Pacific Grove to Spend Big Bucks to Make Ice Plant Pretty Again

VolumeThe 105 No. 44 Carmelwww.carmelpinecone.com Pine ConeNovember 1-7, 2019 T r u s t e d b y l o c a l s a n d l o v e d b y v i s i t o r s s i n c e 1 9 1 5 Hacienda Hay & Feed closes as owners retire Coastal staff urges By CHRIS COUNTS shop’s iconic emu. Locals have long depended on the business — located ‘No’ vote on desal SMALL BUSINESSES open and close every week on at 7180 Carmel Valley Road — for hay and feed for their the Monterey Peninsula, and hardly anyone bats an eye. livestock, along with a variety of horse and pet supplies. But the closure this week of Hacienda Hay and Feed in They’ve also brought kids and grandkids there to pet an n Reverses course on ‘slant well’ Carmel Valley has many in mourning. assortment of animals, which included a donkey, goats, And they’re wondering what will become of Sidney, the tortoises and, of course, the emu. And they went there for technology it previously demanded conversation and camaraderie, because By KELLY NIX those commodities were always available. HE STAFF of the California Coastal Commission Owner Chris Olow told The Pine T this week recommended denial of a permit for Cal Am’s Cone he was surprised by how big a deal desalination plant — a potentially devastating blow to the Hacienda Hay and Feed’s closure has private water company facing a two-year deadline to stop become. He and his wife, Jo Ann, have pumping most of the Monterey Peninsula’s water supply owned the business since July 1999. from the Carmel River. “I didn’t realize we had this big an im- The staff’s recommendation, which represents a rever- pact,” Olow said. “I know this has been sal of long-held state guidelines for desal technology, will a great run — with all the well-wishes, I be considered by the coastal commission Nov. 14 when it know we did it right.” meets in Half Moon Bay. The longtime owners of the proper- Despite an OK from the California Public Utilities ty, the Wolter family, are selling it, but Commission for the desal project just last year and approv- Olow said that’s not the reason he’s clos- al by the Monterey County Board of Supervisors in July, ing his business. the commission’s 91-page staff report released Monday “We decided to retire and move to says that Cal Am’s proposed plant could be harmful to the property we own in Oregon,” he ex- environment and might supply more water than the Mon- plained. PHOTO/CHRIS COUNTS terey Peninsula needs. Olow said he and his wife — who “A primary concern is that the project would not con- Long a hub of activity in Carmel Valley, Hacienda Hay and Feed is closing because its met in kindergarten and graduated from form to Coastal Act provisions regarding environmentally owners are retiring and moving Oregon. The news brought an outpouring of support and well wishes from longtime customers. See HACIENDA page 16A sensitive habitat areas,” the report said. ‘Sensitive species’ Specifically, the coastal commission contends that the Council returns to rules on sidewalk vending wells Cal Am would use to supply seawater for desalination would be located in an area that supports a “number By MARY SCHLEY make decisions on a future program.” of sensitive species” that could be “adversely” affected by Before the ink was dry on the new ordinance at the be- the wells. PREDICTED TO be an epidemic but in reality just ginning of the year, applications poured in for the permits, In 1995, Cal Am was ordered to stop pumping a large a sporadic outbreak, sidewalk selling returns to the city most of which went to local restaurants and owners who amount of water from the Carmel River. After a long pe- council’s agenda at its regular meeting Nov. 5, when plan- have never used them, including Rich Pepe, La Bicyclette, riod of discussion and debate about how to replace that ning director Marc Wiener plans to recommend extending Pescadero, Bashar Al Sneeh and Faisal Nimri (co-owners water, consensus settled on the possibility of a desal plant, an ordinance restricting it. of Dametra and several other restaurants), Ryan Sanchez but then Cal Am was also told it could not draw seawater A state law that took effect Jan. 1 requires cities to al- (Surf N Sand and Valley Hills Deli), Faris Nemri and Loie for such a plant directly from the ocean. To comply with low sidewalk vending and says street sellers can only be Al Nimri. that provision, Cal Am proposed building a desal plant in limited based on threats to the public’s health, safety and Also, Trevor Forster, a youth center board member, Marina with source wells located near the beach. The wells welfare. While other cities have seen more sellers, from Fermin Sanchez (Bruno’s Market) and Bowdee’s Shave would be drilled at an angle, allowing them to take in sea- coffee carts to pegboards full of jewelry, the streets of Ice were authorized to sell in Devendorf Park, but not on water that’s filtered through the sandy layer beneath the Carmel have been virtually untouched since the council sidewalks. ocean, rather than from the ocean itself, thereby avoiding approved an “urgency ordinance” regulating street sellers The sole permit issued to someone who wasn’t plan- impacts to sea life. This idea was something the coastal Jan. 8. ning to sell food went to artist Alyson de Guigne, who was commission heartily endorsed, especially in an age when also the only person who actually set up a cart to sell prod- use of desalinated water seemed destined to become an Crickets ucts on the sidewalk. After she lost a battle with planners essential part of life in California. The ordinance caps the number of sidewalk vending over whether she could add a protective cover to her cart, But now the coastal commission’s staff says building permits at 13, three of which can only set up in Deven- de Guigne hasn’t been seen selling merchandise down- wells on land is no good, either, because that can also dorf Park, and vendors can’t occupy narrow pathways and town in months. cause environmental damage. sidewalks, or be near benches, public trashcans, doorways, corners and other features commonly found downtown. See SIDEWALKS page 15A See DESAL page 18A The law expires Dec. 20, and rather than coming up with permanent regulations for street vending now, Wiener wants it extended until Dec. 19, 2020, to “provide the city Seldom-seen albatross rescued by SPCA council and staff additional time to study the issue and By KELLY NIX and a “fish slurry,” which Bergeron characterized as a fish smoothie. Yum. AN ALBATROSS that was found emaciated and suf- “We do that assisted feeding when a bird is really fering from hypothermia at Marina State Beach last week New city forester hired, was transferred to a center that specializes in rehabilitating See ALBATROSS page 15A injured birds and is slowly getting better. gets salary of $123k On Oct. 22, wildlife specialists from the SPCA for Monterey County rescued the large bird, which was in crit- By MARY SCHLEY ical condition. The nonprofit’s wildlife rescue team gave the seriously injured Laysan albatross fluids and food, and A CERTIFIED arborist who has worked in some as- warmed him up. As of late last week, the bird was able to pect of horticulture since she was in high school in Colo- eat fish but was still hypothermic and unable to regulate rado Springs, Colo., will become the new city forester next his body temperature. month. Sara Davis emerged as the top choice among 26 But SPCA spokeswoman Beth Brookhouser said Mon- applicants, city administrator Chip Rerig said this week, day that the nonprofit’s wildlife center — which treats a not only for her knowledge and experience, but for her variety of rescued animals — stabilized the animal and got personality. She is currently the urban forestry program him out of the critical phase before he was healthy enough manager for the City and County of Denver. to be transferred to International Bird Rescue in the San “She has a very approachable personality,” he said. Francisco Bay Area for long-term care and rehabilitation. “We’ve got a lot of folks here who like to share their per- “The bird came in very poor shape and was about as spective, and she seems like a good listener.” emaciated and unwell as we have seen an albatross come After longtime city forester Mike Branson retired in into care,” JD Bergeron, executive director of Internation- PHOTO/COURTESY SPCA the spring, the city advertised in professional journals and al Bird Rescue, told The Pine Cone Wednesday. “But he’s This albatross was emaciated and in critical condition when it was making slow progress.” found at Marina State Beach. This bird is now being treated by a See FORESTER page 17A Staff experts are helping the seabird eat pieces of fish bird rescue group, including wrapping his feet to prevent infection.

Attention readers: Don’t forget that you can have the complete Carmel Pine Cone delivered every Thursday evening to your tablet, laptop, PC or phone — with no banner ads, popups, click bait or paywalls. We also don’t harvest your data or make you create an account or password. Free subscriptions available at www.carmelpinecone.com. 2A The Carmel Pine Cone November 1, 2019 trunk sshowhow Sandy Claws By Lisa Crawford Watson this weekendekend Waldo Works scott barberrber When they were trying to decide which blue shirts & sweaters merle Australian shepherd to bring home from the breeder, they tossed a little ball toward the trio of 34 heritage puppies and chose the one who retrieved it. Once they got home, they realized they’d chosen premium denim a little rascal who liked to play hide-and-seek in the house. And when constantly asking, “Where’s the saxx dog?” became, “Where’s Waldo?” that’s when they the best underwear knew they’d named him. “We had been trying to figure out a unique name for him,” one of his people said. “When we had him november at the dog park, we didn’t want five dogs to come running when we called him. Waldo works.” 2 & 3 Waldo and his people had been living in Wash- ington State but moved to California and settled in Pacific Grove, where one of them works as a com- complementary mercial fisherman. gift wrapping Waldo became a devoted deck hand, which led parking validatedated to the nickname “Jig Head,” referring to a lead sink- with purchasease er attached to a fish hook. He’s that attached to his people. Yet, as much as Waldo likes being near water, he especially likes to hang out on the boat when it’s parked on the driveway. “Waldo loves to swim,” one of his people said. Waldo’s family describes him as energetic, mis- “As soon as he gets to the beach at Asilomar, he chievous, bossy and very loyal — all very Aussie SHOP AT KHAKISOFCARMEL.COM runs full speed into the waves. He doesn’t have a qualities. problem with getting wet, but he doesn’t seem to “Velcro would have been another good name for CARMEL PLAZA • OCEAN AVE • 831-625-8106 like the unstable feeling of a boat on the water.” him,” they said. “He doesn’t leave our side.”

Visit our 16,000 sq. ft. Showroom FOXY COUTURE Join us for a Special Event VINTAGE & DESIGNER RESALE at River House Books OPPLETON’S on Nov 3 from 1-3pm Bring a bag HAND CRAFTED FURNITURE AND INTERIOR DESIGN Grab a friend The hilarious Support the girls “Ya Wanna Watch? I’ll Let Ya!” Sunday,Sunday, NoNovembervember 33rdrd 33-6pm-6pm Buy a book - get a FREE Watch

208 Crossroads Blvd, Carmel

TWO GIRLS BEST House

299 Lighthouse, Monterey • 831 649 3083 • poppletonshome.com Cleaning FROM CARMEL ‘16, ‘17, ‘18 • Experienced • Professional Mon, Wed, Thurs & Sun 11-5 | Fri & Sat 11-6 | Closed Tues San Carlos & 7th Ave | Carmel-by-the-Sea Offering a personal (831)625-9995 | www.foxycouturecarmel.com and friendly touch for 30 years. BONDED JAMES E. RHEIM, M.D. + JOSEPH R. RHEIM, M.D. HOUSECLEANING SPECIALISTS Fall Revival So Many Dust Bunnies, 626-4426 Are you ready for this busy Holiday Season’s Festivities? So Little Time TwoGirlsFromCarmel.com Treat yourself to BOTOX at $11.00 per unit, and/or $750.00 for each syringe of Juvederm Voluma ®XC filler. SATURDAY Erase away all the summer sun damage with our Limelight special (IPL). $300.00 per treatment. A series of 4 treatments NOV 9th@ 2pm is recommended. Saving of $600.00. The Carmel Pine Cone DENTAL CARE Call in and schedule a consultation about our new Micro- Press Release guidelines needling/RF (Radio Frequency) machine! DOES MY PET NEED TO BRUSH? Press releases about newsworthy events should go to the All offers expire December 31, 2019. Danielle Hettler DVM following Pine Cone reporters: GIFT CERTIFICATES ARE AVAILABLE! Mary Schley: Carmel-by-the-Sea, food & wine, police, fire, criminal courts and schools Cosmetic Laser Center Consultations available by appointment. [email protected] All treatments are scheduled with our RN. Please make your Includes an entry appointment by calling our offices today. Chris Counts: Carmel Valley, Big Sur, Arts & Entertainment for a Raffle Prize of and scholastic sports [email protected] General Dermatology: 831.373.4404 $300 OFF Cosmetic Laser Center: 831.373.0441 Kelly Nix: Pacific Grove, Pebble Beach, Monterey, Seaside, 30 min lecture plus Q & A. Dental Cleaning! 757 Pacific Street, Suite A-1, Monterey state government, civil courts and water [email protected] $25 Donation to BirchBark Foundation.. Advanced Dermatology Medical Clinic Letters to the editor are only accepted by email and should be [email protected] www.rheimdermatology.com sent to November 1, 2019 The Carmel Pine Cone 3A OPEN TO THE PUBLIC Commission: War memorials need protection, regular maintenance

By MARY SCHLEY commission appointed a subcommittee to draft a policy, but the issue subsequently THE CITY’S most visible war memo- went dormant. rial — the stone arch on Ocean Avenue de- “The draft War Memorial Policy has signed by architect Charles Sumner Greene been complete for some time now, and staff nearly a century ago to honor those lost in has decided to move forward with bringing World War I — should have the beneﬁt of this before the city council for adoption,” ongoing care based on a solid city plan, planning director Marc Wiener said at the planning commissioners said last month, commission’s Oct. 9 meeting. and so should all the other war memorials The short document that seeks “to estab- in town. Commissioners approved a set of lish policies that maintain the respect and policies that are set for review by the city dignity of the war memorials with regards council at its Nov. 5 meeting. to their care, treatment and maintenance” More than three years ago, the planning includes rules for displaying banners near them, maintaining them, and keeping an inventory of them. “Each war memorial stands as a reminder and recognition of the sacriﬁce and courage that individuals made for our country and each of us,” the policy reads. “As such, it is of the utmost importance that policies be established with regards to the treatment and care of these memorials that hon-

or the men and women who COME VISIT US AT OUR served our country.” According to the policies, Monterey Showroom which must be approved by the city council: 8am to 4pm Monday through Friday Q No banners or structures and by appointment 831.375.7811 shall be attached to war memorials or the surrounding struc- HIGHEST QUALITY TEAK OUTDOOR FURNITURE, PERFORMANCE FABRICS tures that are part of them. AND LIMITED STOCK OF SALE ITEMS: DINING TABLES • DINING CHAIRS Q Banners and structures cannot obscure any war me- OCCASIONAL TABLES • COFFEE TABLES • LOUNGE CHAIRS • OTTOMANS morial. SOFAS • BAR CHAIRS • DAY BEDS • CONSOLES • OUTDOOR FABRICS AND Q Periodic maintenance MUCH MORE! assessments should be con- PHOTO/MARY SCHLEY ducted and maintenance 5 HARRIS COURT BUILDING W MONTEREY CA 93940 scheduled in a timely manner, The World War I Memorial Arch, which has been undergoing and those tasks will be the re- SUMMIT FURNITURE, INC. | 831.375.7811 | SUMMITFURNITURE.COM restoration, and other monuments honoring those who served MONTEREY LOS ANGELES SAN FRANCISCO LONDON MONACO should have regular care and attention, according to policies set for review by the city council next week. See MEMORIALS page 22A

PROUDLY PRESENTING

Bob McLaren Photography

Exclusive Showroom on the Monterey Peninsula Intricately Hand Knotted Area Rugs made with the Finest Materials from Nepal. Carpets & Floors is the ﬁrst store in Monterey & Santa Cruz County to offer Stark Rugs. Please come by and see what you are missing. Trade discounts given to designers.

~ Only at ~ FC Carpets & Floors, Inc. CELEBRATING A Karastan Gallery Showroom Ocean Avenueenue | CarmelCarmel-by-the-Sea by the Sea | (831) 624-2403 Carpets & 471 Lighthouse Avenue, Monterey Floors, Inc. 831-372-2300 | carpetsandfloorsmonterey.com IN BUSINESS Monday - Saturday 10am - 5:30pm | Sunday 12 - 5pm Open Monday through Saturday from 9am to 5pm | Closed Sunday www.augustinaleathers.com 4A The Carmel Pine Cone November 1, 2019 STAY INDEPENDENT With your own personal assistant TO DO • Errands run-shopping done. Police, Fire & • Conﬁdential assistance after any medical procedure. • Organize your space, Home & Garden Sheriff’s Log • Only 1 HR minimum commitment• Customized delicious meals • Free estimates, References Available 831-915-4001 That’s not what doggie doors are for

HERE’S A look at some of the signifi- reported money lost via fraudulent social me- cant calls logged by the Carmel-by-the-Sea dia activity. Police Department and the Monterey County Pacific Grove: Ammunition from a Sinex Sheriff’s Office last week. This week’s log residence was turned in for destruction. was compiled by Mary Schley. Pacific Grove: Dispute between neigh- bors on Jewell Avenue. FRIDAY, OCTOBER 11 Pacific Grove: Domestic violence incident on Lighthouse Avenue. A 30-year-old Carmel Valley: Child Protective Services male was arrested. referral on Salsipuedes Road. Carmel Valley: Deputy dispatched after SUNDAY, OCTOBER 13 report of vandalism of a mailbox on Flight Road by gunfire. Carmel-by-the-Sea: A vehicle was towed Carmel Valley: Vehicle’s window shat- from San Carlos south of 12th at 0343 hours tered by unidentified object on Carmel Valley for blocking a roadway. Road. Carmel-by-the-Sea: Vehicle vs. pedestri- Pacific Grove: An ID card was turned in an in the business area on Ocean Avenue. A trusted name on the Monterey Peninsula to PGPD records. Item booked for safekeep- Carmel-by-the-Sea: Lost women’s wallet ing. between the Sunset Center and Seventh Av- for nearly 50 years! Pacific Grove: Bike left on a property on enue. Chestnut Street. Officer responded, collected Carmel-by-the-Sea: Telephone report of Terry McGowan 831.236.7251 bike and took it to the city yard for storage. property possibly lost in the City of Carmel. Information only. SATURDAY, OCTOBER 12 Pacific Grove: Officer flagged down on TerryMcGowan.com Evans for dog at large. Carmel-by-the-Sea: Male at Santa Rita Carmel area: Wedding party on Mead- [email protected] and Fourth reported that someone cashed a ows Road had checked the noise ordinance check he did not write. He stated the bank prior to the change in July 2019 and thought GRI, CRS, ABR, SRS, e-Pro, SRES DRE: 01126129 was conducting an investigation and needed the wedding party had to end at 2200 hours. the incident documented. The wedding party was advised of the ordi- Carmel-by-the-Sea: Lost necklace in the nance change to 2100 hours for party noise, Helping you reach your real estate goals since 1991! area of Mission and Ocean. and they turned the music off immediately. A Carmel-by-the-Sea: Lost cell phone in copy of the county ordinance was provided. the area of San Carlos and Fifth. Case closed. Pacific Grove: A dog found on Highway 68 was brought to PGPD. Owner notified and To advertise in The Carmel Pine Cone picked up the dog. See POLICE LOG page 8RE contact [email protected] Pacific Grove: Monarch Lane resident in the Real Estate Section The gavel falls Verdicts, pleas and sentencings announced by Monterey County District Attorney Jeannine Pacioni

Aug. 30 — Arthur Bright Jr., 71, was Negative impact may occur from the use of sentenced today by Judge Andrew Liu for a fertilizers, even if organic, or any pesticides, cannabis cultivation operation discovered at as well as having trash and generators close his Carmel Valley Road home in June 2018. to the waterway. Bright had not enrolled his Bright received a three-year probation sen- cultivation operation with the water quality tence and was ordered to serve 90 days jail. board. The illegal cultivation was discovered by Permits are also required if someone in- the Department of Fish and Wildlife via air. tends to divert or obstruct the natural flow A search warrant was executed on the prop- of water or alter any stream bed. Such activ- erty and three separate grows were located. ity requires a Lake or Streambed Alteration Bright claimed that he was growing medical Agreement available through the Department marijuana for himself but the amount, over of Fish and Wildlife. Bright had not obtained 500 plants, far exceeded the amount allowed. such permission. Additionally, the grow operations were draw- Even without environmental violations, ing water from a stream via gas generator. anyone wishing to grow cannabis must make The streams in this area flow into the Arroyo sure they understand all of the local and state Seco, which in turn feeds the Salinas River. requirements. Monterey County requires The Salinas River is designated critical habi- those growing over six plants, even if ap- tat for steelhead. Cannabis plants can require proved by a physician, to register with the six gallons of water per plant per day and the county. growing season usually coincides with low Sept. 9 — After a three-day jury trial, Eu- water season, thus further taxing this limited sebio Andrade, 29, was found guilty of carry- FOLLOW OUR PROGRESS resource. ing a loaded firearm in his car. Judge Thomas Commercial cannabis cultivation is highly Wills presided. regulated, and this includes obtaining permis- On November 8, 2018, while working sion from the Central Coast Regional Water at a local manufacturing company, Andrade Quality Board to ensure that the operation and a co-worker exchanged unpleasant words Visit the Monterey Peninsula Water will not negatively impact the waters of the Supply Project website at state, including ground and surface water. See GAVEL page 22A www.watersupplyproject.org to read the latest quarterly progress report, Clark’s Carmel Stone sign up for updates and find out more information about the project. (831) 385-4000 100 Airport Drive, King City Delivery Available VISIT US ONLINE AT WATERSUPPLYPROJECT.ORG clarkscarmelstone.com [email protected] November 1, 2019 The Carmel Pine Cone 5A You are cordially invited to attend an educational seminar, hosted by Battery over cat with flashlight David T. Morwood, M.D., F.A.C.S., named one of America’s Top Plastic Surgeons©

By MARY SCHLEY her left eye, and requested an ambulance to come further evaluate her injuries, accord- Th e Truth About Plastic Surgery POLICE ARRESTED a San Car- ing to Powell. After the crew examined her, “Natural Neck Lift ” los Street man for assault with a deadly she refused any additional medical care. weapon Friday night after he allegedly hit “Smithback’s version of the story was In an informal atmosphere, Dr. Morwood will discuss his personal, a woman with a metal flashlight during a slightly different,” Powell continued, add- innovative approach to a more revitalized appearance of the neck. fight over his letting her cat out, according ing that the two were fighting because he Learn about the system of analysis Dr. Morwood employs looking at your to Carmel Police Cmdr. Luke Powell. let her cat outside. The man told officers At around 8:45 p.m. Oct. 25, officers that when they were yelling at each other, anatomy, health, and goals to develop a custom-designed approach, went to the home in the 24000 block of she got really close to him and “put hands” resulting in a natural appearance and improved function. San Carlos Street at the north end of town on him. “Experience old world customer service combined with to investigate a reported assault, arriving to Smithback stated he was not going to find 53-year-old Graham Smithback stand- let the victim attack him, “so he ‘bopped’ state-of-the-art surgical technology.” ing in the street in front of the house. The her with the flashlight in order to get her to alleged victim was inside. stop,” Powell said. The woman, whose identity was not Police arrested Smithback and took released, told officers that during an argu- him to Monterey County Jail on a felony ment, he hit her “several times about the charge of assault with a deadly weapon. head and shoulders with a metal flashlight,” He has since been released. According to Powell said. She got away and dialed 911. Monterey County Superior Court records, Police observed she had a bump on the Smithbank also had a felony case in 1994 back of her head and a purple welt under and a misdemeanor case in 2011. Actual patient before After Probationer jailed on warrants Friday, November 15, 2019 • noon - 1:30pm 665 Munras Ave., Suite 220, Monterey after yelling at restaurant worker Call to RSVP: (831) 646-8661 or email [email protected] A MAN who got angry and “created Sacramento County for committing fraud a scene” because employees at a down- to obtain aid. They also learned he was on town restaurant didn’t know the Monte- probation and is not allowed to drink. Space is limited to 18 people. rey-Salinas Transit schedule was arrested “While taking him into custody, officers Hors d’oeuvres & refreshing beverages will be served. Oct. 17 for probation violation and three searched his backpack and located a bot- Attendees receive a complimentary $125 consultation using outstanding warrants after one of the work- tle of vodka,” Powell said. “Officers could Vectra 3D Imaging System to help better visualize procedures. ers called Carmel P.D., according to Cmdr. smell a strong odor of alcohol coming from Luke Powell. his person, and when asked about the vod- Dr Morwood has over 20 years experience in plastic surgery and Gregory Miller, a 55-year-old Carm- ka, Miller stated he had consumed 8 ounc- is the host of the TV program, The Doctor is In. He is certifi ed by the American Board of Plastic Surgery and a member of the American el Valley resident, wasn’t a customer. He es of alcohol, a violation of his probation.” Society for Aesthetic Plastic Surgery. walked up to the hostess and asked for Their trip to Monterey County Jail took help. Angered by not getting the informa- an unexpected detour to Community Hos- tion he wanted, he left when police were pital of the Monterey Peninsula when he called. Shortly before 6:30 p.m., officers complained of back pain. found him walking nearby and questioned After a physician there conducted a “jail him, Powell said. They learned he had check” and concluded he was fine, Miller three outstanding warrants — two misde- was booked into county jail on the warrants meanors out of Monterey County for DUI and violation of probation. He remained in and public intoxication, and a felony out of custody Thursday. 6A The Carmel Pine Cone November 1, 2019 County commission OKs hot springs makeover despite wildfire warnings

By CHRIS COUNTS center, a culinary training center, an outdoor amphitheater responding to emergencies. and much more. “Just because a site might be in a high fire severity WHILE SOME contend that a plan to build a 103- Because the resort in located in a box canyon with zone, it does not mean that you can’t build there,” Huff room hotel and 77 timeshare units at Paraiso Hot Springs dense and dry vegetation, much of the testimony at this told the planning commission. “It means you have to do will create a wildfire hazard, the Monterey County Plan- week’s hearing focused on its ability to protect workers, additional things to build there.” ning Commission voted unanimously Oct. 30 to approve guests and structures from a fire. The fire protection plan also includes hydrants, three it. Consultant Michael Huff defended the project’s fire onsite wells and storage tanks, hoses, alarms, a fire pump If all goes according to the plan, the resort will include protection plan, which includes having a fire engine on- and extinguishers — as well as widening an existing road a visitor center, restaurants, a spa, a fitness and wellness site, along with a safety coordinator and staff trained in to 20 feet, doing extensive brush clearance, and relying on firefighters from Soledad, who could reach the resort in a little more than 15 minutes. When asked by planning commissioner Martha Diehl asked if public safety electricity shutoffs — suddenly a

126 Clocktower Place #103 Carmel, CA 93923 (831) 625-9922 “Featuring notable people, places, foods, wine, destinations, styles and events of RENDERING/HILL GLAZIER ARCHITECTS Carmel and the Monterey Peninsula, we are a local company that publishes This rendering shows what Paraiso Hot Springs will look like once Carmel Magazine, The Guide to Carmel an ambitious makeover, which includes building a 103-room hotel, and the Monterey Jazz Festival Program”. is completed.

