocytes_4 HG-U133A 8 8 3 GSE64282 Promyelocytes_5 Promyelocytes_6 Promyelocytes_7 Promyelocytes_8 Non-commercial 2 Supplementary Table S2. Chromosomal regions up-regulated in CD34+ samples as identified by the LAP procedure with the two-class statistics coded in the PREDA R package and an FDR threshold of 0.5. Functional enrichment analysis has been performed using DAVID (http://david.abcc.ncifcrf.gov/)
    [Show full text]
  • Expression Analysis of Progesterone‑Regulated Mirnas in Cells Derived from Human Glioblastoma
    MOLECULAR MEDICINE REPORTS 23: 475, 2021 Expression analysis of progesterone‑regulated miRNAs in cells derived from human glioblastoma DIANA ELISA VELÁZQUEZ‑VÁZQUEZ1, AYLIN DEL MORAL‑MORALES1, JENIE MARIAN CRUZ‑BURGOS2, EDUARDO MARTÍNEZ‑MARTÍNEZ3, MAURICIO RODRÍGUEZ‑DORANTES2 and IGNACIO CAMACHO‑ARROYO1 1Unidad de Investigación en Reproducción Humana, Instituto Nacional de Perinatología‑Facultad de Química, Universidad Nacional Autónoma de México, Mexico City 04510; 2Oncogenomics Laboratory, The National Institute of Genomic Medicine; 3Laboratory of Cell Communication and Extracellular Vesicles, The National Institute of Genomic Medicine, Mexico City 14610, Mexico Received August 16, 2020; Accepted February 2, 2021 DOI: 10.3892/mmr.2021.12114 Abstract. Glioblastomas (GBMs) are the most frequent and is characterized by being highly infiltrative, angiogenic and malignant type of brain tumor. It has been reported that resistant to chemotherapy and radiotherapy. The medical progesterone (P4) regulates the progression of GBMs by modi‑ history of patients with GBM is short as few of them survive fying the expression of genes that promote cell proliferation, more than one year (1‑3). GBM is mainly diagnosed in adults migration and invasion; however, it is not fully understood >50 years old, but it can occur at any age and the incidence is how these processes are regulated. It is possible that P4 medi‑ higher in men than in women (3:2) (4). ates some of these effects through changes in the microRNA Studies have focused on the identification of new biomarkers (miRNA) expression profile in GBM cells. The present study and therapeutic agents in GBM. Of particular interest are the investigated the effects of P4 on miRNAs expression profile microRNAs (miRNAs), which are single‑stranded, short, in U‑251MG cells derived from a human GBM.
    [Show full text]