“Best Bank EVER!! After more than a very hot topic in California — would hinder the resort’s decade of doing business with Charles ability to contend with a fire, Huff said it wouldn’t because and Company, I can honestly say that there will be a backup power supply. L to R: Charles T. Chrietzberg Jr., President/CEO MCB; there is no better bank than Monterey County Bank. We are here today because Second road needed? Clarissa Rowe, VP Community Relations Officer; of Monterey County Bank! But David Fulcher of Cal Fire warned that the resort Kelli Uldall and Steve Snider, Carmel Magazine; only has one way in and out, and needs a second route for Sarah Gaebelein, VP MCB; Steve Snider and Kelli Uldall, people to flee a fire. He suggested that the builder should Stephanie Chrietzberg, SVP MCB Carmel Magazine be required to create such a road or explain why he doesn’t need one. “Until the developer puts in a secondary ingress and Call Monterey County Bank Today! (831) 649-4600 egress, I can’t support this,” Fulcher said. “And if there’s not a factual basis for not putting it in, the developer has Member F.D.I.C. • Equal Housing Lender to give us a reason.” Two representatives of Land Watch Monterey County spoke out against the project, including executive director Mike DeLapa, who warned the fire risk is going to get much worse in the coming years. He urged the planning Monterey Bay 21 Upper Ragsdale Dr, Ste. 200 commission to downsize the project to better “protect visitors and workers.” Ryan Ranch Monterey “Things are getting hotter and drier,” DeLapa said. “It’s Eye Center getting more difficult to support safe building in rural areas. Climate change means more fires.” Also speaking out at the hearing were members of the of the Alliance of Monterey Area Preservationists, who argued the builder should pay a big price for illegally

See PARAISO page 20A

CARMEL PUBLIC LIBRARY Community Night with the Library Dr. Quinn Kennedy PhD Cognitive Reserve: TASTE, TOUCH, HEARING, SMELL AND… Maintaining Cognitive Function into Late Adulthood WE PROTECT YOUR SIGHT! Wed, Nov 6, 7pm FULL MEDICAL, SURGICAL, AND OPTOMETRIC EYE CARE Carpenter Hall, Sunset Center PREMIUM LENS IMPLANTS • ROUTINE EYE EXAMS • GLAUCOMA EVALUATIONS FREE – donations always appreciated. CUSTOM CONTACT LENS FITTINGS • DIABETIC EYE CARE Proceeds benefit Carmel Public Library NEW PATIENTS WELCOME LELAND H. ROSENBLUM, MD ROGER C. HUSTED, MD ANNA J. SHI, MD KASEY N. NAKAJIMA, OD 831.624.2811 — RYAN RANCH OPTICAL — www.carmelpubliclibraryfoundation.org EYEWEAR FOR EVERY LIFESTYLE, AGE & BUDGET. This ad sponsored by Rebecca Wolf Arnold, Carmel Realty Company and Carmel Public Library Foundation Board Member montereybayeyecenter.com | 831.372.1500 831.241.2600 • www.SellingCoastalCalifornia.com DRE#01706104 November 1, 2019 The Carmel Pine Cone 7A New urgent care clinics will include one at Carmel Rancho in 2020

By KELLY NIX emergency department every year for conditions that can cused.” easily be treated in a doctor’s office or an urgent care clin- The urgent care clinics, which the company calls TO GIVE people without regular doctors an op- ic,” Peck told The Pine Cone. “But there aren’t enough “MoGo” are the first of their kind for Montage. Though tion besides going to its emergency room at Communi- doctors available in our community and patients at local the company owns a small stake in Monterey Bay Urgent ty Hospital of the Monterey Peninsula, Montage Health urgent care centers frequently experience very long waits.” Care near Fisherman’s Wharf, the clinic is closing at the announced this week it’s opening three new urgent care end of December. centers, including one in Carmel Rancho in 2020. ‘Asked us to solve problems’ The three new centers will accept “most insurance” Montage Health, community hospital’s parent com- The clinics will allow patients to make online reserva- plans, and there will be flat-fee pricing for those who ar- pany, will open its first urgent care facility at the site of tions but will also take in walk-ins without appointments. en’t covered. Monterey’s old rollerskating rink in mid-December, with a Lab work and X-rays will be done on site and a “clinical “While we have not yet set the actual charge for a similar clinic in Marina in early 2020 and another in mid- concierge” will help patients during their visit, Montage MoGo visit, it will be a small fraction of what it costs to 2020 on Carmel Rancho Boulevard, the former location of said. The clinics will be open from 8 a.m. to 8 p.m., seven have the same condition treated in the emergency depart- Do Re Mi Music, which closed last summer. days per week, 365 days per year. People who need urgent ment, and it will be competitive with other area urgent care Montage Health vice president Cynthia Peck told The care overnight will still have to go to the emergency room. centers,” Peck said. Pine Cone that the centers — which Montage said would Peck said that the patients Montage surveyed cited long Montage will publish the fees on its website for patients allow most patients to get in and out within 30 minutes — wait times, operating hours and other concerns as things to find out “in advance what their cost will be, no matter are needed because of the extraordinary number of people they’d like to see changed. what they need during their visit,” Peck said. The fee will who visit CHOMP’s emergency room. “They asked us to solve those problems,” Peck said, “so include lab tests, X-rays, things like crutches and splints, “Today, approximately 20,000 people come to our we have re-engineered the urgent-care experience from the and medications for most conditions. ground up, making it smarter, faster, and more patient-fo- Braxton Stuntz Scholarship announced

By MARY SCHLEY

COMMUNITY HOSPITAL is launching a new scholarship in memory of Carmel resident Braxton Stuntz, the debra C Stevenson School grad who died in January while showing Garrapata Beach to some college friends, according to his mom, nurse Ruth Baltes. “CHOMP just announced the Braxton Stuntz Memorial Scholarship tonight with rounds of applause and tears at their staff meeting at Embassy Suites,” she said last Thursday night. “We are so overwhelmed and honored.” Baltes’ husband, Dr. Mike Stutz, Come visit our is a CHOMP surgeon who often brought their son to work, and Braxton was planning to become a doctor. Dr. Matt Fritsch, an anesthesiologist at Community Hospital, said the medical executive committee and top administrators decided to add the scholarship. CHOMP Backroom already offers scholarships ranging from $100 to $2,000 to students who have a parent or guardian on the medical staff. After speaking with Braxton’s parents, Fritsch said, they decided that starting next year, one of the students will also be named a Braxton Stuntz Memorial Scholar. While the criteria haven’t been ﬁnalized, he said, they Super Sale “are most likely very heavily weighted to volunteerism, citizenship and selﬂess giving of one’s time, rather than gifts of money or other goods.” Braxton was devoted to helping people, including assisting his father on medical th missions at a children’s hospital in Cambodia and, without Now thru November 8 his parents’ knowledge, buying food and supplies to donate to the homeless at Christmastime. “Also, academic performance is considered very mini- mally compared to acts of caring for other people,” Fritsch said. “The more direct human-to-human contact to learn what can most help another person is what is valued most highly here.” Fritsch said he plans to donate money in Braxton’s honor and encouraged others to do the same. 60%-80% OFF Selected

Join Us November 7th • 5:30–7:00pm Richard Grand sweaters for our NO-TOX & BUBBLES Piazza Sempione pants PARTY Bogner, Armani, Let’s Get Ready for the Holidays! Akris Punto Jackets The festive event will feature a discussion on non-toxic skin treatment by homeopathic doctor Dr. Rozlynn Trotter, HD, as well as Prosecco, light hors d’oeuvres and makeup applications by Nichole.

5:30 to 6:00 Make-up tips and tricks by Nichole 6:00 to 6:30 Dr.Trotter's presentation 6:30 to 7:00 Q & A and booking appointments SPACE LIMITED TO 20 PEOPLE The Crossroads Carmel (Next To The Rio Grill) EVENT IS COMPLIMENTARY

RSVP TO NICHOLE 129 Crossroads Blvd., Carmel, CA 93923 [email protected] 831-624-9400 (831) 625-4410

1 1 8 C R O S S R O A D S B L V D, FINAL SALE C A R M E L 8A The Carmel Pine Cone November 1, 2019 Police station redo, development CALIFORNIA REQUIRES MANDATORY on Dolores Street and vacation SEXUAL HARASSMENT TRAINING FOR ALL EMPLOYEES BY JANUARY 1, 2020 rentals on council agendas By MARY SCHLEY emergency operations center and other uses. Since then, Kasavan Architects re- WHEN THE city council holds back- drew the plans, which now call for minor to-back meetings at 4:30 p.m. Monday and exterior changes and more extensive work Tuesday, Nov. 4-5, it will get an update inside. City staff reviewed them and re- on the remodel of the police station and quested changes, and the drawings are hear proposed changes to the zoning code now complete, according to public works and residential design guidelines, as well director Bob Harary’s report. He discour- Hudson Martin PC is offering this training to as discuss whether to let a developer put ages the council from making any changes, a garage ramp across a sidewalk, whether since that could be expensive and lead to local employers and their employees to approve an ordinance controlling short- more delays, and says changes should defi- term rentals downtown, and whether to nitely not be made once work is underway, allow a Dolores skincare store to remain since doing so would be even more costly. Dates and Time open, among several other items of public business. Dolores project After a closed session to discuss a few A developer’s proposal to build under- Monday, October 28 at 12 noon legal issues, including existing lawsuits ground parking, condos and apartments and the ongoing question of who might on what is now the parking lot next to the Tuesday, November 5 at 6pm move into the aging Flanders Mansion and Seventh & Dolores Steakhouse, and to turn fix it up in exchange for years of free rent, the small building there into a market, in- Friday, November 15 at 8am the council will open the public meeting, cludes a lift that would provide access to set for 4:30 p.m., to talk about amendments the garage without cutting a driveway into to the residential zoning code and design the sidewalk and having a steep ramp. But Supervisors: 2 hours at $50, guidelines, including providing incentives since that would mean installing the lift, Nonsupervisory Employees: 1 hour at $30 for people to retain their existing houses which would have gates on each side that rather than tearing them down and building would rise when a car enters or exits, on new ones, no longer counting small sheds a public sidewalk, the council needs to Compliance certificates will be issued upon completion when calculating the total floor area of OK it. The plans also call for balconies Call 831.375.3151 buildings on a lot, limiting wood-burning that would extend into the right of way, fireplaces to one per house, allowing gar- too, even though they would be far above bage enclosures in side or front setbacks, the ground. The planning commission and authorizing “cottage food operations” supported the design concept and the en- in the residential districts, since state law croachments, but planning director Marc Hudson Martin PC requires it, among many other changes. Wiener is recommending denial. Also on Monday, the council will receive a report on Sunset Center and consid-

ADVERTISEMENT Police station update In March 2019, the city council voted er a Mills Act Contract, which provides fi- Corporate & LLC Formations | Business Transactions | Intellectual Property | Leases to vastly scale back a planned remodel of nancial incentives for historic preservation Contracts Probate | Employment Law | Estate Planning | Trust Administration the police station at Junipero and Fourth of a home by lowering taxes on the prop- Business Mergers & Acquisitions | Real Estate Transactions | State & Federal Litigation that would have expanded the 52-year-old erty. Senior planner Marnie Waffle is rec- building on two sides and provided more &DOOH3ULQFLSDO0RQWHUH\__KXGVRQPDUWLQFRP space for officers, evidence, dispatch, the See AGENDA page 22A

First Course Butternut Squash & Tomato Soup River Inn House Salad Entree Herb Roasted Turkey Chateaubriand Herb & Citrus Fish Butternut Squash Ravioli Braised Lamb Shank Sides ?QTL5][PZWWU;\]ЅVO Garlic Mashed Potatoes Sweet Potatoes with Marshmallow :WI[\ML>MOM\IJTM[ Green Bean Casserole Broccoli Cheddar Bake Mac & Cheese Fresh Bread w/ Honey Butter Dessert )[[WZ\ML8QM[8]LLQVO November 1, 2019 The Carmel Pine Cone 9A Privacy and Tranquility in Aguajito Oaks Entries sought for selﬁe mural contest

By MARY SCHLEY calling it “brilliant,” and “very fun.” Donna Jett said it was “the best idea I’ve heard all THE CITY might attract more visitors year,” and Nancy Whitman commented, “It (and their money) if they have an eye-catch- should have been done a long time ago.” ing mural to pose in front of for selfies that Community activities director Ash- they would then share with friends and lee Wright told commissioners the mural strangers through social media, according would be temporary so that perhaps more to Amy Herzog, executive director of Vis- than one artist in the city could have a it Carmel, the taxpayer-funded nonprofit crack at it, and so that no one will be stuck tasked with marketing the town to travel- with its maintenance and upkeep over the ers. A contest starting Friday and running long term. She also said the planning de- through the end of the year will give local partment and the commission would weigh artists the opportunity to design and hang in again before anything is hung. a temporary mural on a large blank wall on the west side of Mission south of Sixth for The rules just that purpose. This week, Herzog announced the con- Herzog brought the concept to the city test and its rules. “Visit Carmel is seeking a few months ago, mentioning it toward a local artist to create an eye-catching mu- the end of a lengthy presentation about ral that is modern, bold, fresh, highly pho- Visit Carmel to the community activities tographable and unmistakably ‘Carmel-by- commission. She said the idea dawned on the-Sea,’” she said. Only artists who create her when she and city administrator Chip or sell their work in the city and/or who are Rerig, who represents the city on the or- members of the Carmel Art Association ganization’s board of directors, were walk- can apply, and the winner will get a $500 ing around town, and she noticed people prize and up to $1,000 in reimbursement stopping in the middle of the crosswalk at for materials. The piece should “commu- 3 beds, 3 baths ■ $1,595,000 ■ www.158Littlefi eld.com Ocean and Junipero to pose for photos with nicate the concepts of Visit, Live and Love the brown wood Carmel-by-the-Sea sign in Carmel-by-the-Sea,” and would cover a the median. wall measuring 40 feet wide and a bit over Single level home, set far back from street 11 feet high. with huge interior patio set on a large lot. Enthusiastic response In January 2020, a committee of Vis- “That’s not necessarily safe and also it Carmel board members will review the not necessarily representative,” she said entries and select the top three, which will at the June 11 meeting. “If that’s what then be subjected to a popularity contest they’re posting on social media, is there a through social media. The committee will way where we can create something that’s still make the final selection, however. No a little more bold and modern and graphic one knows how long the piece will hang Judie Profeta and exciting that shows us as the arts des- on the wall. tination we are? Then we can rely on other The rules explain that the city has final 831.601.3207 people here to tell our story for us.” say and might request changes to the de- Managing Director | Broker Associate The board discussed the concept and sign, that the contest might not even yield where a mural could go, and restaurateur a winner at all, and that “the artist waives Judie@Th eProfetaTeam.com DRE#00703550 Rich Pepe, also on the board, approached right to ownership of the mural, and it can property owner Phil Coniglio about using be removed or painted over at any time the wall at Mission and Sixth, she said, and at the discretion of the sponsor, building received an enthusiastic response. owner, or the City of Carmel.” For more Commissioners were similarly enthu- details and to enter, visit CarmelCalifornia. siastic and discussed the concept briefly, com/MuralContest.

MEASURE J: FEASIBILITY OF PURSUING PUBLIC OWNERSHIP OF CAL-AM'S MONTEREY PENINSULA WATER SYSTEM

Monterey’s Premier Independent Mercedes Service with over 100 Combined Years of Experience t'BDUPSZ5SBJOFE5FDIOJDJBOT t'SFF4IVUUMF4FSWJDF"WBJMBCMF tNPT NJMFOBUJPOXJEFXBSSBOUZ t'SFFSPBETJEFBTTJTUBODF 684 Ponderosa Ave., Seaside 831-394-6600 www.mercedes-werks.com

A Monterey County Green Certiﬁed Business 10A The Carmel Pine Cone November 1, 2019 PACIFIC GROVE TO SPEND BIG BUCKS TO MAKE ICE PLANT PRETTY AGAIN

By KELLY NIX While Garfield said efforts to plant more vegetation at nance and volunteer weed-pulling efforts are helping the Perkins Park have helped, they have brought more weeding ice plant, it will “take some time to overcome the years of IT MAY be the “face of Pacific Grove,” but it needs a challenges. The hope is that the plan will show how to get neglect compounded by drought and gophers.” facelift that won’t come cheap. “this iconic face of Pacific Grove to look the way it’s sup- “For the Perkins Park Restoration plan, we acknowl- On Wednesday, the P.G. City Council voted 7-0 to pay posed to,” she said. edge that we will not be redesigning this park, but will be a consultant more than $70,000 to develop a plan that will The consultant the city hired, Santa Cruz-based Eco- creating a vegetation management plan which maintains ensure that the so-called “magic carpet” that blooms along logical Concerns, Inc., has proposed focusing on vegeta- an eye for the park cohesion and the user experience,” ac- the city’s picturesque waterfront every year will be as stun- tion management from Lovers Point about three-quarters cording to Ecological Concerns, Inc.’s proposal to the city. ning as it used to be. It is unknown how much it will cost of a mile to Esplanade Street. The city will pay the com- The company said it would work in coordination with to implement the plant. pany $71,815, plus a 15 percent contingency for the work. the consultant for the city’s shoreline management plan The vibrant drosanthemum floribundum ice plant that — a separate proposal that “will assess ways to provide blankets Perkins Park has long dazzled residents and vis- Overcoming neglect continuous recreation trail access and protect vital, city- itors, but the purple blooms have become more sparse in The Perkins Park plan will “include detailed conditions owned infrastructure along the shoreline well into the fu- recent years due to drought, invasive plants, rodents and assessments, recommended maintenance activities for the ture while protecting and enhancing the coast’s natural and the reduction in the use of traditional herbicides, according next five years, plans and specifications for implementa- cultural resources.” to the city. tion, and yearly cost estimates for recommended mainte- In July 2017, the California Coastal Commission ap- “I have been pulling weeds in Perkins Park for 10 years nance activities,” a report to the city council said. proved the repair of a failed portion of seawall on con- with not a whole lot of success,” councilwoman Cynthia “I wish it didn’t cost so much, but that’s what it is,” Gar- dition that the city develop a shoreline plan. The council Garfield said of her work to protect the perennial plant, field said of the city’s contract with the consultant. Wednesday received a brief update on that effort, which is which is native to South Africa. Resident Lisa Ciani said that while regular mainte- on track to be completed before July 20, 2020.

Low premium plans starting at $32

Telehealth — NEW

Fitness beneﬁt

Transportation

Chiropractic and acupuncture

in collaboration with November 1, 2019 The Carmel Pine Cone 11A Big Sur road still needs work, but U.S. taxpayers help with $1.6 million

By CHRIS COUNTS of distant neighborhoods named after their geographical entire road is estimated to exceed $19 million. features, such as Green Ridge, Long Ridge and Upper The damage came during a wet winter that followed THE UPPER portion of Palo Colorado Road is still Rocky Creek. the 2016 Soberanes Fire, which destroyed 57 homes — closed after suffering major storm damage in 2017 — and So far, according to Monterey County spokesperson mostly in the Palo Colorado area — and burned more than it’s uncertain when it will be fixed — but Monterey Coun- Maia Carroll, the county has spent more than $6 million to ty just received a $1.6 million taxpayer grant from the Fed- repair the parts of the road. The total cost of repairing the See ROAD page 21A eral Emergency Management Agency last week that will help pay for it. Congressman Jimmy Panetta said he supports spending information money on making Monterey County’s roads more stable call for and secure. LUXURY “I will continue to engage with FEMA officials to ensure not only that our communities have the financing they GARAGE need for storm repairs, but that we make federal invest- CONDOS ments in resilient infrastructure so that they are protected against future storms,” he said.

Congressman praises workers Panetta also complimented local workers who helped ﬁx the lower portion of the same road, which was damaged from the same storms. “When this road was completely washed out, our local crews got to work,” the congressman said. “The repairs made last year got the road back into shape for the many people who rely on it to safely travel to work and school.” The 8-mile route, which travels southeast from High- way 1 to Bottchers Gap, provides access to an assortment JOSH JONES BRE# 01352818 831-647-2106 RYAN CLARK BRE# 02012077 831-755-1635 DENNIS CHAMBERS BRE# 00475577 408-605-6760

PHOTO/CHRIS COUNTS

Workers repair Palo Colorado Road, which has been in bad shape since the wet winter that followed the 2016 Soberanes Fire. A new federal grant will help pay for the effort.

’Tis the Season to Book a Highlands Holiday

No venue captures the magic and wonder of the holiday season quite like Hyatt Carmel Highlands. Book now though November 20th and enjoy: • 50% off rental spaces • Special guest room rates • Complimentary 1 hour bubble bar • Complimentary gourmet fruit and cheese display* Contact our Special Events Coordinator today at (831) 620-1234 120 Highlands Dr, Carmel-By-The-Sea, CA 93923

*For groups of 20 or more. 12A The Carmel Pine Cone November 1, 2019

rently flows to the ocean (global warming is already pro- regarding water, (and other issues), knows very well how LETTERS ducing more intense winter storms) means it will also be their so-called journalists like to present their own alterna- From page 24A able to store ample water to improve groundwater basins tive ‘facts’ to uninformed readers. The simple truth is, the and protect us from future drought. 28 elected officials in question wrote and signed their own If we eventually need a desal plant, the PWM expan- letter to the California Coastal Commission, not one that not become an enclave just for billionaires. That’s part of sion gives us plenty of time to plan a more environmen- was penned by public advocacy group Public Water Now. the reason I support the Pure Water Monterey Expansion. tally responsible, nonprofit project that does not endanger But, as usual, The Pine Cone just invents their own version PWM water will cost only 25 to 30 percent as much per Marina’s groundwater and can serve the entire region more of reality and expects the gullible reader to adopt it as is. acre-foot as Cal Am’s desal. affordably. Apparently, The Pine Cone brain trust regards their readers With many friends and family who are business peo- Marli Melton, Carmel Valley as essentially a bunch of idiots incapable of independent ple, I’m a fan of small business, but not biased against thought. But does anyone think they will offer a retraction government. The Monterey Peninsula Water Management — don’t hold your breath on that one. District’s report contains data and very careful reasoning, ‘Don’t hold your breath’ Dear Editor, Larry Parrish, Carmel Valley concluding that the PWM expansion can provide enough Once again the Pine Cone misstates the facts in their water for residential, business, housing, and development piece entitled “Anti-Cal Am group asks state board to uses and growth, including new businesses, new residents, Publishing junk block desal plant.” The Pine Cone just loves to belittle Dear Editor, affordable housing, renovations and upgrades. The PWM what they derogatorily characterize as “activists” and of I wasn’t going to respond to the letter to the editor from expansion’s use of some of the winter stormwater that cur- course any astute reader of the typical Pine Cone article James King in your Oct. 18 edition, but it has been bother- ing me ever since I read it for two reasons. One, the letter in itself is what is wrong with society today. Instead of addressing the problem: lack of effort to address the in- vasion of robocalls and the problem of the inaccessibility of a public servant from a constituent, James King instead takes the low road and uses a community’s newspaper to malign a public servant. Two, who is he to malign Jimmy Panetta, who paid his way through college and law school, who served this community as a gang prosecutor, who volunteered to serve in our military in combat operations in Afghanistan and decorated for his actions in combat, who volunteered with me on several nonprofit boards in our community, and is now continuing to serve me and my community? Thank you, Jimmy, for stepping up to serve once again as our congressman. I’m embarrassed that people continue to stoop so low as to belittle our leaders and military veterans Saturday, September 28, 2019 from 11:00 AM - 1:00 PM in public and ashamed that The Carmel Pine Cone would stoop even lower and publish this kind of junk. We will be selling Tri-Tip Sandwich Meals and Hot Dog Meals DJ Skelton, with all proceeds going to the Alzheimer's Association! Monterey Rock n' Roll Entertainment provided by Bag O' Trix! Continues next page Car Show - from 11:00 AM - 2:00 PM Live Music - from 11:00 AM - 1:00 PM Chili Cook Off - Taste and Vote from 12:00 PM - 12:30 PM Please call for more information 877-821-6818

Lic# 019200513 200 Glenwood Cir | Monterey, CA 93940 | PacificaParkLane.com FURNISHINGS & ACCESSORIES WITH DISTINCTION In your 20s, it was work hard, WANTED Play hard. Photos or inquiries to: [email protected] 831-574-8153 www.consignmentbythesea.com 230 & 232 Crossroads Boulevard • Carmel

TRUNK SHOW monday november 4TH

hand-made tailored suits, sport coats, & trousers êŰŤūļĲƞūūĕĳČŤƆĕūĒ Here, Everything Can Be Easy. president Robert Denton

Every age has its joys and challenges, whether you’re 20 or 40. But those over 65 can relax at Carmel Valley Manor, a life care community. It has an ideal climate, ﬁne dining and fun activities, with three levels of care, should you need them. For information, call Angie Machado, (800) 544-5546 or visit cvmanor.com Celebrating 56 Years

CARMEL PLAZA • OCEAN AVE • 831-625-8106 8545 Carmel Valley Road, Carmel, California 93923 SHOP AT KHAKISOFCARMEL.COM License #270700110 COA #082 November 1, 2019 The Carmel Pine Cone 13A

From previous page level, so everybody has a chance to choose whatever they want. Pacific Grove You have even more license than other editors to print ‘Something productive for a change’ whatever you consider appropriate because the paper is Expert Beauty & Hair Dear Editor, free. So there is no argument that she may request anything The Trump Administration has negotiated a treaty to re- because she pays for it. place the outdated NAFTA; it is called the USMCA or U.S, And yes, we already have enough one-sided opinions Mexico, Canada trade agreement. Economists predict that and there is a chorus of liberal views available, so simply this agreement would add at least .5 percent to our gross for our sanity, it is necessary to be exposed to opposing domestic product. The USMCA has broad support in the views. business and labor communities but must be ratified by Jerry Juskie, first the House and then the Senate. President Trump has Monterey repeatedly asked the House to act on this treaty. Mexico has already ratified the USMCA, but the House has not seen fit to deal with the issue. I called Congressman Jimmy Panetta’s D.C. office to ® see why the House has not acted. In reply, I got a letter Gr8ness Building from Panetta which stated, in part, “to date the Adminis- You Matter Success Roadmaps™ tration has not yet delivered the agreement to Congress for consideration and debate.” This statement is an outright ASK ROSALINDA lie. I called D.C. again and told Panetta’s office I wanted Q: Rosalinda, I don’t say No when asked to help. a retraction of their statement or I would go to the media; Sometimes it is too much for me to add one more thing I got a quick phone call back from a Mark Denham who to my Calendar. How do I be a good person and say No said that Congress was negotiating for some changes in the sometimes to requests for help? Thank you, Kimberly agreement. I pointed out to Mr. Denham that Mexico had A: Dear Kimberly, already ratified the agreement and asked how Congress You are better and smarter for yourself by asking for help could ask for a change in terms if they had not received the proposed agreement as stated in the letter. Mr. Denham’s to stop sacrificing to please others. Time is the currency response was to stonewall. of our Lives. When asked to help, respond with I would love to help, let me get back to you on if I can. Ask your- The problem is, of course, that the Democrats are so Jeanne Frank-Bergquist consumed with the impeachment issue and their hatred of self if you really want to do it, when if your answer is the president that Nancy Pelosi has no time or inclination Yes, and answer No if you don’t want to. You can never The Hair Specialist to deal with issues that would benefit the country. get Time back, once you spend it. Practice compassion, Maybe The Pine Cone can persuade Panetta and his peace and power. 207 16th Street #104 | (831) 372-6446 boss Pelosi to do something productive for a change. Take good care. Charles Hoppe, Rosalinda Carmel email questions to: [email protected] ‘Excellent and logical’ Dear Editor, Please pay no attention to the advice from the Oct. 11 letter writer Christine Hoberg. Rosalinda O’Neill Business, Partnership & Life Builder Keep writing your excellent, logical, sensible and high- Time is the currency of your Life • Let’s make it payoff better for You brow editorials. Mission & 4th Avenue SW, Suite 4, Carmel-By-The-Sea I start reading always from your editorial. 831.620.2912 • [email protected] • ceolifementor.com There are enough newspapers at a lower intellectual ©2019 Rosalinda O’Neill, Licensed Marriage & Family Therapist, Inc. Issue 103, November 2019

Chong Choi Lee’s Salon Gifts and Accessories 222 17th Street | (831) 375-6432 Outdoor Public Art Mural Contest

For more than a century, the resplendent beauty of Carmel-by-the-Sea has inspired artists of all kinds. Their work, in turn, has drawn countless visitors to the white sands of Carmel Beach and to our charming village in the forest.

To both honor our artistic heritage as well as provide a safe and accessible spot for visitors to take photos, Visit Carmel is sponsoring the creation of a new temporary outdoor public art mural. Visit Carmel is seeking a local artist to create an eye-catching mural that is modern, bold, fresh, highly photographable, and unmistakably “Carmel-by-the-Sea.” Rose Hawayek Submission period opens November 1, 2019 For details and to enter, please visit and closes December 31, 2019. CarmelCalifornia.com/MuralContest A Bella New – Skincare Open to all graphic artists who reside or own a 227 Grand Ave., Suite 2A | (415) 867-1650 gallery in Carmel-by-the-Sea (93921), and/or are a member of the Carmel Art Association. $500 cash prize will be provided to the PACIFIC GROVE CHAMBER winner, with up to $1,000 for expenses. OF COMMERCE (831) 373-3304 WWW.PACIFICGROVE.ORG 14A The Carmel Pine Cone November 1, 2019 Thousands vie for cash prizes in juried photography contest

TO COME up with 45 finalists, the 2, at 5 p.m., when the nonprofit gallery work done in early photographic processes added. judge of the Center for Photographic Art’s hosts an opening reception. like cyanotypes and gum bichromates, and The Center for Photographic Art’s gal- 2019 International Juried Exhibition, Paula “It’s a really interesting mix of photo- some interesting still lifes Tognarelli, looked at more than 2,300 sub- graphs,” executive director Ann Jastrab told and collages.” missions from as far away as Japan. The The Pine Cone. “The work comes from all Besides cash prizes for winners will be announced Saturday, Nov. over world. There’s a lot of abstract work, the best photographs, one of Art Roundup the winners will be awarded a solo exhibit at the Griffin By CHRIS COUNTS Museum of Photography in Celebrating 5 Giving Years! Boston, where Tognarelli works as its ex- lery is located inside Sunset Center at San ecutive director. Jastrab called Tognarelli Carlos and Ninth. photography.org Supporting a pioneer in digital printing. “She’s juried See ART page 21A Local Charities hundreds, if not thousands, of shows,” she

Margery Ammon will GIVINGTREE BENEFIT SHOP show people how she paints tulips and Open Thursday & Friday Noon-4 daffodils Saturday at Gallerie Amsterdam. Saturday 10-4 The artist is known for her ﬂorals. at Community Church of the Monterey Peninsula One mile east of Highway 1 on Carmel Valley Road (831) 624-3060

James Wayne Pond February 20, 1949 — August 8, 2019 Carmel-by-the-Sea, California James Pond was born in Cody, Wyoming, the sixth of eight children of Irene Felsheim Pond and Dean H. Pond, Sr. He died at the Com- munity Hospital of the Monterey Peninsula of heart and kidney problems that affl icted other family members. Will Taylor, his domestic partner of twenty-seven years, had died in November, 2018. Carol Cortright Keaton After high school and studies at St. Meinrad in Indiana, James November 1, 2004 joined the Air Force, serving in Greenland and New Zealand. He worked as a driver and transportation manager in Montana and Death is nothing at all. Wyoming before becoming a rehabilitation counsellor in Reno, It does not count. Nevada, and a Trager bodywork practitioner. With Will he lived I have only slipped away into the next room. in San Francisco and Carmel, and enjoyed a mountain cabin in Nothing has happened. Portola, California where he gardened for health and for his ex- Everything remains exactly as it was. pert cooking and gave sessions of the super-gentle Trager body- I am I, and you are you, work, performed in high altitude sunshine and pine breezes. and the old life that we lived so fondly together is untouched, unchanged. When their partnership was fi rst formed, Will and James or- Whatever we were to each other, that we are still. ganized “a gathering of friends we never met” to introduce their people to each other. Th ey traveled often to reconnect with Will’s Call me by the old familiar name. friends from youthful years in Germany, Turkey, and NYC. In re- Speak of me in the easy way which you always used. cent years James made cruise trips on the Danube, and on the Put no difference into your tone. Maine coast for lobster. When eff ects of diabetes reduced his mo- Wear no forced air of solemnity or sorrow. bility, he focused his energy on good food, for which he could always provide recommendations, and on bridge, becoming a Life Laugh as we always laughed at the little jokes that we enjoyed together. Play, smile, think of me, pray for me. Master of the American Contract Bridge League. Let my name be ever the household word that it always was. Friends were the keynote of James’s life. “Th e most sensitive Let it be spoken without an effort, without the ghost of a shadow upon it. man,” one friend recalled him, “so kind to his older friends” said another; others noted how he “was always there” for people at key Life means all that it ever meant. moments in their lives. He greatly enjoyed his fi ftieth high school It is the same as it ever was. reunion in Cody in 2017. After Will’s passing, an old Cody friend There is absolute and unbroken continuity. John Beck came to live with James in Carmel. James’s heart was What is this death but a negligible accident? in the mountain West, especially Cody and Portola, and it was warmed in the last seven years of his life by a beautiful and loving Why should I be out of mind because I am out of sight? rescue dog named Stella. Th eir ashes will be buried in Cody. I am but waiting for you, for an interval, James was preceded in death by his parents and three siblings, somewhere very near, Dean Pond, Jr., Patricia English, and Paula Chamberlain. He is just round the corner. survived by older brother Willard (Obie) Pond of Washington All is well. state, sisters Peg Pond Paul (husband George), Pamela I. Briggs, Nothing is hurt; nothing is lost. and Phyllis M. Claudson (husband Earl), of Cody, many cousins, One brief moment and all will be as it was before. nephews, and nieces, and by Will’s brother Claxton and his wife How we shall laugh at the trouble of parting when we meet again! Kim, and children Austin, Llama, and Tully. Saturday, November 16, from 3-6pm, an open house will — Henry Scott Hollond, 1909 be held for friends to remember James, at Camino Real 3SE of 12th, Carmel. RSVP optional to (831)-241-3473. November 1, 2019 The Carmel Pine Cone 15A

“While we occasionally see black-footed albatross, we SIDEWALKS ALBATROSS don’t have records of a rescued Laysan albatross,” Brook- From page 1A From page 1A houser said. “Laysan albatross are pelagic birds, which means they live their lives at sea except while nesting.” While it was under the SPCA’s care, wildlife center staff When the council last reviewed its sidewalk vending struggling and needs help getting its strength back,” he used a baby monitor to observe the bird so it wouldn’t be law in February, members discussed requiring sellers to said. “We are not sure when it might be released.” stressed since they’re afraid of humans. SPCA employees go out and set up their carts a certain number of days per The albatross also had some lesions on its feet which were able to track his progress and watch him eat without month or year. They also decided the permits should ex- the bird rescue center is treating to prevent infection. the bird hearing or seeing them. pire when the ordinance does. Wiener is recommending The bird — which has a wingspan of more than 6 feet Laysan albatross range across the northern Paciﬁc the time requirement be put off until a permanent law is — may be the ﬁrst of its kind to have been rescued by the Ocean from about the latitude of Costa Rica to the Aleu- adopted and that the issued permits remain valid until the SPCA for Monterey County. tian Islands and southern Bering Sea. extended ordinance expires a little over 13 months from now, assuming the council does what he wants. And in the meantime, Wiener said, the council should schedule a time to talk about sidewalk vending, including Carlos Olvera Chavez determining how to equitably issue permits in the future December 19,1953 — August 31, 2019 and deciding whether vendors should be required to go out and do business on the sidewalks of Carmel. On the 31stbRI$XJXVW&DUORVFRQFHGHGGHIHDWLQKLVPRQWKEDWWOHZLWK*UDGH The council meets in city hall on Monte Verde south of *OLREODVWRPD+HSDVVHGDWKRPHKLVIDYRULWHSODFHWREHVXUURXQGHGE\KLVORYLQJ Ocean at 4:30 p.m. IDPLO\ %RUQ'HFHPEHUWR'U+RUDFLR2OYHUD+XHUWDDQG&HOLD&KDYH]GH2OYHUD LQ&RORQLD&R\RDFDQ0H[LFR&LW\KHZDVEOHVVHGZLWKDQDPD]LQJIDPLO\ZKRQXUWXUHG WKHLUFKLOGUHQōVORYHRIPXVLFDUWKLVWRU\OLWHUDWXUHVFLHQFHDQGZRUOGWUDYHO+LVIDWKHU ZDVWKH8QGHU6HFUHWDU\RI+HDOWKDQG:HOIDUHIRU0H[LFR+HZDVDOVRDZULWHUDQG SRHW+HZDV&DUORVōVJUHDWHVWLQVSLUDWLRQ&DUORVFDUULHGRQKLVOHJDF\LQKLVZDUPWK JHQHURVLW\LQWHOOLJHQFHKXPRUDQGFXOWXUH ,QWKHVXPPHURILQWKHPLGVWRIWKLVEXFROLFXSEULQJLQJDŏ*ULQJDŐVKRZHGXS DQGVZHSW&DUORVLQWRDZKLUOZLQGRIFXOWXUHFODVKDQGQHZH[SHULHQFHV$IWHUHDUQLQJD EDFKHORUōVGHJUHHLQ%XVLQHVV$GPLQLVWUDWLRQbIURP/D8QLYHUVLGDG/D6DOOHLQ0H[LFR&LW\ &DUORVDQG0HOLVVDZHUHPDUULHGLQKLVSDUHQWōVKRPH&KULVWPDV(YHRI7KHQWKH\ ZHUHRIIWR(QJODQGZKHUH&DUORVGLGJUDGXDWHVWXGLHVLQ3XEOLF+HDOWK$GPLQLVWUDWLRQ DW$VWRQ8QLYHUVLW\7KH\VSHQWWKHQH[W\HDUVVDYRULQJQHZDGYHQWXUHVDQGFRQWLQXLQJWRJURZDQGOHDUQWRJHWKHUZKLOH UDLVLQJDIDPLO\$QGWKHUHZDVDOZD\VPXVLF&DUORVōVSDVVLRQIRUPXVLFSHUPHDWHGIDPLO\OLIH $IWHU\HDUVZLWKWKH&LW\RI3DFLƓF*URYH&DUORVUHWLUHGDV$GPLQLVWUDWLYH6HUYLFHV'LUHFWRU$KLJKOLJKWRIWKLVH[SHULHQFH ZDVWKHOLIHORQJIULHQGVKLSVKHIRUPHG$OWKRXJKWKH2OYHUDIDPLO\HYHQWXDOO\OHIW3DFLƓF*URYHDQGIROORZHGWKHVXQWR&DUPHO 9DOOH\&DUORVVWLOOPDGHLWEDFNWR3*WZLFHDZHHNWRPHHWIULHQGVDQGSOD\KLVIDYRULWHJROIFRXUVHb 7KHELUWKVRI&DUORVōVFKLOGUHQDQGJUDQGGDXJKWHUVZHUHWKHPRVWMR\IXOPRPHQWVRIKLVOLIH+HZDVWKHFHQWHURIWKHLU XQLYHUVH:HFDOOHGKLPWKHEDE\ZKLVSHUHU &DUORVOHDYHVEHKLQGDKHDUWEURNHQIDPLO\KLVZLIH0HOLVVD0DQNHGH2OYHUDKLVWKUHHEHORYHGFKLOGUHQ*UHWFKHQ2OYHUD 5RELQVRQ -HVVH RI3DFLƓF*URYH(EHQ2OYHUD (OL]DEHWK RI6DQ-RVHDQG3HQHORSH2OYHUDRI&DUPHO9DOOH\KLV\RXQJHU EURWKHU'U$UWXUR2OYHUD&KDYH]RI0H[LFR&LW\DQGWKHOLJKWVRIKLVOLIHKLVWKUHHJUDQGGDXJKWHUV(ORLVHDQG6DRLUVH5RELQVRQ DQG%DE\(OHQD2OYHUD&DUORVZDVSUHFHGHGLQGHDWKE\KLVSDUHQWVDQGROGHUEURWKHU'U5DXO2OYHUD&KDYH] PHOTO/KERRY BELSER 0HPRULDOFRQWULEXWLRQVLQ&DUORVōVKRQRUPD\EHPDGHWRVRPHRIKLVIDYRULWHSODFHVWKH)LQH$UWV0XVHXPVRI6DQ)UDQFLVFR Alyson de Guigne is the only one of 13 permit holders to actually OHJLRQRIKRQRUIDPVIRUJ 0RQWHUH\3HQLQVXOD&ROOHJH0XVLF'HSDUWPHQWRUWRKHOSWKHEDWWOHDJDLQVWWKLVUHOHQWOHVVGLVHDVH go out and sell on the sidewalk. The city council is set to decide WR8&6) *OLREODVWRPDUHVHDUFK what should happen to those permits when it meets next week.

ANTIQUES & Frances Camille Maysonave COLLECTIBLES 1924 Y 2019 Frances Camille Maysonave was born October 19, 1924, in Charleston, South Carolina, to Frances and Emile Passailaigue. When she was 12, she moved with her parents and brother, Emile, to Carmel to live with her Aunt Marie Gordon, who built the seventh home in Carmel, Casa del Mar Azul, which still stands on San Antonio. Fran attended Sunset School and served as the first “Queen of the Carmel Mission.” A member of one of the first graduating classes of Carmel High School (’43) she sang soprano at the Bach Music Festival and worked at Fortier’s OVER 140 DEALERS Drug Store, where she served Clark Gable and Carole Lombard. 21,000 Fran met Captain René Maysonave, serving in the 7th SQUARE Division at Fort Ord, at a dance. When he asked to see her again, she told him that he could find her at the Carmel FEET Mission, singing in the choir on Sundays. They married at the Mission in 1946. René’s Army career meant a life of travel, The Largest Antiques first to Baltimore, where they welcomed their firstborn, and Collectibles Mall Camille (1950), then to Munich, Germany, where Nanette (1951) was born. Postings followed at Fort Lee and Quantico, on the Central Coast Virginia, Ft. Leavenworth, Kansas, and Falls Church, Virginia. René was assigned to Tehran, Iran, in 1960, where Fran began her decades-long volunteer work for the American “ANTIQUE MALL Red Cross. In 1962, they were transferred to Fort Mason in San Francisco, where Desirée (DeeDee) was born in 1965. Following René’s Korean tour, he was OF THE YEAR” reassigned to the Joint Chiefs of Staff at the Pentagon. The family joined him in Falls Church, Virginia. Professional Antique In 1970, with their older daughters in college and the completion of René’s tour of duty in Vietnam, Mall Magazine René retired and they settled in Pebble Beach. René and Fran joined The Retired Officers Association and The Monterey Peninsula Yacht Club, where Fran was active with the Spinnakers. She also enjoyed swimming, painting watercolors, reading, knitting and travels to Ireland, Spain, Canada, and Hawaii. Camille and Nan eventually settled in the Monterey Peninsula. Nan, working in marketing at The Monterey County Herald, married Nick Chiulos. Camille, an Army nurse, married Heinz Brinks and had three daughters, Aimée, Kate and Elisabeth. In 1987, René passed away after a brief illness. Desiree married Nick Lerissa in 1994 and had three daughters, Belle, Ella and Renée. 471 WAVE STREET In 2007, after Nanette was diagnosed with cancer, Fran was a fixture at her bedside, a great source of comfort to her daughter, who passed away quickly. Fran’s brother, Emile Passailaigue, died MONTEREY the following year. She moved into Forest Hill Manor, Pacific Grove, where she was loved and well- (831) 655-0264 cared for, and family and friends visited often. Fran is survived by Camille and Desirée, their daughters, and eight great-grandchildren, Camille, 30 Tristan, Jude, Alex, Colette, Luke, Nathan and Nanette. canneryrowantiquemall.com Services for Frances Maysonave are scheduled for Monday, November 4, at 9:30 a.m., at San Carlos Cathedral (500 Church St., Monterey), followed by a reception in the Parish Hall. 16A The Carmel Pine Cone November 1, 2019

The goats and tortoises, meanwhile, have found homes feed and all the things from now on,” she asked. “This is a HACIENDA in the Jamesburg area. really big change in a way of life here.” From page 1A Lifelong resident Doug Steiny, who as a realtor is selling the property — which is in escrow — described the Picking up the slack business as “a gathering spot since the Wolters opened it.” Thankfully, another local business is picking up at least Carmel High School together in 1974 — will soon be liv- “People go by to pick up hay and stay for an hour,” he some of the slack. “We will be carrying some of their ing in a house they own in the high desert north of Bend. explained. “It’s such an integral part of our community.” products, including wild bird seed, chicken feed, and treats They previously lived in the area for four years and love While the place has a rich history, Steiny said the Olows and supplements for horses,” said Sarah Adams, the own- that part of the country. “We feel like we’re going back made it extra special. er of the Raw Connection, which is located less than four home,” he said. “They’re just really nice people,” he said. “They’re miles away in the Carmel Rancho shopping center. completely selﬂess — they basically would do anything On the internet, numerous comments about the closing Emu and others ﬁnd new homes for anybody.” include the concern that another wine tasting room will set So what’s going to happen to the many animals that Another local, Iris McGilloway, said she will miss Ha- up shop on the site, but so far, there’s no evidence of such once inhabited the petting zoo? They’ve all found new cienda Hay and Feed and its owners. She described the a venture. Steiny said he can’t speak for the new owners, homes, including the emu, who came to Hacienda Hay and business “as her daughter’s favorite place to go.” but he did say, “there is a fair amount of talk” about keep- Feed as a chick — and is now 17. “I love Chris and Jo Ann,” McGilloway posted on social ing its use “the same or similar” to what’s previously been “Sidney has gone to a farm in Aromas where they raise media. “They are like family. located there. emus,” Olow reported. “Oriole the pig is going to live with But she wonders where residents will get the products Olow said the building Hacienda Hay and Feed occu- his brother, Sulu, his sister, Lucy, and friend, Carnita, on Hacienda Hay and Feed once offered. pied was built in the 1930s. For many years, Wolter’s Ha- Schulte Road.” “Where the heck is everyone supposed to get hay and cienda Market operated on the site.

$ 500 Drammaatic Frank Llooyd Wrighht style Mid Century homem 9 Yankeee Point Driive, CCarmmel Higi hllands OFF Oppenn Sundaay 1 to 3 STRESSLESS WING CHAIRS IN PALOMA OR PIONEER LEATHERS

OFFER ENDS NOV. 11 Dramatic, immaculate, Ocean View 4,000 square foot home with 3 or 4 bedrooms and 5 baths. A mid- century design in the Frank Loyd Wright style bringing the out of doors into the home. Approximately *See sale's associate for details 2/3 of an acre is beautifully landscaped with a lengthy patio over looking the gardens and Ocean. The remodeled home has a wall of glass and 2 large river rocks walls with a vaulted beamed ceilings. Many mummum''ss placeplace extra rooms and garages for 5 cars. $2,990,000 246 Forest Ave., Paciﬁc Grove | 831-372-6250 For a private showing contact: Earl Meyers 831-601-9999 | [email protected] Mon-Sat 10am-5:30pm | Closed on Sunday's | www.mumsfurniture.com Bonnie Sunwood 831-915-613 | [email protected]

th NomadsSALE 40 Anniversary HOLIDAY & GIFT GIVING EVENT 100’s of Handmade Rugs GIFTS HOLIDAY 50% OFF ITEMS TABLE TOP ITEMS JEWELRY

CLOTHING HOME DÉCOR

YOUR TREASURES AWAIT YOU… Monday, November 4th – Saturday 9th

Nomads Fine Rugs HOPE TO ...to help the homeless 486 Alvarado St Monterey 373-1009 26358 Carmel Rancho Lane, Carmel SEE YOU (831) 293-8140 Rugs* Expertly Hand Washed & Repaired Mon – Wed 10-4:30 Thurs-Sat. 10-5 November 1, 2019 The Carmel Pine Cone 17A

scape manager for a property care company and as a de- perament.” FORESTER partment supervisor at Home Depot, Davis first went to “I was looking for someone who has the necessary From page 1A work for the City and County of Denver in 2005 as a gar- skills and abilities — is an arborist and has experience in dening technician in charge of coordinating and training an urbanized forest, and who is good with people,” he said. master gardeners throughout the city in cooperation with “I think she’s really going to fit the bill. She’s a personable elsewhere for someone to replace him and received more the Colorado State University Extension. person.” than two dozen applications. Rerig and others in city hall From there, she oversaw a million-tree planting initia- In her new position, Davis will receive an annual salary culled the list to a handful who were subjected to panel tive by handling outreach, social media, site analysis, map- of $123,240 plus benefits and retirement contributions. interviews and one-on-one talks. ping, coordination, planning and implementation. The individual interviews “are less structured and a lit- Now, she manages a half-dozen people and a $2.6 mil- tle more of a conversation, lion budget, and oversees annual outreach efforts and cam- and that’s where you really paigns on behalf of her department. She also supervises a Nahla hit on fit,” he said. “It’s one program that plants 3,000 trees in the public right of way thing if someone knows every year, collects and analyzes data, and works on rela- This beautiful girl is so sweet. the lifespan of a redwood tionships with the construction community, nonprofits and She is great with kids, other tree, but it’s another when it other government agencies, among many other duties. dogs, and even cats! Nahla comes to how they’re going enjoys receiving attention and to build relationships with Peninsula’s strong pull is very athletic, able to go on the development communi- In her letter to the city, Davis said she often visited Car- hikes and runs. She knows basic ty and the CRA, and when mel with her parents when she was a child, and fell “in love commands and responds well someone disagrees with with the tide pools, large trees and quirkiness of the area.” for treats. your planting a tree in front “I have worked in different facets of the green industry Nahla is 7 years old and 60 pounds. She is healthy, happy, of their house or your de- from my first high school job at a local garden center to my and ready for a home. cision to refuse to remove current position running one of the largest and most pro- one.” gressive urban forestry programs in the nation,” she said. If you’d like to meet Nahla, Davis hadn’t been hunting for a job when she came across please fill out an online adoption questionnaire. $2.6 million budget the vacancy for city forester here, “but the idea of work- Sara Davis According to Davis’ re- ing and living on the Monterey Peninsula has changed my sume, she graduated from mind,” she wrote. 831-718-9122

UC Davis with a Bachelor In running her department, she said planning and poli- Ad Sponsored by of Science degree in environmental horticulture and ur- cy work have played a large part. Betty P. Bass ban forestry in 2001 and has been involved in gardening, “I hold a core value that the community must partici- (If you’d like to sponsor our horticulture and tree cultivation and care since she was in pate in guiding the work of a municipal government, and next ad, give us a call.) high school. At Davis, she was a student gardener in 2000 public involvement is key,” said Davis, who has overseen a and an intern in the U.S. Forest Service Center for Urban lot of strategic planning in climate action and adaptation, WWW.PEACEOFMINDDOGRESCUE.ORG Forestry Research in 2001. environmental hazard mitigation and other areas. P.O. Box 51554, Paciﬁc Grove, CA 93950 After stints in the private sector, including as a land- Rerig said he found Davis to have “a very even tem-

First United Methodist Church Talk on brain health of Pacific Grove in late adulthood www.butterflychurch.org Worship ALL SAINTS SUNDAY THE NEXT Community Night with the Library will ‘RADIANCE’ feature Dr. Quinn Kennedy presenting, “Cognitive Re- JOIN US AT 10 A.M. serve: Maintaining Cognitive Function into Late Adult- CARMEL ~ CARMEL VALLEY ~ MONTEREY hood” Wednesday, Nov. 6, at 7 p.m. in Carpenter Hall at PACIFIC GROVE ~ PEBBLE BEACH The Rev. Audrey Ward Sunset Center on Mission at Ninth. Loving Child Care, Children’s Sunday School During the free talk, Kennedy, who holds advanced 915 Sunset Dr. @ 17-Mile Dr., Pacific Grove degrees in psychology and cognitive aging from Stanford (831) 372-5875 University, will describe research indicating that “cognitive reserve” can help delay age-related declines in cog- “This beautiful and serene place nitive function and the onset of dementia symptoms. She is the historical and spiritual heart Saint John the Baptist will also offer advice on everyday activities that can help of California.”— St. John Paul II Greek Orthodox Church build cognitive reserve and will provide information about Services: Saturday Vespers from 5 p.m. free resources regarding cognitive aging. Sunday Matins from 8:30 a.m. followed by Kennedy will draw on her 20-plus years of researching 9:30 a.m. Divine Liturgy. and investigating factors that affect older adults’ decision making and mental performance. Her work has been pub- Lincoln and 9th Street, Carmel by the Sea (entrance from Lincoln). lished in numerous scientific journals and has been fea- (408) 605-0621 or [email protected] tured on numerous media outlets. For more information, Carmel Mission Basilica Full schedule: http://www.stjohn-monterey.org/ visit www.carmelpubliclibraryfoundation.org. 3080 Rio Road, Carmel www.carmelmission.org Church of the Wayfarer Mass Times: Saturday 5:30 p.m.; (A United Methodist Church) • 10 am Worship Service ANIMAL HOSPITAL Sunday 7:30 a.m., 9:15 a.m., Worship with us this Sunday, Nov. 3 AT MID VALLEY CENTER, CARMEL 11 a.m., 12:45 p.m. and 5:30 p.m. 831.624.8509 Confessions: Sat. 9:30 to 10:30 a.m. (Blessed Sacrament Chapel) ‘Count Your Blessings: Providing the highest quality medical and All Saints’ Episcopal Church for All the Saints’ surgical services for dogs and cats DOLORES & 9TH, CARMEL-BY-THE-SEA Pastor Luke Ham V Therapeutic Laser V Diagnostic Sunday 8 am & 10:30 am service Nursery Care for Infants & Toddlers V Trauma/EmergencyV Surgery V Digital Xrays in Chapel on 9th: Weekday Morning Prayer 9 am Lincoln & 7th, Carmel by the Sea Thursdays Centering Prayer 5 pm V Ultrasound V In House Laboratory 831.624.3550 • www.churchofthewayfarer.com (831)-624-3883 www.allsaintscarmel.org Ask about our Dental Special and Wellness Profiles Ƌä ŖőőäŅƈű 'ƄäÚő äŅġĩĢäŅĆäŉ

This Sunday Katherine Edison Robert Armstead soprano bass-baritone Melinda Coffey Armstead piano & organ

Karl Anderson, DVM Church in the Forest Available for housecalls at Stevenson School, Pebble Beach U.C. Davis School of Sundays at 9:45 am Veterinary Medicine for Euthanasia and other situations as appropriate. www.churchintheforest.org Lori Anderson, RVT Complimentary gate access & valet parking Hospital Manager FREE EXAM FOR ALL NEW PATIENTS Christian Science Church to advertise in the Sunday Church and Sunday School 10 a.m. Carmel Pine Cone worship section 312 Mid Valley Center • 831-624-8509 Wednesday Testimony Meetings 7:30 p.m Near Jeffrey’s Grill & Catering Reading Room hours: 10 am to 4 pm Mon-Thu, 11 am to 3 p.m. Sat. email [email protected] Serving Carmel, Carmel Valley, Big Sur, Pebble Beach, Childcare & Parking Provided or call (831) 274-8654 Paciﬁc Grove, Monterey and other surrounding areas. Lincoln St. btwn 5th & 6th • 624-3631 18A The Carmel Pine Cone November 1, 2019

according to the water district. Cal Am’s desal plant, with telling how long it could take to get the expanded reclama- DESAL other water supplies, including the reclamation project, tion project approved. From page 1A would provide 15,296 acre feet annually. “There is no expedited track for the PUC to consider The PUC and Cal Am contend that, without desal, there an alternative to their decision approving Cal Am’s desal would not be enough water for tourism, lots of record and plant,” Stoldt told The Pine Cone. When the state’s Public Utilities Commission OK’d the other uses, and that not building the desal plant would Cal Am spokeswoman Catherine Stedman said Cal desal plant in September 2018, it concluded the Monterey make the Monterey Peninsula’s water shortage permanent. Am’s strategy at the meeting will be to make commis- Peninsula needed 14,000 acre-feet of water per year — in- Nevertheless, the coastal commission — which did sioners aware of the “flaws” and “unsubstantiated claims” cluding a small amount for infill development and other not include Cal Am’s response in its document — called about the Peninsula’s water needs, and point out what it be- new uses. Pure Water Monterey this week “a feasible and less dam- lieves are the drawbacks of Pure Water Monterey project. But the coastal commission said that’s not the case now. aging alternative,” and said it’s “progressed from being too “We will point out that the Pure Water Monterey expan- “Since the CPUC’s review and decision, new informa- speculative for the PUC to consider as a viable alternative, sion without desal, as laid out in Stoldt’s memo, does not tion about water supplies and demands shows that there to now being a feasible, well-developed alternative.” contemplate years in which we have a multiple drought- is less need for water from new sources than previously It also said Pure Water Monterey would have “few ad- years scenario,” Stedman said. determined,” the staff report says. verse environmental effects compared to the desal plant Stoldt has said that Pure Water Monterey would survive The coastal commission’s findings rely heavily on a re- and few, if any, adverse effects to coastal resources, since drought due to “built-up drought reserves in average to wet port Monterey Peninsula Water Management District gen- it would be located outside of the coastal zone.” years.” This week, he knocked Cal Am’s criticism of his eral manager Dave Stoldt released in September that says water demand analysis. Pure Water Monterey — a project to purify sewage and Years of delay? “I’m going through the 140-page Cal Am rebuttal to other contaminated water — could supply enough water to Though Pure Water Monterey would not need approv- my report and I’m amused, to say the least, that they can the Peninsula for decades to come, with no ocean desali- al by the coastal commission, Stoldt conceded that if the nation needed. agency rejects a permit for Cal Am’s desal plant, there’s no Continues next page Pure Water Monterey, if expanded to produce more water that first planned, and combined with other water sources, would produce 11,294 acre-feet of H O per year, 2

The California Coastal Commission SHIRLEY KIATTA, RN, CMC approved Cal Am’s • ELDER CARE CONSULTANT desalination test well • COMMUNITY RESOURCE SPECIALIST in Marina because it • CERTIFIED GERIATRIC CARE MANAGER uses what was considered environmen- Helping Families Make Informed Choices tally friendly slant well I am an initial contact to… technology. Now the commission says the Assess needs of client and family. company should not Identify resources to meet the client’s needs. use the system. Assist in coordinating those resources. 2010 Business Excellence Award Winner Monterey Peninsula Chamber of Commerce PHOTO/COURTESY CAL AM

0RQWHUH\6DOLQDV2IƓFHVDQG+RPH9LVLWV 3DFLƓF6WUHHW0RQWHUH\Ř:HVW$OLVDO6WUHHW6DOLQDV 831.645.9950 ZZZVKLUOH\NLDWWDFRPVNLDWWD#PVQFRP

Welcoming New Customers

• No Long Waiting Time • Prescriptions Filled in 15 minutes* • Accepting Most Medicare Part D Plans • Same Day Delivery • Accepts Tricare *In-stock inventory Over 100 Years of Service Still Locally Owned & Operated CARMEL DRUG STORE Ocean Ave. & San Carlos, Carmel 831.624.3819 www.CarmelDrugStore.com Pharmacy Hours: 9am-6pm Mon-Fri Store Hours: 8am-10pm • 7 Days a Week

DEBBY BECK

DAVID LYNG PRESIDENT’S CLUB ELITE & TOP INDIVIDUAL PRODUCER 2017 & 2018

COMING SOON - BEAUTIFUL CARMEL HOME WITHIN 2 BLOCKS TO POST OFFICE & DOWNTOWN 2 BEDROOM | 2.5 BATHROOM | 1,550 SF | $1,499,000

DEBBY BECK NEW PRICE! OPEN SATURDAY 1-3 COMING SOON - RENOVATED OPEN SAT 1:30-3:30 & SUN 1-3 831.915.9710 BROKER ASSOCIATE CRS®, GRI® — DRE 01747647 211 Grand Ave, Paciﬁc Grove [email protected]

KIM SMITH DRE 02066615 | 831.917.1433

NICOLLETTE EASON TROTTIER 14 CIELO VISTA TERRACE, MONTEREY SKYLINE FOREST, MONTEREY 1108 MONTECITO AVE, PACIFIC GROVE DRE 02074629 | 831.595.0009 3 BED | 2 BATH | 1,879 SF | $1,049,000 3 BED | 2 BATH | 2,131 SF | $1,499,000 4 BED | 2.5 BATH | 1,813 SF | $949,000

DEBBYBECKPROPERTIES.COM November 1, 2019 The Carmel Pine Cone 19A

From previous page “We would be in a situation of conflicting direction Cal Am notes that the desal plant would provide wa- from state agencies and an inability to comply with the ter to the City of Castroville, which has a severely disad- continue to say that the analysis is flawed because the PUC orders of all those agencies,” Stedman said. vantaged population and a saltwater-tainted groundwater reached its conclusion” on the amount of water the Penin- The state water board has ordered Cal Am to stop supply. Proponents also say the project would benefit the sula needs, Stoldt told The Pine Cone. “That was then, this pumping most of its water from the Carmel River, the county’s hospitality workers, many of whom live in eco- is now, and things are different.” Peninsula’s primary water source, by Dec. 31, 2021. If it nomically disadvantaged areas of the county. The City of Marina, which argues that the desal plant doesn’t, the people of the Monterey Peninsula could face “Having an adequate water supply to meet the basic would harm its coastal dunes and groundwater, issued a mandatory cutbacks and fines. demands of the community is in my mind a social justice press release praising the coastal commission staff’s rec- If commissioners deny Cal Am’s permit, the company issue,” Stedman said. ommendation. could appeal, but that would likely mean a protracted pro- “The analysis outlined in the report is thorough and cess that would make it unable to comply with the state highlights the damages to the environment and the com- water board order. As it stands, Cal Am has said it would Visit AdvancedBlind.com munity that were identified when the City of Marina’s have to begin building the desal plant shortly after approv- planning commission issued its own coastal permit denial al to meet the state water board deadline. for current available discounts in March,” the city said. In its recommendation for denial, the coastal commis- Offer must be presented at time of order sion also pointed out what it called the “environmental Agencies in conflict justice” issues stemming from the cost of water from Cal Made Right. Made Right Here. A denial of Cal Am’s project by the coastal panel would Am’s desal plant, which is expected to be about $6,100 per Made Right. Made Right Here. put the company in the precarious — and perhaps un- acre-foot, compared to $2,100 per acre-foot from water precedented — position of being caught in the middle of produced by Pure Water Monterey. contradictory mandates from the coastal commission, the “Cal Am’s project would create substantial hardships Public Utilities Commission and the State Water Resourc- for several communities of concern that would be affected es Control Board. by the relatively high water costs,” the document said.

Adoption group Law Office of celebrates 35 years Sara Senger

PINE CONE STAFF REPORT 30 years of experience in Medi-Cal Estate Planning THE MONTEREY County-based adoption and foster care nonprofit, Kinship Center, is celebrating its 35th year providing adoption, foster care and caregiver and mental health services to children and families. Elder Law Founded in 1984 by Carol Bishop and Carol Biddle, Salinas-based Kinship Center went from a three-person Wills and Trusts Monterey County’s Premier In-House Manufacturer of agency in an apartment to part of a statewide nonprofit, Quality Blinds, Shades, Shutters and Window Coverings Seneca Family of Agencies, with more than 1,000 employees. Special Needs The group’s official anniversary was in September, but the agency announced the milestone ahead of national adoption month in November. “Every year, Kinship Center supports more than 1,500 I will make home and hospital visits children and their families,” the group said. For more in- SHOWROOM LOCATION formation regarding Kinship Center’s 35-year anniversary, 2511 Garden Rd., Suite A230 Monterey 2320 Del Monte Ave. | Monterey National Adoption Month, or to donate, visit kinshipcen- (831) 372-1908 | AdvancedBlind.com ter.org or call (831) 455-4713. (831) 646-5424 | [email protected] *discount on in-house manufactured products. Helping our homeless

community attain safe PROPERTIES LLC affordable

housing Silverie Properties LLC is proud to acknowledge Maribel Martinez, our managing partner employee, for her For Over outstanding service. Maribel has been the manager at Plaza Grande Apartments for 30 Years! over ten years. Earlier this month, she was recognized by the City of Salinas and CCIL (Central Coast Center for Independing Living) as an outstanding manager and for her assistance in the affordable housing needs of the community. Housing Resource Center of Monterey County 201A John St., Salinas (831) 424-9186

WWW.SILVERIEPROPERTIES.COM Donate to HRC through McGives! 831-920-3545 www.montereycountygives.com 20A The Carmel Pine Cone November 1, 2019

per year in hotel tax, $1 million in property there’s going to be a wine corridor — this in the foothills of the Santa Lucias on a PARAISO tax, and $8 million in tourist dollars. is going to be an anchor.” 235-acre property, the hot springs resort From page 6A Kim Stemler, the executive director of This week’s hearing was continued from had operated since the late 19th century- the Monterey County Vintners & Grow- March, when planning commissioners held but has been closed since 2003. Two years ers Association, called the effort to bring off on making a decision about the make- later, developer John Thompson unveiled tearing down 18 structures, including nine the resort back to life “heroic,” and said it over — in part because Attorney General his plan, which also includes expanding an historic cottages, in 2003. One of them, would create better job opportunities in lo- Xavier Becerra’s office had concerns about existing water system, installing a waste- Jeffrey Becom, said it would cost $1.7 cal communities. the wildfire risk. water treatment system and cutting down million to rebuild the lost structures, so he Planning commissioner Melissa Du- Located seven miles west of Greenfield 185 oak trees. reasoned a fine of that size would be a fair. flock, who represents the district where the resort is located, offered her support. She Jobs for locals also suggested that had it been approved Others suggested the renovation of the earlier, its success might have saved local resort would provide a big boost to the lo- wineries that went out of business. cal economy. The builder has predicted it “I’m really excited about this project,” would create 300 jobs, generate $2 million Duflock said. “The general plan has said Experience No Bars. No Springs. Pure Comfort.

NEW SPA NOW OPEN! CaliforniaThe Salon & Spa RECEIVE 10% OFF AMERICAN LEATHER'S COMFORT COLLECTION Sleepers, Recliners and Chairs Choose from a Pumpkin *See your sales associate Enzyme Facial, for complete details mummum''ss placeplace Signature Facial or 246 Forest Ave., Paciﬁc Grove | 831-372-6250 Aromatherapy Massage Mon-Sat 10am-5:30pm | Closed on Sunday's | www.mumsfurniture.com Hour long Service $99 Limited Time Only We pay for news photos! WůĞĂƐĞŵĞŶƟŽŶƚŚŝƐĂĚƚŽƌĞĐĞŝǀĞĚŝƐĐŽƵŶƚ The Carmel Pine Cone will pay up to $50 for photos of #thesaloncalifornia newsworthy events around the Monterey Peninsula. BOOK ONLINE or call 831-620-5595 Submit yours to [email protected]. www.thesaloncalifornia.com 9698 & 9750 Carmel Valley Road, Carmel, CA 93923 Payment made for photos accepted for publication. ;ŽīZŽďŝŶƐŽŶĂŶǇŽŶĞǆŝƚŝŶ&ĂƌŵĞŶƚĞƌͿ

ALIFORNIA STATES UCTION UNDAY OVEMBMBER THTH AAMM PST O VER 200 LOTS OF ESTATE JEWELRY

DECEMBER 15TH CHINESE ANTIQUES AUCTION NOW ACCEPTING PATIENTS AT OUR NEW LOCATION IN MONTEREY!

NOW ACCEPTING CONSIGNMENTS House Appointments Available - Please email photos first Christian Flickner, O.D. | Jennell Bockenstedt, O.D. Call 408.505.0708 | Email photos to [email protected] Maureen Hong, O.D. | James Flickner, O.D. “We Simplify the Process of Selling Both your Home and your Personal property.” 700 Cass Street, Suite 101 48 West Romie Lane 271 Reservation Road, Suite 202 Ask Us How. Monterey, California 93940 Salinas, California 93901 Marina, California 93933 ROBERT SLAWINSKI M. 408.505.0708 831.641.7252 tel 831.424.0834 tel 831.384.6800 tel Auctioneer & REALTOR M. 831.334.4393 831.424.4994 fax 831.424.4994 fax 831.384.6802 fax DRE# 01354172 o. 831.335.9000 November 1, 2019 The Carmel Pine Cone 21A

sculptures, and help to expand the under- Dec. 12. The art center is located at 568 Dolores between Fifth and Sixth. “There ART standing of the richness and the intricate Lighthouse Ave. Call (831) 375-2208. are some subjects that seem to want to be From page 14A possibilities of this medium.” painted,” the artist suggested. Also new at the art center are shows by The fine art of flowers While tulips and daffodils in Ammon’s photographer Rachell Hester (“Between Q garden always fade, her paintings of them The greatest invention? Here and There”), painter Nina Temple A painter with an affection for flo- will likely outlast her. “By creating paint- Q (“Moving Water”), multi-media artist Ker- rals and rich color, Margery Ammon will ings of them, we need not watch them New shows will be unveiled Friday, ry Conboy (“So Far”), and local incarcerat- demonstrate how she paints tulips and daf- fade, nor do we need to wait another year Nov. 1, at the Pacific Grove Art Center, in- ed youth (“Empathy with Animals”). fodils Saturday, from 11 a.m. to 5 p.m., at for their appearance in our gardens,” she cluding a display by Gerald Huth, whose Nov. 1 is also First Friday in downtown Gallerie Amsterdam, which is located on added. imagination runs wild when he has paper P.G., where many merchants will stay in his hands. open late, including Artisana Gallery (612 “Paper is one of the great inventions of Lighthouse Ave.), which represents many mankind,” Huth said. “The uses and variet- local artists, and Hauk Fine Arts (206 ies continue to inspire and influence artists Fountain Ave.), which focuses on early and HOLIDAY today — this exhibit will showcase a large contemporary California art. FASHION EVENT variety of collages, paintings, and collage The shows will be on display through Friday-Sunday November 8-10 most homes in the area — were reopened ROAD four months later. Glitz & From page 11A As for a time table on repairs to the upper part of the road, the Monterey County • New and vintage jewelryGlamour Board of Supervisors was set to discuss it 130,000 acres. The rain trigged mudslides, at their Nov. 5 meeting, but the county’s • Designer high end fashion with tags still on which damaged many sections of the road. chief of public works, Randy Ishii, told While most of residents can now reach The Pine Cone it’s been pulled from the • Great men’s designer shirts and ties their homes by vehicle, a few who live agenda because some details still need to • Couture shoes and boots along the upper portion of Palo Colorado be worked out. He expects the item will be Road still can’t. back on the agenda with a couple months. • Name brand handbags… and more! After a major culvert replacement proj- “We still need to present it to the budget ect began in June 2018, the first four miles committee before bringing it to the full SPCA Benefi t Shop of the road — which provides access to board for consideration,” Ishii reported. 26364 Carmel Rancho Lane, Carmel near the Barnyard Shopping Village 831-624-4211 Mary Bell Open House Saturday 1-3pm Open Mon-Sat 10-4 • Sun 12-4 Exceptional Representation For Individual Needs SE Corner San Antonio & 2nd

Chartwell School: Empowering students who ơǤ

For over 35 years, Chartwell has been transforming the Private Carmel home with library conveniently located close to Carmel Beach lives of students in Carmel ■ 3 Beds, 2 Baths plus Den ■ $3,695,000 ■ www.SESanAntonio2nd.com grades 2 to 12 with a variety of learning 831.595.4999 ■ www.MaryBellProperties.com DRE#00649274 ơ Ǥ ǡ͙͕͔ǣ͔͗Ǥ ȋ ͗ ͛Ȍ Support Pine Cone advertisers — shop locally Ǥ Ǥȁ͕͗͜Ǥ͗͘͝Ǥ͚͗͘͜ ȁ͖͙͕͕Ǥȁǡ͙͙͗͝͝ 22A The Carmel Pine Cone November 1, 2019

in the commercial districts. A developer “We need this policy,” he added. AGENDA could have one transient rental if the plans MEMORIALS “I think this policy is thoughtful, and I From page 8A also include three other units, with at least From page 3A support it,” commissioner Stephanie Locke one for low-income residents and one for said. moderate-income residents. Commissioner Julie Wendt suggested ommending approval of the agreement for Finally, the council will consider a sponsibility of a specific department. adding another line explicitly stating that a historic house on Lopez Street. business owner’s plea to operate a store on Q An inventory list and photos of all special events on Ocean Avenue need to Dolores Street that sells honey-based skin- war memorials shall be maintained. adhere to the rules protecting the memorial Tax arguments care products. After people complained Q These policies will be given to any- arch. With that addition, the commission At Tuesday’s meeting, the council will about the shop’s employees standing in the one holding a special event near any of the unanimously voted to send the new policy review proposed ballot arguments in favor doorway and soliciting business, a city of- war memorials. to the council for review, and members will of increasing the sales tax, which voters are ficial visited the shop and noted it offered Q When events are scheduled, Ameri- look at the updated version Tuesday. set to decide in the March 2020 election, skincare products, which requires a spe- can Legion Post 512 must be notified. and will consider extending an ordinance cial permit. The planning commission a on sidewalk vending (see story page 1A). few months ago denied the permit, and the Much needed GAVEL The first draft of an ordinance regulat- owner wants the city council to overturn Post Cmdr. Brian Andrus comment- From page 4A ing short-term rentals in the business dis- that decision. Wiener is recommending the ed that the World War I memorial arch is trict and apartment buildings will also be council uphold the denial, which means the “looking great,” since it is now being re- up for a vote. The new law would allow store will either have to change its invento- stored, but he told commissioners he had followed by “dirty looks” from the those who have permits now to keep them ry, shut down or sue the city. to ask kids to get down off of it during Car co-worker. This was preceded by vague and would also use vacation rentals as in- For more information and complete Week. He suggested including the frequen- rumors that the co-worker was going to centives for construction of new housing agendas, visit ci.carmel.ca.us. cy of inspections in the policy and a line “hurt” him. Instead of reporting this to his about the rules being in keeping with state supervisor or security, Andrade left work, and federal guidelines. drove to his house in Salinas, put his load- “Thank you for considering this,” he ed handgun and an extra loaded magazine said. “It’s been really nice seeing people in a lunchbox and returned to work. Pet Specialist of Monterey is your complete get behind this and having the memorial Upon returning to work, he told his su- come back to the forefront.” pervisor that he had a loaded firearm. The Chair Michael LePage, who was on the supervisor immediately called the Monte- 24-HOUR EMERGENCY AND committee, said it’s important to maintain rey County Sheriff. After a brief investi- the memorials to honor the people who gation, Andrade was arrested for carrying sacrificed their lives. a loaded firearm in his car in the City of FULL-SERVICE SPECIALTY HOSPITAL Commissioner Christopher Bolton sug- Salinas. Judge Wills sentenced Andrade gested inspections be done annually, rather to 15 days in jail, and ordered the weapon Surgery than “periodically.” destroyed. Internal Medicine Cardiology ICU and Emergency Care

Serving the community since 2011 Call us and schedule a tour today! Located in the Stone Creek Shopping Center 831 | 649-3363 451 Canyon Del Rey Blvd. in Del Rey Oaks www.centralcoastseniorservices.com 831-899-7387 (PETS) CA License #275202563 November 1, 2019 The Carmel Pine Cone 23A

liver the car bodies to him, then he’d hand me a box and AUGUST send me into his plant to pick out all the parts I wanted.” Pacific Grove From page 25A Tilted masts A passion in recent years has been creating miniature Top Name Brands Most memorable moment: August and a fellow fire- models of historic sailing vessels, like the Vasa, a warship fighter once crawled upstairs to the second floor of a burn- built between 1626 and 1628 to the specifications of the ing home, spotted the feet of an unconscious woman, and king of Sweden. The boat listed to one side just 1,300 me- pulled her to safety. ters into its maiden voyage, its cannon ports filled with “I’m the guy who grabbed her, but it was a team effort water, and, with most of Stockholm’s population looking from the get-go,” said August, who received a commenda- on, sank in the harbor. tion for his action. “It was impressive how every one of us A model of the 1797 USS Constitution (“Old Iron- did exactly the right thing that day.” sides”), with an intricately crafted copper hull, took two August began building and racing radio-controlled years to construct. It’s a centerpiece of the living room in cars, and in 1996, he went to the national championships August’s northeast Carmel home, alongside his replica of in Seattle, where he took top honors in two separate class- The Royal Caroline, a yacht built in 1750, then broken up es, thanks in large part to the custom paint jobs he applied for parts in 1820. to his cars. He also painted models for other racers. One of August’s personal favorites is a Baltimore clip- After that event, he was recruited by a Costa Mesa per, on display in his workshop. model car manufacturer to apply custom paint jobs to its “I fell in love with Baltimore clippers because their products. masts are tilted, rather than standing straight up, and they “That arrangement kept me in the sport for 10 years,” just look like they’re going fast,” he said. he said. “I took most of my compensation in trade. I’d de- He also has a miniaturized “luxury tugboat” (a current fad in the Seattle area). Peek through the window of the vessel to see hardwood floors, a dining room, and a complete kitchen with a tiny Pepsi can on the countertop. Some of his projects take years to complete, but August said he’s far more likely to give one away than sell it. He has never approached a gallery and doesn’t have a website, but occasionally does commission work. Marita Johnson He can be reached via email at caugust1946@hotmail. com or by phone at (831) 625-2637. Dennis Taylor is a freelance writer in Monterey County. Contact him at [email protected]. Marita’s Boutique 551 Lighthouse Ave. | (831) 655-3390 • Cheyenne • NoBlu • Fenini • Neon Buddha • Toofan • Beau Jour • Baciano • Mycra Pac

Marita’s Mens 549 1/2 Lighthouse Avenue AFRP ADOPTION CENTERS Hitch your wagon and ride to town. (831) 657-0114 There’s a SALE going on at • Kuhl • Olukai The Soiled Doves Bath House • Pendleton • Fridaze Relax into the season with savings • Jeremiah • Cole Haan Viau Estate Jewelry on wonderful practical gifts. • Samuel Hubbard • Vionic Friday Nov. 1 & Sat Nov. 2 • 10am – 5pm • Tommy Bahama • Clarks FINE ESTATE JEWELRY Sunday Nov. 3 • 11am – 4pm

BOUGHT AND SOLD Dolores St S/W of Ocean Ave by Piccadilly Park Carmel-by-the-Sea Marita’s Shoes Serving Carmel Since 1982 831.624.9377 547 Lighthouse Ave. 831-624-5991 (831) 373-4650 • Bueno • Bernie Mev Mission St. Between Ocean and 7th Get your complete Pine Cone every Thursday night by email — • Jambu • Jafa www.viauestatejewelry.com Free subscriptions at www. carmelpinecone.com • Sergio Tomani • Vionic • Eric Michael • Sorel NEED Fencing? Three Stores Call today for your in the Heart FREE CONSULTATION of Paciﬁc Grove 831.783.1500 www.CypressCoastFence.com PACIFIC GROVE CHAMBER OF COMMERCE (831) 373-3304 LIC. #904200 WWW.PACIFICGROVE.ORG 24A The Carmel Pine Cone November 1, 2019 Editorial BEST of BATES Tax dollars aren’t free

THIS WEEK we report that Monterey County has received a $1.8 million grant from the federal government to help fix Palo Colorado Road, which is definitely good news for anybody who needs to use that road. But it’s also a time to consider what “grant” means. The word pops up all the time in meetings of local city councils, planning commissions, park districts, etc., etc. etc. When they want to do something they don’t think they can afford within the limits of their own budget, local officials usually try to get a “grant” — a term they use as a synonym for “gift” or perhaps “lottery winnings,” which is to say, money that can be spent happily or even frivolously. Sometimes, they’re right. A grant can be a gift, but usually it’s not. The difference is very important, as officials at all levels of state and local government debate whether to apply for and spend those wonderful things called “grants.” A grant is a gift — something given at no cost to the recipient — when it comes from a private individual or organization that offers money to promote whatever cause they’re interested in. The Bill and Melinda Gates Foundation, for example, gives millions in grants every year to promote population control, conservation and education, all in accordance with the wishes of Gates, one of the world’s richest men, who has decided to give away a large portion of his billions. Numerous other tycoons of the internet era have also set up foundations that make grants, and all of them should be thanked. But most grants you hear discussed at city hall or in the board of super-

visors’ chambers are sent from one branch of government to another. They “I hear they used a Danish architect.” are definitely not gifts. They are an allocation of tax dollars which are, of course, collected from people who have incomes. These taxpayers have no We are relieved that Monterey County choice but to pay their taxes, and when they send their money to the govern- Animal Services has impounded the Hen- ment — federal, state or local — they expect it to be spent wisely. Letters derson dog in order to protect the rest of us walking in our neighborhood. And we Too often, local government officials speak of a grant from the federal or to the Editor wish to set the record straight, that Larry state government as if it fell from heaven. Television and newspaper reports Arthur and his dog were the victims, not the offenders. almost always refer to a federal grant with studied casualness, never men- ‘Not the victims’ James Stellar, Jody Hansen, Susan tioning that the money gleefully received at city hall or the county court- Dear Editor, and Bud Miller and 30 others house in the form of government grants comes from the very taxpayers We live on Pine Hills Drive in the Car- mel Views neighborhood. The Pine Cone Who really sent the letter whose interests the journalists should be guarding. Oct. 25 article about a recent dog attack Dear Editor, The more distant the source of the grant, in fact, the less local officials misrepresents what happened and does not Your lead article last week, “Anti-Cal and reporters seem to worry about who is really paying for it. address concerns for safety in our neigh- Am group asks state board to block desal borhood. plant,” was in error. The letter sent to the The subject is relevant not only because of what’s going on in Palo Col- The Akita jumped a fence, crossed the California Coastal Commission from 28 orado Canyon, but because “grants” represent the hopes and dreams of street, and attacked an adult, Larry Arthur, local elected officials opposing Cal Am’s government officials everywhere. In just the last couple of years, we have walking his dog. Mr. Arthur’s defensive in- desal plant did not come from Public Wa- juries are not “alleged” but quite real and ter Now. Stating or characterizing this let- reported about “grants” from one layer of government to another for things required staples and stitches on both his ter from elected leaders as a Public Water like repairs to Mission Trail park, maintenance of the World War I Memo- arms. His dog needed stitches in his throat, Now letter is absolutely false. face and ears as well. Their injuries would Was this an attempt on the part of The rial Arch, construction of Cal Am’s desal plant (which may not get a permit have been more significant if Larry had not Pine Cone to diminish the voices of elect- but got $10 million from the Department of Water Resources anyway), in- defended himself with a pocketknife. ed officials or just a mistake on the paper’s stallation of new trash containers in downtown Carmel, design and building Quite a few of us walk, skateboard and part? This paper has long been a friend to bicycle on Pine Hills. Many passersby Cal Am. I call on The Pine Cone to pub- of the roundabout, improving services to the homeless, etc., etc. All of these have felt intimidated by the growling and lish this important letter and let those who are very worthy causes. But when the water resources department “grants” barking dogs straining at the Henderson’s signed it speak for themselves. fence. The constant barking of three dogs I am a partner in a local advertising $10 million for the construction of a desal plant, this money represents the disrupts the quiet we enjoy in our neigh- agency; I arranged the press conference on hard work of taxpayers. It is not play money to be spent just because it’s borhood. the letter. The demonstration set up in con- there. The Henderson’s claim that they don’t junction with the press conference was a feel safe because of Larry Arthur is far group effort by Public Water Now, Citizens Unfortunately, so much money flows from citizens to government at all outweighed by our collective fear of their for Just Water and other groups. levels, most officials can’t help but start thinking of that money as some- dog’s aggressive behavior. If this dog is re- Melodie Chrislock, Carmel turned to our neighborhood, then the next thing to be spent at will. They should be doing the opposite. Taxpayer dol- passersby walking with a dog or a stroller Not for billionaires lars — from whatever source — are very precious and should only be spent might not be able to defend themselves. Dear Editor, when they have to be. Some of us have opted not to take walks I too hope that this beautiful area will just to avoid the area where the dogs are located. See LETTERS page 12A

Q Publisher ...... Paul Miller ([email protected]) Production/Sales Manager ... Jackie Miller ([email protected]) Q 734 Lighthouse Ave., Pacific Grove, California 93950 QOffice Manager ...... Irma Garcia (274-8645) Mail: P.O. Box G-1, Carmel CA 93921 QReporters ...... Mary Schley (274-8660), Chris Counts (274-8665) ...... Kelly Nix (274-8664) Email: [email protected] The Carmel Pine Cone or fi[email protected] QFeatures Editor ...... Elaine Hesser (274-8661) QAdvertising Sales ...... Real Estate, Big Sur - Jung Yi (274-8646) Telephone: (831) 274-8593 Carmel-by-the-Sea, Carmel Valley, Carmel & Pebble Beach www.carmelpinecone.com ...... Meena Lewellen (274-8655) Monterey, Pacific Grove, Seaside, Sand City ...... Jessica Caird (274-8590) PUBLISHED EVERY FRIDAY QReal estate classifieds ...... Vanessa Jimenez (274-8652) QLegal Notices ...... Irma Garcia (274-8645) Vol. 105 No. 44 • November 1, 2019 The Carmel Pine Cone QAd Design ...... Sharron Smith (274-2767), Vanessa Jimenez (274-8652) was established in 1915 and is a legal newspaper for QAd Design & Obituaries ...... Anne Papineau (274-8654) Carmel-by-the-Sea, Monterey County and the State of California, QOffice Assistant ...... Hannah Miller (274-8593) ©Copyright 2019 by Carmel Communications, Inc. established by Superior Court Decree No. 35759, July 3, 1952 QCirculation Manager ...... Scott MacDonald (261-6110) A California Corporation QFor complete contact info: www.carmelpinecone.com/info.htm November 1, 2019 The Carmel Pine Cone 25A You can get ’em back on the farm Tiny houses: Extreme edition

— even after they’ve seen Havana LIKE SO many kids of his generation, And he built an ornate replica of a fa- Chuck August built model cars, a hobby mous old Canadian filling station, Shady BENJAMIN EICHORN was sitting in son, thinking farming was unglamorous, that evolved into “kit bashing” — creating Grove Texaco, resplendent with red trim the MEarth amphitheater at Carmel Mid- and I wasn’t interested in land stewardship. unusual cars out of parts left over from his over white paint, and two tiny, antique gas dle School, surrounded by singing birds I knew I’d be back only if I needed Plan B.” other models. pumps. Parked alongside is a model of a and buzzing insects, when he became Eichorn was finishing high school when Then he started building and flying “woodie” station wagon with two surf- keenly aware that the breeze had changed. he met the president of Whitman College model airplanes, which took his enthusi- boards strapped to the roof. “The wind just shifted, the heat’s ris- at a Carmel High college fair. He liked the asm to a new level. “Where I grew up — Rock Springs, ing inland, and the land is warming up,” idea that Whitman was not too far from “It was such a rewarding thing to take Wyo. — that’s what a lot of the gas sta- he said. “We hear so much about climate home, but far enough to get away and en- what was basically a box full of sticks and tions looked like,” August reminisced. “I change. I’ve definitely seen the weather joy the four seasons of Washington State. remember life there being change here over the years.” He majored in sociology and Spanish, and a lot of fun. It was one of Earlier this year, tak- those places where we’d get ing the helm as execu- Carmel’s Artists in our cars and cruise from tive director of MEarth one end of town to the oth- — the environmental By DENNIS TAYLOR er, turn around, and go all sustainability educa- the way back, just like in tion program in Carmel make it fly,” he said. “This was way before ‘American Graffiti.’” Valley — was a kind of radio-control, and it was a whole lot of fun His grandfather, Charles August, immi- homecoming. He first for kids like me, growing up in Wyoming.” grated to Rock Springs from Greece and became engaged with August today is a “master modeler,” found work but decided after two weeks the organization in the specializing in meticulously detailed boats, that he was likely to be killed in the copper late 1990s, when it had cars (some radio-controlled), and quirky mines. He quit that job, bought himself a an owl program and had buildings, like his miniature reproduction camera, and in 1919, he opened New Stu- begun to rebuild the nat- of the Tuck Box, the iconic little restaurant dio Photography, which still exists today. ural habitat for birds. on Dolores Street between Ocean and Sev- Chuck’s father, Tony August, and his Uncle enth avenues. Mike took over the business in 1945 and Cuban music The charm of his work is in the detail. ran it together until Tony uprooted the fam- After graduating “Peek through that window,” suggested ily and moved to Carmel in 1962. from Stevenson School, the 73-year-old artist. “See that picture on “We moved here the summer before my Eichorn, who grew up in the wall? That’s the actual art that’s on that junior year in high school, and I wasn’t Palo Colorado Canyon, wall in the Tuck Box.” happy about it. I had so many friends in went off to Whitman August photographed the painting in Rock Springs — life there was a bowl of College in Washington, the cozy restaurant, then reduced his im- cherries for me,” Chuck said. “My very and traveled extensively age to the size of a large postage stamp. first impression of Carmel was, ‘Wow, in Cuba and Central and PHOTO/PHILIP M. GEIGER He used the same technique to replicate there aren’t even any sidewalks or street South America before Ben Eichorn once thought he was leaving the family homestead in shelves displaying teacups. There’s also a lamps … what kind of place is this?’” settling for a time in San Palo Colorado Canyon behind. Instead, inspired by urban farms in fire in the fireplace. The August family bought the Colo- Francisco. But now that Cuba, he came back to help children learn where food comes from. His Tuck Box model won first prize in nial Terrace Inn at 13th and San Antonio. he’s here, he said he feels the 3D class at last year’s Monterey Coun- Chuck and his father refurbished three of like he never really left ty Fair and got a third-place award in the the rooms and quickly started turning a home. minored in environmental science, gradu- overall art exhibit. profit. “I was 1 year old when my parents ating with what he considers a good liberal Chuck August graduated with Carm- bought 40 acres of poison oak in Palo Col- arts education. Missing Wyoming el High’s Class of ’64, and 10 years later, orado Canyon,” he said. “I spent my ear- “During school, I spent six weeks August also created a miniature version he was hired as a firefighter for the City of ly years in a pig barn my dad bought and studying in Cuba, led there by a love of of another local landmark, Uyeda Bros. Carmel. He worked there 32 years, retiring took to the canyon to serve as an instant Afro-Latin music,” he said. “I’m a percus- Automotive, which operated in Monterey in 2006. house, until he built his dream home — a sionist, and I really wanted to learn how for 40 years at 560 Fremont St., as a com- “It was the perfect job for me,” he said. rammed-earth house.” to play the rhythms of this culture while mission for the Uyeda family. “I knew how houses were built, how to take Eichorn’s dad is building contractor studying social sciences in Havana.” He’s replicated Mel’s Drive-In (from care of them, where problems were likely Peter Eichorn, and his mom is Janie Rom- As he moved through the city, Eichorn “American Graffiti”) — a model now on to lie. It wasn’t a desk job, so I was outside mel-Eichorn, a marriage and family thera- noticed a number of urban farms and display at the Corvette Museum in Bowl- and active, serving the community. I really thought, ‘Holy cow, this ing Green, Ky; the Nifty Fifty’s Drive-In (a didn’t want to retire, but I was just getting farming thing is unique — popular East Coast chain); In-N-Out Burg- too old.” beautiful, super-productive, er (complete with tiny hamburgers on the Great Lives and organic.’ I also noticed grill), and similar slices of Americana. See AUGUST page 23A they were being managed by By LISA CRAWFORD WATSON elderly farmers. Locals told me farming was not hip or pist. His sister, Lizzie, is a scientist. Mean- cool to young people. I knew I needed to while, at their home — dubbed Country explore that.” See Master modeler Farm Flat — the whole family grows or- Back at Whitman, he did a 30-page pa- Chuck August shows ganic fruit, vegetables and cut flowers, and per (in Spanish), which explored the value off his hand-crafted keeps honeybees and goats. of family, community and culture, and how sailboat, alongside “I was thinking, just this morning, as I they’re connected to the land. replicas of Carmel’s poured a little goat’s milk into my coffee, “I realized what my parents had done Tuck Box Restaurant, about the quality of my life and how fortu- in Palo Colorado was pretty cool,” he said, a vintage gas station, nate I am to be able to enjoy having grown “And I understood that this is how to get and a woody station up here,” he said. “I didn’t always feel that people to eat healthy food — you get them wagon, complete with two surfboards. way.” involved in the cycle of planting, cultivat- Eichorn said he used to feel like an out- ing, growing, harvesting, cooking, eating, sider, driving his rusted pickup to Steven- and composting. This creates ownership son School. He left home for college at 18, and connectivity.” pretty sure he wasn’t coming back. Eichorn went on to do a senior paper PHOTO/DENNIS TAYLOR “I was ungrateful — not that I didn’t on school gardens and their impact on aca- love or respect my parents and the way they raised us,” he said, “but I’d gone to Steven- See EICHORN page 27A

183 Sonoma Lane, Carmel Highlands Don’t miss “Scenic Views” by Jerry Gervase 3 Beds, 3 Baths ■ www.183SonomaLane.com ■ $1,429,000 — every week in the Real Estate Section.

Real Estate Solutions

For When Needs Change. (831) 601.1620 | Paul Brocchini Mark Ryan | (831) 238.1498 DRE #00904451 DRE #01458945 Call 831.601.3320 AdamMoniz.com DRE: 01885594 26A The Carmel Pine Cone November 1, 2019 The wedding gift that ultimately turned the bride into a widow ONE TRACT on the map of the Ranchos He was an old man when his fourth wife died varado’s grant, dated Jan. 27, 1840, gave the of Monterey County stands out because of its giving birth to Loreta the very night the pirate land to Romero with the understanding that non-Spanish name — the James Meadows Hippolyte de Bouchard plundered Monterey one of the natives, Jose Agricio, could keep Tract. The nearly 4,600-acre ranch sat along in November 1818. his house and farm. Carmel River, between today’s Quail Lodge Fisher’s story is partly fiction, but her ac- The grant made no mention of the Peral- count that in 1834, the padres of tas and other families, who didn’t understand the Carmel Mission gave land as how someone could claim the land which a wedding present to Loreta and their ancestors roamed freely, and which the History Beat her first husband, Domingo Peral- padres had assured them was theirs. They ta, is close to accepted tradition. stayed, even as Romero and his men harassed By NEAL HOTELLING There was no written deed from them continuously. Domingo Peralta was the church, which lost its lands a soon found dead in the hills, and Loreta be- Resort and Garland Ranch. It officially be- year earlier through the Secularization Act. came a widow with two children, Jacinta and came Meadows’ property in 1866, although That set the stage for a lethal conflict. Madelena. he moved there following his 1842 marriage Loreta’s husband, Domingo Peralta, was to Loreta Peralta y Onesimo, a young widow Esselen. Since neither of them was Mexican, Enter an Englishman with two children. their unwritten land claim was easily chal- Meadows arrived at Monterey with a whal- Loreta’s story was made famous by Anne lenged. Gov. Alvarado prepared to grant the ing ship in 1837 and decided to stay, but that Fisher’s 1940 work, “Cathedral in the Sun.” land to Jose Antonio Romero, a civil adminis- didn’t last long. He was one of 50 aliens de- Fisher’s source was the couple’s daughter, Is- trator. Several native families who lived there ported to Mexico in 1840, suspected of sup- abelle Meadows. According to Fisher’s story, pled for protection from the grant, and Jose porting insurrection. After 18 months he was An illustration that accompanied the July Loreta’s father, Juan Onesimo, was a Rumsen Amesti, acting justice of San Carlos, declared 14, 1902, obituary for James Mead- native who helped build the Carmel Mission. that some of them had valid claims. Still, Al- See HISTORY next page ows in the San Francisco Chronicle. November 1, 2019 The Carmel Pine Cone 27A

five children together between 1843 and 1860: Frank, Isa- ley Road, which was approved in January 1892 after he, HISTORY belle, Edward, James and Thomas. Meadows had appren- accompanied by William Hatton and Joseph Steffani, pe- From previous page ticed as a blacksmith, and did that work for others, even as titioned the county board of supervisors to build the road. he built up his own ranch. Loreta did not see its completion. She died at the ranch on Meadows’ efforts to resolve ownership of the property Sept. 30, 1892. released and returned to Alta California. He found work were aided by friends like Thomas Larkin, as well as by When Meadows died on July 12, 1902, his estate was on ranches, notably Rancho El Sur, which was owned by external events. When Commodore Sloat claimed Califor- initially valued at $125,000, and his will stipulated that fellow British expatriate Cap. John Rogers Cooper. nia as a U.S. holding in 1846, uncertainty about the future the revenue from the ranch should be paid to his children, On his return to Monterey in 1842, Meadows married caused land values to fall. Romero sold the ranch in Janu- but the ranch was not to be sold until the last child died. Loreta and moved onto the disputed ranchland. They had ary 1847 to William Garner. Larkin bought it from Garner Then it was to be sold with the proceeds divided among in March and sold it to Meadows. Following California’s the grandchildren. However, his eldest son, Frank, was ex- statehood in 1850, Meadows filed his petition for title on cluded and contested the will. Feb. 10, 1853. Delays brought apprehension, and on April Negotiations dragged on, and when they were finally EICHORN 27, 1861, Meadows also claimed the land as a homestead. resolved in March 1905, the estate was valued at $700,000, From page 25A Finally, his patent, or title, was issued by the government and much of Meadows’ will was set aside. on Aug. 9, 1866. Meadows became a very successful The estate was immediately divided equally among rancher and leader. the children, and the ranch was chopped up and sold off, demic achievement. His thesis explored the lasting impact In 1858, his dedication to education led him to help accelerating an influx of new residents to Carmel Valley. of having a garden and concluded that it connects us to the establish the Carmelo School district, where he served as Thomas, the Meadows’ youngest and last living child, died earth and to ourselves, and to our cultural heritage via the a trustee for the rest of his life. He even had Matthew P. 35 years later. way we cook, share and eat. Smith of Ohio, an early teacher, live on the ranch. Loreta Neal Hotelling has been researching and writing about Enamored by Che Guevara’s memoir, “The Motorcycle learned to read and write and reportedly became a teacher. Monterey County history for more than three decades. His Diaries,” the college graduate went on a bus trip through Meadows also pushed the plan for building Carmel Val- email is [email protected]. South America and ended up in Brazil, where he spent a year studying music. During that time, he also visited 14 countries, absorbing their cultures. He came home fluent in Spanish and Portuguese. In 2010, Eichorn established a consulting company, “Grow Your Lunch,” committed to building educational gardening programs in public, private and charter schools, after-school programs, to help children learn to eat off the fat of the land.

You can go home again He also spent four years working as a garden educa- tor at Chef Alice Waters’ Edible Schoolyard in Berkeley. In 2015, he wrote a gardening handbook, which Waters championed. When Eichorn was ready to leave the city, he and his wife, Anastasia, moved to the family homestead in Palo Colorado, and he accepted the opportunity to take the THE RETURN OF THE helm at MEarth. “At MEarth and in life,” he said, “my job is to weave it all together under the umbrella of stewardship. We must be self-advocates for what we need, and give our kids the tools to do that, as well — to grow, cook, nourish and care for themselves, their community and the natural world that supports the human community.” In order to take care of the earth, he said, we have to BIG FALL learn to love it, ﬁrst. Know someone whose life of accomplishment or adven- ture would make interesting reading? Please suggest them for Great Lives by emailing [email protected]. SALE BIGGEST Be prepared for emergencies — register your This is the Sale of the Year! phone number at www.alertmontereycounty.org SALE NOW ENDS SUNDAY, NOVEMBER 3RD Harvest Fair SATURDAY, NOV. 9 20-75% OFF 9-3 Nursery-wide Everything is on Sale! Flowers, roses, trees, shrubs, deciduous fruit trees, soils, fertilizers, pottery and more. Discounts apply Only to Items Currently In-Stock. “Special Order” Items Excluded.

Ask about our Landscaping services.We provide professional design, custom masonry work, drainage, irrigation and much, much more... At Valley Hills We’ll Get You the Plants You Want and We’ll Get ’em In the Ground! Local vendors, License #877350 baked goods, craft and holiday gifts Valley Hills Nursery is the closest full-service nursery to Hot “German donuts” Carmel-by-the-Sea, Pebble Beach, Paciﬁc Grove and all of Monterey. Delivery available 7 days a week and lunch available Community Church Located just 3.5 miles off Hwy 1 on Carmel Valley Road 4590 Carmel Valley Road (831) 624-3482 • www.VHnursery.com (831) 624-8595 7440 Carmel Valley Rd., Carmel Valley 28A The Carmel Pine Cone November 1, 2019 November 1, 2019 The Carmel Pine Cone 29A

The Carmel Pine Cone Section 2 Early to bed, early to rise, and your water polo team can beat the other guys THERE’S A world out there that many of us rarely the first time. Someday, when they’ve got kids and grand- combined score of 80-23. see, populated by insomniac roosters, masochistic joggers, kids of their own, they’re likely to see this legacy as some- Then, on Sept. 12, the Pirates scored their biggest reg- sleepy milkmen and a gaggle of student-athletes who are thing that was worth rolling out of bed for. ular season victory ever, a 12-8 conquest of St. Ignatius expected to be on the deck of the swimming pool at Ste- “Our philosophy is to focus only on the game that’s di- College Prep, a tradition-rich West Catholic League power venson School at 5:45 a.m. for water polo practice. rectly in front of us, respect every opponent on our sched- The rest of us can only presume that it’s a rude awak- ule, and devise a game plan specifically for that opponent. ening to hit the water at that hour on chilly mornings, with We don’t take any game for granted,” said second-year the sunrise leaking through the trees in Del Monte Forest. coach Frank Reynolds, whose 2018 squad became the first Peninsula Sports But the Stevenson Pirates also must be sleeping well these in school history to win a CCS playoff game. days. Maintaining humility is undoubtedly harder than it By DENNIS TAYLOR sounds when you’re part of a team that routinely routs op- Worth setting the alarm clock ponents by scores like 17-2, 19-3, and 24-5. from San Francisco. As they get ready to play their regular season finale (5 Stevenson opened its season by outscoring four op- “We learned that night that if we prepare and train, p.m. Friday at Stevenson) against rival Carmel, the Pirates ponents 57-13 at the Pioneer Valley tournament in Santa we’re capable of taking it to any opponent,” Reynolds said. have the best record in school history — 20-1 — and real- Marina, and steamrolled its first four challengers in the “Our guys were really up for that game, and winning it was istic hopes of winning a Central Coast Section crown for Gabilan Division of the Pacific Coast Athletic League by a truly something historic for our program.” The emotional victory took place the night before they co-hosted the Pete Cutino Cup (named for UC Berkeley’s late, great, NCAA Hall of Fame coach, who was a Monterey resident).

A good teacher That’s when Stevenson lost for the ﬁrst and only time this year, 14-8 to Los Altos, a school that, at this writing, is 22-2 overall, and 12-0 in the De Anza Division of the Santa Clara Valley Athletic League. “We didn’t win, but we gave a really good opponent a real PHOTOS/FRANK REYNOLDS (LEFT), KERRY BELSER dogﬁght. I think we learned It’s 5:45 a.m. at Stevenson School (left) and the Pirates’ water polo some things against Los Altos team is practicing while other teams sleep. Second-year coach Frank about maintaining intensity af- Reynolds (above) has not only instituted a strict practice regiment, he’s guided the team to a 20-1 regular-season record. See SPORTS next page

HAVE YOU TURNED OFF YOUR IRRIGATION?

LET THE WEATHER DO YOUR WATERING During fall, leaves and temperatures begin to drop, reminding you that winter is just around the corner. This is the time to turn off your irrigation system and let the weather do the watering. Keep plants healthy and avoid overwatering – you’ll help conserve our precious natural resource and save money on your water bill.

WE KEEP LIFE FLOWING™ 30A The Carmel Pine Cone November 1, 2019 SPORTS From previous page ter a very tough game the night before, and what it takes to compete against an opponent with players who definitely will play at the collegiate level,” Reyn- olds said. Those are lessons Reynolds is clearly qualified to teach. He was a two-time All-American, and three-time all-state and all-league selection at Foothill High (Class of ’04) in Tustin, then played at the University of Southern California before finishing his career at UC Berkeley. PHOTO/?KERRY BELSER Reynolds scored a goal against USC Luca Bozzo (6) and Patrick Powers (9) are high-scoring juniors Coach Reynolds calls “thunder and lightning” for this year’s soaring Stevenson Pirates. as a sophomore in the 2006 NCAA championship match, went to the finals again that summer to the playoffs.) Powers and Bozzo, both juniors, are right-handed driv- with the Lamorinda club team, earning All-America hon- Since that September loss to Los Altos, Stevenson’s ers on this year’s team. ors, and was named co-captain of UC Berkeley’s squad in guys have gone 13-0, and their record may well land them “Those guys are like thunder and lightning for us — his junior year. The Bears, with Reynolds in the lineup, in the Open Division bracket with the best teams in the they bring non-stop energy,” Reynolds said. “Patrick is the were NCAA champions both years. Central Coast Section for the playoffs. If not, they’ll play fastest swimmer in school history, and he sparks our coun- in Division 2, based on their small-school enrollment. terattack. Luca is the brains of our offense — a very ce- Not overwhelmed Either way, they’re unlikely to feel overwhelmed. Four rebral player who is very meticulous about how he breaks That resume convinced Jim Fannin to step aside last players — Patrick Powers, Luca Bozzo, Jasper Dale, and down an opponent.” fall after 20 seasons as coach of Stevenson’s boys team Owen Monke — were on the team that beat Sobrato 14-7 and take over the girls program instead. (That, by the way, in the quarterfinals of the 2018 Division 2 tournament, Unstoppable is a separate success story: Stevenson’s girls also won the then lost 6-5 to West Catholic League powerhouse Arch- In the center of the lineup, quite literally, are the Dale PCAL’s Gabilan Division this season and also are headed bishop Mitty in the semifinals. brothers, both 6-foot-5 and well over 200 pounds, with experience playing in the U.S. National Team’s developmen- tal system. Wiley Dale, a freshman, is in the middle of the offense, nearly unstoppable when he gets the ball. Jasper, his sophomore brother, is a second-year defender assigned to contain the opponent’s best scorer. “Jasper is a vocal leader and a lock-down defender who I would put up against anybody in the state,” Reynolds said. “He really takes pride in running our defense.”

See MORE SPORTS page 36A

YOUR LOCAL SOURCE FOR LUXURY KITCHEN & BATH PRODUCTS 831-899-2525 575 Charles Ave. Seaside, CA 93955 ADMISSION EVENT Open Mon-Fri: 9AM-5PM and Sat: 10AM-3PM SAT, NOV 9 | 1 – 4 PM Pre-register: york.org/all-about-york www.delreysupply.com GRADES 8-12 | MONTEREY, CA | YORK.ORG PREPARED FOR COLLEGE AND FOR LIFE

TRINITY CHRISTIAN OPEN HOUSE GRADES 6-12

SATURDAY, DECEMBER 7th PROGRAM BEGINS AT 2:00PM

trinityhigh.org | 831-656-9434 680 BELDEN ST. MONTEREY

To advertise in our Food & Wine section Call Meena Lewellen 831-274-8665 [email protected] November 1, 2019 The Carmel Pine Cone 31A

We cordially invite you to our Open House

3#1" 7A-4@2&#",#1" 7A-4@2&&301" 7A-4@2& 0'" 7A-4@2&

carmelhearingaids.com IKR 32A The Carmel Pine Cone November 1, 2019 CARMEL • PEBBLE BEACH • CARMEL VALLEY & THE MONTEREY PENINSULA

Food & Wine Live Music, Galleries and Art This Week Clubs and Events

Duo kicks off music series at fairgrounds, soulful singer plays Sunset THE MONTEREY Cowboy Festival may be taking In 2012, Wilson released her first album, “AM/FM,” The show starts at 7 p.m. Tickets are $39 to $100. The the year off, but the group behind it is kicking off a new which paid tribute to the hits of the 1960s and 1970s. She site is located at 2004 Fairground Road. For more details, country music-themed concert series Saturday with a show followed it up three years later with her first record of orig- visit montereycowboy.org. by singer-songwriters Kristian Bush and Rita Wilson at the Monterey County fairgrounds. Fresh from the White House Bush is co-founder of the the Grammy Award-winning Q country duo, Sugarland, which has had five No. 1 coun- On a High Note A soulful singer-songwriter with bright future, Sheléa try hits, including “Settlin’,” “All I Want To Do” and “It performs Saturday at Sunset Center. Happens.” By CHRIS COUNTS When Stevie Wonder was invited to sing for the Pres- Wilson was an actress before she found success as a ident and Michelle Obama at the White House in 2012, musician, and her credits include “Sleepless in Seattle,” inal material, and this past March, she unveiled her fourth he asked that the young singer be added to the program. “Runaway Bride” and “It’s Complicated.” She also co-pro- album, which includes original music. Her performance generated a buzz, as did her 2013 debut duced, along with her husband, Tom Hanks, “My Big Fat After a one-year break, the Monterey Cowboy Festival Greek Wedding” and its sequel. plans to return next year. See MUSIC page 41A

Singer-songwriter Kristian Bush (left), who is best known for his work with the hit country music duo, Sugarland, performs with actress-turned-musician Rita Wilson (center) Nov. 2 at the Monterey County Fairgrounds. Singer-songwriter Sheléa (right) takes the stage the same evening at Sunset Center.

SUNSET PRESENTS 2019-2020

SHELÉA Natural Woman: A Night of Soul Saturday, November 2 at 8PM GIVING Quincy Jones protégé whose voice blends traditional pop, jazz, R&B and soul, to bring a contemporary edge to classics and a classic touch by Design to contemporary pop standards.

Experience SUNSET PRESENTS IN STUDIO 105 the up close & intimate NELLA atmosphere of Thursday, November 7 at 8PM Studio 105 at Sunset Center! Don’t miss Venezuelan singer and songwriter Nella, deemed “global Latin music for the 21st century” and who has just been nominated for a Latin Grammy in the “Best New Artist” category!

Limited The Strings/Keys Incident: tickets still An Evening With Joanna Newsom available! Read his story: JMTJVVYN)PSS;`SLY Friday, November 22 at 8PM A rare and intimate performance by the multi-instrumentalist and “The Community Foundation is a design studio for singer-songwriter alone: solo voice, harp and piano. philanthropy that invites you to pull up a chair at the table. You would be simply amazed at the possibilities.” —Bill Tyler, The William H. and Susanne Tyler Pathway Fund The Second City The Good, The Bad & Design your philanthropic vision. We can help. The Ugly Sweater Saturday, November 30 at 8PM +VUVY(K]PZLK-\UKZ࠮*OHYP[HISL,Z[H[L7SHUUPUN*.(Z*9;Z Laugh along as improv comedy’s 09(*OHYP[HISL+PZ[YPI\[PVUZ࠮-HTPS`7OPSHU[OYVW` best and brightest roast the chestnutschestnuts outtaoutta allall thethe thingsthings wewe :JOVSHYZOPWZ 4VYL lovingly loathe about the holidays!holidays!

Brought to you by Sunset Cultural Center, Inc., a nonprofit 501(c)(3) For event details and to purchase tickets: www.sunsetcenter.org • 831.620.2048 831.375.9712 | JMTJVVYN | San Carlos Street at Ninth Avenue • Carmel-by-the-Sea November 1, 2019 The Carmel Pine Cone 33A FOOD & WINE CCVNA.COM/SPEAKERSERIES Big Sur Food & Wine tickets going fast, food bank fun(ds), and Delivering C.V. Coffee Roasting turns 25 Professional Care, Trusted Compassion You Deserve THE BIG Sur Food & Wine Festival, of Cultura, 7D Steakhouse executive chef which each year raises tens of thousands of Tom Snyder, head Bernardus Lodge chef dollars for Big Sur charities, returns Nov. Cal Stamenov, Brad Briske from Home, FOUR-PART LUNCHEON 7-9 with a full lineup of wine tastings, din- Salt Wood executive chef Paul Corsentino ners, parties and other culinary adventures. (who formerly worked at Ventana), Alta Some of the festival’s quirkier events, like Bakery’s Ben Spungin, Rio Grill exec chef SPEAKER SERIES the Magical Mystery Tour and Hiking with Eduardo Coronel, chef Eric Piacentine Stemware, are already sold out, but there’s from Big Sur Bakery, Michelin-starred plenty left on the schedule to enjoy down chef Justin Cogley from Aubergine, as well the coast. as baker and pastry chef Ron Mendoza, DISCUSSION TOPIC chef Nadiv Geiger from Testarossa Winery, Thursday night start Cheese Shop Carmel owner Kent Torrey, BEGIN WITH THE END IN MIND: Ventana Big Sur will host the lavish and Black River Caviar’s Graham Gaspard. UNDERSTANDING ESTATE PLANNING Opening Night celebration Nov. 7 from 6 Tickets are $175 per person, with shuttle to 9 p.m., with more than a dozen chefs and rides to and from Carmel available for an LIZA D. HORVATH, CTFA, PLF purveyors partnered with some two dozen additional $35. champagne and wine producers, all com- Tuesday, November 5th plemented by live music and a stunning Fun Friday 11:30AM – 1:30PM setting. Friday will be a busy day at the Big Sur Guests can expect delicious small bites festival, starting with a tasting of Tablas Tarpy’s Vintner Rooms from Roux restaurant chef/owner Fabrice Creek wines at Ventana at 10 a.m. For $50 999 Monterey Salinas Hwy Roux, Carmel Valley Ranch executive chef Event is Complimentary Tim Wood, executive chef Michelle Estigoy Continues next page and includes Lunch.

Wine & Swine, held at the Henry Miller Library, has become Big Sur Food & ABOUT THE SPEAKER Wine’s signature Monterey Trust Management, Private Client Services Founder and CEO event, complete with not just plenty of food Professional Licensed Fiduciary Firm accepting appointment as Trustee, and wine, but danc- Executor, Administrator or Trust Protector. Also serving as a multi-family ing, performances, office for a handful of families holding multi-generational trusts, complex and general frivolity businesses or property structures and investments of signiﬁcant value. all around.

RSVP today! Contact Tina Del Piero at (831) 648-3734.

SAVOR THE LOCAL SCENE

MONDAY & TUESDAY AT EDGAR’S RESTAURANT $8 till 8pm Happy Hour with Live Music 7 - 10 NOV WEDNESDAY Date Night Special $15 Brick Oven Pizza $5 Draft Beer & $10 Select Wines 5pm–7pm

SATURDAYS & SUNDAYS Champagne Brunch and Live Music

BEER, SAUSAGE, CHEESE, PROST! What more can you ask for?

Where: Edgar’s Restaurant When: November 7 through November 10 Time: 5:00 to 9:00pm daily

:ŽŝŶƵƐĨŽƌŝĐĞĐŽůĚďĞĞƌƐĂŶĚƚƌĂĚŝƟŽŶĂů'ĞƌŵĂŶͲŝŶƐƉŝƌĞĚŵĞŶƵŝƚĞŵƐ͘ 831.658.3400 ZĞƐĞƌǀĂƟŽŶƐƌĞƋƵŝƌĞĚĨŽƌĚŝŶŝŶŐ͘WůĞĂƐĞǀŝƐŝƚƋƵĂŝůůŽĚŐĞ͘ĐŽŵͬĞĚŐĂƌƐ͘ 415 West Carmel Valley Road BernardusLodge.com EDGARS RESTAURANT t 8000 VALLEY GREENS DRIVE t CARMEL, CALIFORNIA 34A The Carmel Pine Cone November 1, 2019 FOOD & WINE

From previous page The $200-per-person dinner will feature chef Virginia Willis from Culinary Enter- per person, guests will enjoy a lineup of prises, chef William Dissen from Market coveted Tablas Creek’s flagship mourve- Place Restaurant, chef Morgan L’Esper- dre-based Chateauneuf-du-Pape-inspired ance of Costanoa, Big Sur Lodge’s Rick red blend, starting with the first vintage in Sahagun, and baker/pastry chef Ron Men- 1997. doza. Located in Paso Robles, Tablas Creek Also that evening, Deetjen’s Big Sur was born 30 years ago through a de- Inn will host a winemaker dinner for the cades-long friendship between two signif- festival, this one focusing on the Pioneers icant wine families, the Perrins of Chateau of Santa Barbara, with seatings at 5:30 and de Beaucastel in France and the Haas fam- 8:30 p.m. ily of Vineyard Brands. After searching Similar to Monterey County, Santa Bar- all over California for limestone soils and bara valleys run east to west, allowing cool a Mediterranean climate, they bought a ocean breezes to drift into hot inland areas 120-acre parcel a dozen miles inland from in the afternoon, making it an exceptional the Pacific, imported cuttings from their area for cultivating varietals like pinot noir French estate, and planted their biodynam- and chardonnay, and Rhone grapes like ic vineyard. syrah and grenache. Executive chef Renee Tablas Creek is credited with helping Esperanza is creating a menu to match the 50% off Appetizers, $3.50 Beers, $6 Wine & Cocktails start this country’s “Rhone Rangers” wine evening’s impressive lineup. Reservations movement and putting Paso Robles on the should be made directly with the restaurant map as a wine region. Second-generation by calling (831) 667-2378. (SUN, TUES - THURS 4:30-6PM) $24.95 proprietor Jason Haas will present the tasting, which will span two decades, from the Saturday starts with brunch first bottling to the recently released 2017 The new Village Big Sur next to the Esprit de Tablas. River Inn just added a Big Sur Food & That afternoon from noon to 3 p.m., Wine Festival event. The Bubbly Disco the beautiful chef’s garden at Sierra Mar Brunch will cost $100 per person, and at the Post Ranch Inn will host the Pinot while the 9:30 a.m. seating is already sold Walkabout, a popular exploration of this out, spots are available at 11:30 a.m. and region’s spectacular pinots from 20 pro- 1:30 p.m. Chef A.J. Beatty is planning a ducers paired with bites from a half-dozen five-course organic brunch to pair with lo- local chefs. The cost is $150 per person. cal sparkling wines. The vibe will be creat- And in the evening, from 6 to 10 p.m., ed by Big Sur’s Milky Way Radio featuring A Dinner in Sustainability at the Big Sur Nico Georis, DJ wax-by-the-sea and Two Lodge will be prepared in collaboration Mandy DJs. with the Monterey Bay Aquarium in rec- The weekend’s popular bash, Wine & ognition of its longstanding contribution Swine at the Henry Miller Library, will run to sustainable seafood and helping people from 6 to 10 p.m. and is described as “a avoid fish that is in declining supply or should not be consumed for other reasons. Continues next page

Opening Night of Big SCOTCH DINNER Sur Food & Wine, held at the stunning Ventana inn, offers the perfect way to kick off a weekend of eating, drinking and reveling amid the splendors of one of the most beautiful places in the world.

PHOTO/THE DELAURAS

THURSDAY | NOVEMBER 7, 2019 | 6PM OPEN FIRST COURSE AT dƌĂĚŝƟŽŶĂů͞tŚŝƚĞWƵĚĚŝŶŐ͟ 12 Year Double Cask 11AM SECOND COURSE ^ĐŽƚĐŚŐŐ 15 Year Triple Cask THIRD COURSE tŝůĚ^ĐŽƫƐŚ'ĂŵĞŝƌĚƐ Rare Cask FOURTH COURSE WůĞĂƐĂŶƚZŝĚŐĞZĞƐĞƌǀĞΘDŝŵŽůĞƩĞŚĞĞƐĞƐ 18 Year

INSIDE THE CLUB ROOM AT THE PORTOLA HOTEL & SPA $125 per person Tax and gratuity included ZĞƐĞƌǀĂƟŽŶƐĂƌĞƌĞƋƵŝƌĞĚͮComplimentary self or valet parking Fresh Seafood, Fresh Pasta W>^>>ΈϴϯϭΉϲϰϵͳϳϴϳϰdKZ^ZszKhZ^d FOOD | SERVICE | ATMOSPHERE | WE HAVE IT ALL

47 Old Fisherman’s Wharf #1 Monterey • www.cafeﬁna.com dtKWKZdK>W>ͮDKEdZz͕ϵϯϵϰϬͮWKZdK>,Kd>͘KD 831-372-5200 November 1, 2019 The Carmel Pine Cone 35A FOOD & WINE

From previous page Big Sur Fiddle Camp, Stage Kids, Ventana challenges Ryan Feliciano from Cibo. The ley Coffee Roasting Company’s 20th anni- Wilderness Society, the Weston Call Big contestants will first make a cocktail that versary. rock-and-roll, no-holds-barred, let-your- Sur Fund and Big Sur Softball also re- must contain Belvedere vodka and a secret Through the end of the year, customers hair-down-and-bring-your-dancing-shoes ceived gifts. ingredient, and will then undertake a skills who purchase a 12-ounce bag of the An- party,” with special live musical guests and To learn more about everything, go to challenge — seeing who can cut citrus the niversary Blend will get a free 12-ounce plenty of porky treats, with wines to match. www.bigsurfoodandwine.org. Tickets for fastest — before presenting a second cock- coffee. Talented chefs and purveyors signed the fest are available through Eventbrite. tail entirely of their own creation, with no In addition, on the 25th of November on for Wine & Swine include Tony Bak- com. restrictions on ingredients. and December, refills will be 25 cents for er (Montrio), Jamie Collins (Serendipity Guests vote for their favorites, as do people hanging out at any of their shops at Farms), Percival Lammie (Percival’s Pies), QMPC Foundation the four judges, and in the case of a tie, the mid-valley, the Crossroads, the Barnyard, Jonathan Roberts (PigWizard), Chris Watts scholarship dinner competitors do another skills challenge. If Ocean Avenue, Lighthouse Avenue in Pa- (Carmel Valley Ranch), Danny Leach they are still tied, they make a cocktail on cific Grove, and Fremont and Broadway in (Folktale), Terry Teplitzky (Michael’s Ca- The Monterey Peninsula College Foun- the fly for the judges, who have the final Seaside. Finally, from Nov. 25 to Dec. 25, tering), Todd Spanier (California Truffle dation will present its 3rd Annual Evening say at that point. $25 gift cards will be sold for $20 apiece. Orchards), Erika Neargarder (Julia’s Veg- Opportunity Gala, “Sea of Dreams,” at the Tickets are $20 through Eventbrite.com Carmel Valley Coffee Roasting Co. etarian Restaurant) and Jerry Regester Monterey Plaza Hotel on Cannery Row and include tastes and entertainment. Ad- is family-owned and operated by the (Monterey Plaza Hotel). Nov. 2 at 5 p.m., with the goal of “rais- ditional drinks and food will be available McAthies, who acquired the business from Tickets are $125 per person, plus $35 ing dollars for scholars and making stu- for purchase. founders Barbara and Dick Ely, who served for the mandatory shuttle ride to and from dents’ dreams come true.” Tickets are $250 on Carmel’s city council, in 2001. The Rio Road in Carmel. There is no parking apiece. QHappy 25th, C.V. Coffee! company’s coffee roasting facility is lo- near the library this year. The menu planned for the evening in- cated at Mid Valley Shopping Center. The The informal finale of the festival is cludes baby spinach salad with feta and In celebration of their company’s 25th McAthies also own and serve their coffee Bennies and Bubbles at Deetjen’s, a place toasted pecans, followed by entrée choices anniversary, Dean and Janet McAthie are at East Village Coffee House in downtown famous for its spectacular Eggs Benedict, of braised short ribs and ricotta gnocchi offering special deals on beans, refills and Monterey. on Nov. 10 from 8 a.m. onward. No reser- with cauliflower gratin, onion-crusted sea- gift cards, and have resurrected the lim- vations are needed — though there might bass with fingerling potatoes and seasonal ited-edition Organic Anniversary Blend. QFirst Night lunch be a wait if you dillydally. vegetables, or porcini mushroom risot- Created by longtime wholesale director to with grilled asparagus and red quinoa. Tina Muia and roaster Rory Phares, the The Carmel Valley Women’s Club’s Making a difference Dessert will be Valrhona triple chocolate anniversary blend includes organic coffees monthly lunch will feature Ellen Martin, The Big Sur Food and Wine Festival is mousse cake. For tickets and information, from Colombia, Sumatra and Mexico. The a nonprofit created to support to the Big go to mpcfoundation.org. duo first created the blend for Carmel Val- See FOOD page 37A Sur community. Grants from last year’s festival totaled $80,000, including $16,500 7D cocktail competition each for the Big Sur Volunteer Fire Brigade Q and the Big Sur Health Center, $10,000 for The second round of Seventh & Dolores Henry Miller Library, and $6,000 each for Steakhouse’s Mixology Throwdown will be Mid Coast Fire, Apple Pie preschool and held Nov. 4 at 8 p.m., when bartender Lind- the Big Sur Park school. Big Sur Grange, sey Greblo from the Monterey Plaza Hotel

The Carmel Valley Cof- fee Roasting Company opened its Seaside location in 2015, bringing its number of locations to a half-dozen, with shops in Carmel Valley, Carmel, Paciﬁc Grove and Mon- terey, too. The company is celebrating its 25th anniversary this year.

SELFIEVILLE • MONTEREY’S NEWEST INTERACTIVE ATTRACTION OPEN 11-4PM 'DWHVYDU\SOHDVHFKHFNZZZVHOƓHYLOOHFRPIRUFRPSOHWHGHWDLOV

MOSCOW BALLET’S GREAT RUSSIAN NUTCRACKER NOVEMBER 9 • 3:00 & 7:00 PM

THE ROBERT CRAY BAND NOVEMBER 15 • 8:00 PM

AN EVENING WITH BRUCE COCKBURN NOVEMBER 23 • 8:00 PM

AN IRISH CHRISTMAS NOVEMBER 29 • 8:00 PM

CHAMPIONS OF MAGIC • DECEMBER 2 • 7:30 PM (((FolkYEAH!))) PRESENTS PINK MARTINI • DECEMBER 3 • 8:00 PM MARY CHAPIN CARPENTER & SHAWN COLVIN • DECEMBER 7 • 8:00 PM CHRIS ISAAK CHRISTMAS SHOW • DECEMBER 12 • 8:00 PM BLIND BOYS OF ALABAMA CHRISTMAS SHOW FEATURING DELICIOUS POURED DAILY NICKI BLUHM PRESENTED BY SBL ENTERTAINMENT • DECEMBER 17 • 7:30 PM SEBASTIAN MANISCALCO: YOU BOTHER ME • JANUARY 18 • 7:00 & 9:30 PM Taste for yourself THE DOO WOP PROJECT PRESENTED BY SBL ENTERTAINMENT • FEBRUARY 23 • 7:00 PM Carmel-by-the-Sea Estate Winery KATHLEEN MADIGAN: 8 O’CLOCK HAPPY HOUR • APRIL 16 • 8:00 PM San Carlos & 7th • 831.626.WINE (9463) 1972 Hobson Ave., Greenfield • 831.386.0316 Golden State Theatre Pouring from 12 noon Daily Pouring from 11 am Daily Downtown Monterey SCHEIDVINEYARDS.COM (831) 649-1070 GoldenStateTheatre.com 36A The Carmel Pine Cone November 1, 2019

team won its first league title since 1997. MORE SPORTS Stevenson’s football team currently is tied for second From page 30A place in the Santa Lucia Division of the PCAL. INE Battle-tested Padres W The other side of the offense is patrolled by Tristan Ev- Q ans, an explosive freshman, and Daniel Meyer, the team’s Carmel’s football team flogged San Benito 41-14 on TASTING senior leader. Both are strong-armed lefties. Saturday, which levels the Padres’ record at 3-3 in the bru- And Reynolds feels blessed to have two sophomore tal Gabilan Division of the PCAL this season. San Benito goalkeepers: Owen Monke, who was in the cage for last previously was unbeaten in the division. MONTEREY year’s playoff victory, and Luca Zaninovich. Carmel leads all Gabilan teams in yards gained, averag- “Both guys have an incredibly competitive spirit, and ing 490 per game, and the Padres scoring average (39.9 per they make each other better every day in practice,” the game) ranks second to Salinas (46.3). Open Monday - Friday: 2pm-9pm coach said. Benicio Cristofalo leads the PCAL in receiving (1,033 Saturday - Sunday: 12pm-9pm “Our strength is that we have talent across the board, yards on 48 receptions, 8 TDs). Dakota Mornhinweg is the but we don’t rely on one player to carry us. Any number of PCAL’s second-leading rusher (835 yards on 132 carries, Come in and blend your own wine! players could step up in any given game,” Reynolds said. 17 TDs), and quarterback Kai Lee is the second leading 381 Cannery Row | Monterey “They’re a very cohesive unit, and they’re really looking passer (121 completions on 175 attempts, 1,880 yards, 14 (831) 324-4974 | wineexperience.org like a team that is poised for the playoffs.” touchdowns, no interceptions.) CCS boys water polo playoffs are scheduled Nov. 9 The Padres, 5-4 overall, have one division game re- CARMEL (quarterfinals at home sites), Nov. 12 or 13 (semifinals maining against Everett Alvarez at 2 p.m. Nov. 9 at home. at home sites), and Nov. 16 (finals at Independence High This week’s scheduled game with Gilroy was cancelled School in San Jose). when the Mustangs forfeited their final six games of the year after multiple players were accused of sexual assault. QSuccessful fall season for Pirates QLooking ahead (Nov. 1-7) Sunday-Thursday: 12-6pm Friday-Saturday: 12-7pm In addition to the girls and boys water polo teams, Ste- venson athletes clinched division or league championships Cross country — Saturday: Pacific Coast Athletic SW Corner of 7th & San Carlos, Hampton Court | 831-601-8761 this season in girls golf and field hockey. The field hockey League Championships, Toro Park (TBA). Field hockey — Monday: Central Coast Section play- Dolores btwn Ocean & 7th offs, first round (3 p.m., site TBA). Wednesday: Central 831-624-3800 Coast Section playoffs, second round (3 p.m., site of high- Baum & Blume er seed). - OPEN - Football — Friday: Stevenson at St. Francis SCP (7:30 Mon-Wed 12pm-6pm Cordially Invites You To… CLASSIC.CLASSIC. RREAL.EAL. AMAMERICAN.MERICANERICAN. p.m.). Thurs-Sun 12pm-7pm “Of Artistry and Angels” Girls golf — Monday: CIF NorCal Regional Champi- onships, El Macero Country Club (TBA). Located on the ground floor of the THEIR ϱϮÄANNUAL Girls tennis — Monday: PCAL Gabilan Division In- Carmel Plaza at the corner of LightingLiihtght of the Tannenbaumbaum dividual Tournament at Chamisal Tennis Club (12-5 p.m.). Ocean Ave. & Mission St. Tuesday: PCAL Gabilan Division Individual Tournament 831-620-1909 and Holiday Open House at Chamisal (1-5 p.m.). wrathwines.com ^ã͘Ä^çÄ͘EÊò͘ϵ^ã͘Ä ã«ÄϭϬã«ϭϭÃ͚ã®½ϳÖÃ͚ã®½ϳÖÃ Girls volleyball — Saturday: Central Coast Section Di- Mon-Sat 11 to 6pm & Sun 11 to 5pm vision 4 first round (7 p.m. at site of higher seed). Tuesday: Holidayy SShopping that Celebrates Spirit & Inspiration!spirationp ! Central Coast Section quarterfinals (7 p.m. at site of higher UnderUnder a canopyc of purple & gold, hear the rustle ooff aangelngel wingswin and discover our collection off curated seed). Thursday: Central Coast Section semifinals (5 and ggoodsoods by talented artists from near AND far!! GiGiftsfts fforor 7:30 p.m., Notre Dame-Belmont). bbabes,abes, millennials,mi campers & cat lovers too!oo! Italian Boys water polo — Friday: Carmel at Stevenson (5 ffashions,ashions, books, wine, puzzles, & ANGELS! GGiftsifts with p.m.). bothboth a storyst and a purpose will make yourr holidayholiday Girls water polo — Central Coast Section play-in SAN CARLOS & 7TH | 831.626.WINE (9463) shoppingshopping delightful and meaningful! game (site and time TBA). POURING FROM 12 NOON DAILY | SCHEIDVINEYARDS.COM Dennis Taylor is a freelance writer in Monterey County. dŚĞĞƐƚ,ŽůŝĚĂǇ^ŚŽƉƉŝŶŐ͊ΕDĞĞƚ>ŽĐĂůƌƟƐƚƐ͊dŚĞĞƐƚ ůƌƟƐƚƐ͊ Contact him at [email protected]. NOW OPEN UNTIL 8:00 PM tŝŶĞdĂƐƟŶŐƐďǇsŝŶƚŶĞƌƐĨƌŽŵĂŶĚWŽƌƚƵŐĂůtŝŶĞdĂ WŽƌƚƵŐĂů EVERY EVENING!!! ,ŽƵƐĞŵĂĚĞƉƉĞƟǌĞƌƐΘ^ĂŵƉůŝŶŐƐĂůůĂǇ,ŽƵƐĞ ůůĂǇ AWARD WINNING WINES >ŝǀĞDƵƐŝĐďǇ>>ŝǀĞDƵ Ghassan andAmy Novak Warren DOG FRIENDLY ŚĞĨĞŵŽ͗ƵĐŬWƌŽƐĐŝƵƩŽΘĂ͞^ƉŝƌŝƚĞĚ͟dĂƐƟŶŐŚĞĨĞŵ ͟dĂƐƟŶŐ AMPLE SEATING The Pine Cone’s email edition: th WůƵƐ͗ƌƟƐĂŶ&ƌƵŝƚĐĂŬĞƐ͕ĂĐŽŶ:Ăŵ͕Wů ŵ͕ 831.622.9704 | Mission 3 SE of 5 , Carmel-by-the-Sea Complete local news without Mon - Thurs 2pm - 8pm | Fri - Sun 12 - 8pm | Happy Hour 4:30-6:30 ŚƵƚŶĞǇΘDŽƌĞ pop-ups, click bait, pay walls or banner ads — ~ Baum & Blume ~ Windy Oaks ~ Carmel and we don’t even harvest your data. ĆēĉčĊĆėėĎĆČĊ ĔĚĘĊ Subscribe at www.carmelpinecone.com Lincoln & Ocean NW corner, Ͷǡ across from the Library 659-0400 Fri & Sat, noon to 7pm; Sun-Thur, noon to 6pm 831-574-3135 • www.windyoaksestate.com

169 Crossroads Blvd, Carmel 831-626-6268 | Open Tuesday - Sunday 11 am to 6 pm

Dawn’s Dream Corner of 7th & San Carlos 831-659-2649 OPEN DAILY Mon-Wed 12pm-6pm Thurs-Sun 12-7pm

On DoloresDo St. between Ocean & 6th www.albatrossridge.com 831-293-8896

Showcasing Exceptional Wines Daily Starting at Noon

CARMEL VALLEY

Windy Oaks ~ Carmel Valley 19 East Carmel Valley Road Open Daily 11:30am-5:30pm 831-298-7083 www.windyoaksestate.com

BERNARDUS

5 West Carmel Valley Road | 831-298-8021 Open Daily 11am - 5pm November 1, 2019 The Carmel Pine Cone 37A The Macallan Dinner Room at the Portola Hotel in Monterey Nov. 7 at 6 p.m. FOOD Q Barley farmers in Scotland’s Speyside region had been From page 35A One of Scotland’s most important whiskies, The Ma- callan, will be featured during a special dinner in The Club See MORE FOOD page 40A executive director of First Night Monterey, at Gardener Ranch Nov. 6 from 11:30 a.m. to 1:30 p.m. Guests will The Mediterranean get the scoop on the big 250th anniversary of the founding On Silversea’s 388 passenger of Monterey, since First Night will kick off the yearlong Silver Shadow — 12 days visiting MAUDE celebration on Dec. 31. Lunch costs $45 per person and Barcelona, Marseille, St. Tropez, Hey there, my name is Maude. will include a buffet of Asian chicken salad, bay shrimp Tuscany, Rome, Sorrento, Taormina, I’m a mellow 9-year-old girl pasta salad with cucumbers and dill, Greek salad with pita Sicily, Brindisi and Venice! who loves taking cat naps, bread and hummus, grilled vegetables, brownie bites and Transportation sitting in windowsills and lemon bars. May 1-14, 2020 from the Monterey being brushed. I was found Peninsula included! Tickets must be purchased in advance online at cvwom- wandering the streets, ended ensclub.org or by calling (831) 624-3081. Gardener Ranch up at a shelter and although is located on Carmel Valley Road near the intersection I was microchipped no one with Ford Road. claimed me. So I became homeless. Now I’m in a Golden Oldies foster home waiting for Tarpy’s annual benefit a new forever family. Q All Golden Oldies cats are spayed/ Tarpy’s annual Food & Fun-draiser for the Food Bank GROUP SPECIAL! Maybe that’s you? neutered and current on medical. for Monterey County will take place from 11:30 a.m. to $500 SHIPBOARD CREDIT PER SUITE! Call Golden Oldies at 831-200-9700 2:30 p.m. Nov. 3, with small bites, wine from Joyce, Spicy Enjoy sailing on the small luxury Silver Shadow with butler service, wines and spirits, unlimited WiFi and gratuities all included! if you would like to meet Maude. Vines, Cima Collina, Zonin, Michael David, Scheid, Car- mel Road and DeTierra, and live music by Grove Acres, Prices start at $5,870 and include coach airfare from SFO! (per person based on double occupancy) along with lots of prizes. Tickets are $50 per person, all Ad sponsored of which benefits the food bank, and can be purchased by Alan and Anneli – PACIFIC GROVE TRAVEL – Rosenthal in memory through Eventbite.com. 593 Lighthouse Avenue, Pacific Grove, CA 93950 of Amber The restaurant is located on Highway 68 at Canyon Del Fares, Taxes, Fees & Port Taxes of $190.00 are included & subject to www.gocatrescue.org (831) 373-0631change. © 2019 Princess Cruises, Ships of Bermudan & British Registry Rey. Call (831) 647-1444 or visit tarpys.com for more in- If you would like to sponsor our next ad give us a call at 831-200-9700 formation. CST# 1003488-10 pgtravel.com | Call or come in to learn more

MUSICAL EXCELLENCE SINCE 1927 An address by the

INCORPORATING THE MOZART SOCIETY Honorable Richard V. Spencer, 93season SUNDAY Secretary of the Navy NOVEMBER 10, 2019 PIONEERING PUBLIC-PRIVATE SOLUTIONS FOR Modigliani INTERNATIONAL SECURITY CHALLENGES String Quartet Free and open to the public Including music by Mozart, Mendelssohn, Brahms. Saturday, November 16, 2019, 7:00 p.m. Single tickets are $45, Call about $10 adult seats $53, and $60 and can with free K-12 Naval Postgraduate School, King Hall be purchased online at Discounted Register to attend by November 8 carmelmusic.org, by subscriptions at calling 831.625.9938 3PM • SUNSET CENTER $204, $240 or $272 go.miis.edu/miisnps or at the box office are available by calling before the concert. 831.625.9938

With support from the Monterey CountyBoard of Supervisors

JOINTLY SPONSORED BY THE MIDDLEBURY INSTITUTE OF Get your complete Pine Cone every Thursday night by email — INTERNATIONAL STUDIES AND THE NAVAL POSTGRADUATE SCHOOL free subscriptions at www.carmelpinecone.com 38A The Carmel Pine Cone November 1, 2019 PUBLIC NOTICES FICTITIOUS BUSINESS 10/11, 10/18, 10/25, 11/1/19 Statement generally expires at the end of California law. declares as true information, which he or Sections 6250-6277). NAME STATEMENT CNS-3301867# five years from the date on which it was she knows to be false, is guilty of a misde- This statement was filed with the County File No. 20192069 You may examine the file kept CARMEL PINE CONE filed in the office of the County Clerk, by the court. If you are a person in- meanor punishable by a fine not to exceed Clerk of Monterey County on Sept. 24, The following person(s) is(are) doing busi- Publication dates: October 11, 18, 25, except, as provided in Subdivision (b) of terested in the estate, you may file with one thousand dollars ($1,000) (B&P Code 2019. ness as: Nov. 1, 2019. (PC1011) Section 17920, where it expires 40 days 17913). NOTICE-In accordance with Subdivision the court a Request for Special Notice I am also aware that all Infor- (a) of Section 17920, a Fictitious Name Almalose, 27875 Berwick Drive, Suite after any change in the facts set forth in the mation on this statement becomes Public A, Carmel, CA 93923, County of Mon- statement pursuant to Section 17913 other (form DE-154) of the filing of an inven- Statement generally expires at the end of terey tory and appraisal of estate assets or of Record upon filing pursuant to the Cal- five years from the date on which it was Registered Owner(s): FICTITIOUS BUSINESS than a change in the residence address of ifornia Public Records Act (Government NAME STATEMENT a registered owner. A new Fictitious Busi- any petition or account as provided in filed in the office of the County Clerk, NutJobs, Inc. 27875 Berwick Drive, Suite File No. 20192047 Code Sections 6250-6277). except, as provided in Subdivision (b) of A, Carmel, CA 93923; DE ness Name Statement must be filed before Probate Code section 1250. A Request This statement was filed with the County The following person(s) is(are) doing busi- form is available Section 17920, where it expires 40 days This business is conducted by a corpora- ness as: the expiration. The filing of this statement for Special Notice Clerk of Monterey County on Sept. 20, after any change in the facts set forth in tion does not of itself authorize the use in this from the court clerk. 2019 the statement pursuant to Section 17913 Registrant commenced to transact business CVS/pharmacy #9612, 6 The Cross- roads, Carmel, CA 93923, County of state of a Fictitious Business Name in viola- Attorney for Petitioner: NOTICE-In accordance with Subdivision other than a change in the residence under the fictitious business name listed Monterey tion of the rights of another under Federal, Anne D. McGowan, Esq. (a) of Section 17920, a Fictitious Name address of a registered owner. A new above on June 11, 2019 Mailing Address: One CVS Drive, Woon- State, or common law (See Section 14411 Stewart, Green & McGowan Statement generally expires at the end of Fictitious Business Name Statement must S/ Paul Sunshine, President socket, RI 02895 et seq., Business and Professions Code). five years from the date on which it was be filed before the expiration. The filing of This statement was filed with the County 26415 Carmel Rancho Blvd., Registered Owner(s): Filing type: ORIGINAL FILING Suite A filed in the office of the County Clerk, this statement does not of itself authorize Clerk of Monterey County on September Longs Drug Stores California, L.L.C., One Publication dates: Oct. 11, 18, 25, Nov. 1, except, as provided in Subdivision (b) of the use in this state of a Fictitious Business 25, 2019 CVS Drive, Woonsocket, RI 02895; Cali- Carmel, CA 93923 Name in violation of the rights of another 10/11, 10/18, 10/25, 11/1/19 2019. (PC1017) Section 17920, where it expires 40 days fornia (831) 624-6473 after any change in the facts set forth in the under Federal, State, or common law CNS-3272068# This business is conducted by A Limited This statement was filed by Superi- (See Section 14411 et seq., Business and CARMEL PINE CONE Liability Company statement pursuant to Section 17913 other Publication dates: Oct. 11, 18, 25, Nov. 1, or Court of California, County of Mon- than a change in the residence address of Professions Code). Registrant commenced to transact business FICTITIOUS BUSINESS terey on October 9, 2019. Filing type: ORIGINAL FILING 2019. (PC1005) under the fictitious business name listed NAME STATEMENT a registered owner. A new Fictitious Busi- Publication dates: Oct. 18, 25, Nov. 1, 8, above on 10/20/2008 File No. 20192157 Publication dates: October 18, 25, ness Name Statement must be filed before 2019. (PC1030) S/ Melanie K. Luker, Secretary The following person(s) is(are) doing Nov. 1, 2019. (PC1021) the expiration. The filing of this statement FICTITIOUS BUSINESS This statement was filed with the County business as: PACIFIC BIOLOGICAL does not of itself authorize the use in this NAME STATEMENT Clerk of Monterey County on September LABS, 54 Country Club Dr., Carmel state of a Fictitious Business Name in viola- File No. 20192038 20, 2019 Valley, CA 93924. FICTITIOUS BUSINESS tion of the rights of another under Federal, STATEMENT OF ABANDONMENT The following person(s) is(are) doing busi- 10/11, 10/18, 10/25, 11/1/19 County of Principal Place of Business: NAME STATEMENT OF USE OF FICTITIOUS ness as: File No. 20192092 State, or common law (See Section 14411 BUSINESS NAME CNS-3301876# MONTEREY. et seq., Business and Professions Code). File No. 20192149 CVS/pharmacy #9802, 2170 Fremont CARMEL PINE CONE Registered Owner(s): The following person(s) is(are) doing busi- St, Monterey, CA 93940, County of RANDAL CURTIS JOHNSON, 54 ness as: Filing type: ORIGINAL FILING The following person(s) has (have) aban- Monterey Publication dates: October 11, 18, 25, Publication dates: Oct. 18, 25, Nov. 1, 8, doned the use of the fictitious business Nov. 1, 2019. (PC1012) Country Club Dr., Carmel Valley, CA ACS Salinas, 2336 N. Main St., Suite C, name: Mailing Address: One CVS Drive, Woon- 93924. Salinas, CA93906, County of Monterey 2019. (PC1026) California Rehabilitation & socket, RI 02895 This business is conducted by an Registered Owner(s): Sports Therapy, 2000 Garden Rd, Registered Owner(s): individual. Gary Omori, 2336 N. Main St., Suite C, Monterey, CA 93940, County of Mon- Longs Drug Stores California, L.L.C., One FICTITIOUS BUSINESS The registrant commenced to transact Salinas, CA 93906 terey CVS Drive, Woonsocket, RI 02895; Cali- NAME STATEMENT This business is conducted by an Individual FICTITIOUS BUSINESS The fictitious business name referred to File No. 20192042 business under the fictitious business name NAME STATEMENT above was filed in the County Clerk’s of- fornia or names listed above on N/A. Registrant commenced to transact business File No. 20192143 This business is conducted by A Limited The following person(s) is(are) doing busi- under the fictitious business name listed fice in Monterey County on September 6, ness as: S/Randal Curtis Johnson The following person(s) is(are) doing 2019 Current File No. 20191940 Liability Company Oct. 9, 2019 above on N/A business as: Registrant commenced to transact business CVS/pharmacy #1300, 662 E Boronda S/ Gary Omori GEAR UP PRINTING, 500 California Sports Physical Therapy Cen- under the fictitious business name listed Rd, Salinas, CA 93906, County of Mon- BY SIGNING, I DECLARE THAT ALL This statement was filed with the County Glenwood Circle #520, Monterey, CA ters, Inc., 2000 Garden Rd., Monterey, above on 10/20/2008 terey; Mailing Address: One CVS Drive, INFORMATION IN THIS STATEMENT Clerk of Monterey County on September 93940. CA 93940; CA Woonsocket, RI 02895 IS TRUE AND CORRECT. A registrant County of Principal Place of Business: This business was conducted by a corpo- S/ Melanie K. Luker, Secretary who declares as true any material 27, 2019 MONTEREY. This statement was filed with the County Registered Owner(s): 10/18, 10/25, 11/1, 11/8/19 ration. Clerk of Monterey County on September Longs Drug Stores California, L.L.C., One matter pursuant to Section 17913 of the Registered Owner(s): I declare that all information in this state- CVS Drive, Woonsocket, RI 02895; Cali- Business and Professions Code that the CNS-3299159# CHACON ROGELIO MIGUEL, 500 ment is true and correct. (A registrant who 20, 2019 CARMEL PINE CONE 10/11, 10/18, 10/25, 11/1/19 fornia registrant knows to be false is guilty of a Glenwood Circle #520, Monterey, CA declares as true any material matter pursu- This business is conducted by a limited lia- misdemeanor punishable by a fine not to Publication dates: October 18, 25, 93940. ant to Section 17913 of the Business and CNS-3301892# exceed one thousand dollars ($1,000) Nov. 1, 8, 2019. (PC1022) This business is conducted by an CARMEL PINE CONE bility company. I Professions code that the registrant knows Publication dates: October 11, 18, Registrant commenced to transact business am also aware that all information on individual. to be false is guilty of a misdemeanor pun- under the fictitious business name listed this statement becomes a public record The registrant commenced to transact ishable by a fine not to exceed one thou- 25, Nov. 1, 2019. (PC1006) above on 10/20/2008. upon filing pursuant to the California FICTITIOUS BUSINESS business under the fictitious business name sand dollars ($1,000).) S/ Melanie K. Luker, Secretary Public Records Act (Government Code NAME STATEMENT or names listed above on N/A. S/ Mark Fuller, Secretary This statement was filed with the County Sections 6250-6277). File No. 20192093 S/Miguel Rogelio Chacon This statement was filed with the County FICTITIOUS BUSINESS Clerk of Monterey County on September This statement was filed with the County The following person(s) is(are) doing busi- Oct. 8, 2019 Clerk of Monterey County on October 8, NAME STATEMENT 20, 2019. Clerk of Monterey County on Oct. 9, ness as: 2019. File No. 20192040 BY SIGNING, I DECLARE THAT ALL 10/11, 10/18, 10/25, 11/1/19 2019. Togo’s of Salinas, 215 Monterey Street, INFORMATION IN THIS STATEMENT 10/18, 10/25, 11/1, 11/8/19 The following person(s) is(are) doing busi- NOTICE-In accordance with Subdivision Salinas, CA 93901, County of Monterey A registrant ness as: CNS-3301908# IS TRUE AND CORRECT. CNS-3302215# CARMEL PINE CONE (a) of Section 17920, a Fictitious Name Registered Owner(s): who declares as true any material CARMEL PINE CONE CVS/pharmacy #3056, 2293 H Dela Statement generally expires at the end of DYS, Inc. 102 Vista Del Prado, Los Gatos, matter pursuant to Section 17913 of the Coun- Publication dates: October 11, 18, 25, Publication dates: Oct. 18, 25, Nov. 1, 8, Rosa Sr St., Soledad, CA 93960, Nov. 1, 2019. (PC1013) five years from the date on which it was CA 95030; CA Business and Professions Code that the 2019. (PC1031) ty of Monterey filed in the office of the County Clerk, This business is conducted by a corpora- registrant knows to be false is guilty of a Mailing address: One CVS Drive, Woon- except, as provided in Subdivision (b) of tion misdemeanor punishable by a fine not to socket, RI 02895 Registrant commenced to transact business Section 17920, where it expires 40 days exceed one thousand dollars ($1,000) I Registered Owner(s): FICTITIOUS BUSINESS after any change in the facts set forth in under the fictitious business name listed FICTITIOUS BUSINESS Longs Drug Stores California, L.L.C. One NAME STATEMENT above on N/A am also aware that all information on NAME STATEMENT CVS Drive, Woonsocket, RI 02895; Cal- File No. 20192039 the statement pursuant to Section 17913 S/ Ehab F. Youssef, President this statement becomes a public record File No. 20192160 ifornia The following person(s) is(are) doing busi- other than a change in the residence This statement was filed with the County upon filing pursuant to the California The following person(s) is(are) doing This business is conducted by a limited lia- ness as: address of a registered owner. A new Clerk of Monterey County on September Public Records Act (Government Code business as: LINKS CLUB, Carmel Plaza bility company CVS/pharmacy #9349, 347 E Alisal St, Fictitious Business Name Statement must 27, 2019 Sections 6250-6277). Ocean & Mission, Suite 101, Carmel, Registrant commenced to transact business Salinas, CA 93901, County of Monterey; be filed before the expiration. The filing of 10/18, 10/25, 11/1, 11/8/19 This statement was filed with the County CA 93923. under the fictitious business name listed Mailing Address: One CVS Drive, Woon- this statement does not of itself authorize Clerk of Monterey County on Oct. 8, Mailing address: 751 Cannery Row, socket, RI 02895 the use in this state of a Fictitious Business CNS-3299166# 2019. above on 10/20/2008 CARMEL PINE CONE Suite 109, Monterey, CA 93940. S/ Melanie K. Luker, Secretary Registered Owner(s): Name in violation of the rights of another Publication dates: October 18, 25, NOTICE-In accordance with Subdivision County of Principal Place of Business: This statement was filed with the County Longs Drug Stores California, L.L.C., One under Federal, State, or common law (a) of Section 17920, a Fictitious Name Monterey. Clerk of Monterey County on September CVS Drive, Woonsocket, RI 02895; Cali- (See Section 14411 et seq., Business and Nov. 1, 8, 2019. (PC1023) Statement generally expires at the end of Name of Corporation of as shown in 20, 2019 fornia Professions Code). five years from the date on which it was the Articles of Inc./Org./Reg.: PACIFIC 10/11, 10/18, 10/25, 11/1/19 This business is conducted by a limited lia- Filing type: ORIGINAL FILING filed in the office of the County Clerk, COAST FAMILY ENTERTAINMENT LLC, CNS-3301902# bility company. Publication dates: Oct. 18, 25, Nov. 1, 8, FICTITIOUS BUSINESS except, as provided in Subdivision (b) of 751 Cannery Row, Suite 109, Monterey, CARMEL PINE CONE Registrant commenced to transact business 2019. (PC1019) NAME STATEMENT Section 17920, where it expires 40 days CA 93940. Publication dates: October 11, 18, under the fictitious business name listed File No. 20192176 after any change in the facts set forth in State of Inc./Org./Reg.: __ 25, Nov. 1, 2019. (PC1007) above on 10/20/2008. The following person(s) is(are) doing the statement pursuant to Section 17913 This business is conducted by a limited lia- S/ Melanie K. Luker, Secretary business as: HEALTH EDUCATIONAL other than a change in the residence bility company. This statement was filed with the County FICTITIOUS BUSINESS SERVICES, 36 Quail Run Cir., Salinas, address of a registered owner. A new The registrant commenced to transact busi- Clerk of Monterey County on September NAME STATEMENT ness under the fictitious business name or File No. 20192125 CA 93907. Fictitious Business Name Statement must FICTITIOUS BUSINESS 20, 2019. Mailing address: P.O. Box 4351, be filed before the expiration. The filing of names listed above on Oct. 9, 2019. NAME STATEMENT 10/11, 10/18, 10/25, 11/1/19 The following person(s) is(are) doing busi- S/ April B Montgomery, President File No. 20192045 ness as: Salinas, CA 93912. this statement does not of itself authorize CNS-3301901# County of Principal Place of Business: the use in this state of a Fictitious Business Oct. 9, 2019 The following person(s) is(are) doing busi- 1. Heritage One, 2. Heritage One ness as: CARMEL PINE CONE MONTEREY. Name in violation of the rights of another BY SIGNING, I DECLARE THAT ALL IN- Publication dates: October 11, 18, 25, Door & Carpentry, 8020 Arco Cor- Registered Owner(s): under Federal, State, or common law FORMATION IN THIS STATEMENT IS CVS/pharmacy #9951, 8063 San Mi- Nov. 1, 2019. (PC1014) porate Drive, Suite 400, Raleigh, HOWARD R. MAIN, 6890 Valle Pacifico (See Section 14411 et seq., Business and TRUE AND CORRECT. A registrant who guel Canyon Rd., Salinas, CA 93907, NC 27617, County of Wake declares as true information pursuant to County of Monterey Rd., Salinas, CA 93907. Professions Code). Registered Owner(s): This business is conducted by an Filing type: ORIGINAL FILING Section 17913 of the Business and Profes- Mailing address: One CVS Drive, Woon- BMC West, LLC, 8020 Arco Corporate sions Code that the registrant knows to be socket, RI 02895 FICTITIOUS BUSINESS individual. Publication dates: Oct. 18, 25, Nov. 1, 8, Drive, Suite 400, Raleigh, NC 27617; The registrant commenced to transact 2019. (PC1027) false is guilty of a misdemeanor punishable Registered Owner(s): NAME STATEMENT Delaware by a fine not to exceed one thousand dol- Longs Drug Stores California, L.L.C. One File No. 20192041 business under the fictitious business name This business is conducted by a limited lia- lars. I am also aware that all Information CVS Drive, Woonsocket, RI 02895; Cal- The following person(s) is(are) doing busi- bility company or names listed above on Aug. 24, 1989. ifornia ness as: S/Howard R. Main on this statement becomes public record Registrant commenced to transact business FICTITIOUS BUSINESS upon filing pursuant to the California This business is conducted by a limited lia- CVS/pharmacy #3050, 268 Reserva- under the fictitious business name listed Oct. 11, 2019 NAME STATEMENT bility company tion Rd, Marina, CA 93933, County BY SIGNING, I DECLARE THAT ALL File No. 20192154 Public Records Act (Government Code of Monterey; Mailing Address: One CVS above on not applicable Sections 6250-6277). Registrant commenced to transact business S/ Timothy D. Johnson Manager INFORMATION IN THIS STATEMENT The following person(s) is(are) doing busi- This statement was filed with the County under the fictitious business name listed Drive, Woonsocket, RI 02895 IS TRUE AND CORRECT. A registrant ness as: Registered Owner(s): This statement was filed with the County Clerk of Monterey County on Oct. 9, 2019 above on 10/20/2008 Clerk of Monterey County on October 4, who declares as true any material Spectrum Label, 30803 San Clemente, NOTICE-In accordance with Subdivision S/ Melanie K. Luker, Secretary Longs Drug Stores California, L.L.C., One matter pursuant to Section 17913 of the County of Ala- CVS Drive, Woonsocket, RI 02895; Cali- 2019 Hayward, CA 94544, (a) of Section 17920, a Fictitious Name This statement was filed with the County 10/18, 10/25, 11/1, 11/8/19 Business and Professions Code that the meda Statement generally expires at the end of Clerk of Monterey County on September fornia registrant knows to be false is guilty of a Registered Owner(s): Resource Label This business is conducted by a limited lia- CNS-3302767# five years from the date on which it was 20, 2019 misdemeanor punishable by a fine not to Group, LLC 147 Seaboard Lane, Franklin, filed in the office of the County Clerk, 10/11, 10/18, 10/25, 11/1/19 bility company. CARMEL PINE CONE exceed one thousand dollars ($1,000) TN 37067; Delaware Registrant commenced to transact business Publication dates: Oct. 18, 25, Nov. 1, 8, I except, as provided in Subdivision (b) of CNS-3301863# am also aware that all information on This business is conducted by a limited lia- Section 17920, where it expires 40 days under the fictitious business name listed 2019. (PC1020) bility company CARMEL PINE CONE above on 10/20/2008. this statement becomes a public record after any change in the facts set forth in the Publication dates: October 11, 18, 25, upon filing pursuant to the California Registrant commenced to transact business statement pursuant to Section 17913 other S/ Melanie K. Luker, Secretary under the fictitious business name listed Nov. 1, 2019. (PC1008) This statement was filed with the County Public Records Act (Government Code than a change in the residence address of NOTICE OF PETITION Sections 6250-6277). above on 9/30/2019 a registered owner. A new Fictitious Busi- Clerk of Monterey County on September This statement was filed with the County S/ William Kent, CFO & Secretary 20, 2019. TO ADMINISTER ESTATE ness Name Statement must be filed before Clerk of Monterey County on Oct. 11, This statement was filed with the County the expiration. The filing of this statement FICTITIOUS BUSINESS 10/11, 10/18, 10/25, 11/1/19 of JUAN LUIS MIJARES Clerk of Monterey County on October 8, NAME STATEMENT 2019. does not of itself authorize the use in this File No. 20192044 CNS-3301906# aka JUAN L. MIJARES NOTICE-In accordance with Subdivision 2019 state of a Fictitious Business Name in viola- The following person(s) is(are) doing busi- CARMEL PINE CONE aka JUAN MIJARES (a) of Section 17920, a Fictitious Name 10/18, 10/25, 11/1, 11/8/19 tion of the rights of another under Federal, ness as: Publication dates: October 11, 18, 25, Case Number 19PR000391 Statement generally expires at the end of CNS-3302626# State, or common law (See Section 14411 CVS/pharmacy #9506, 1140 S Main Nov. 1, 2019. (PC1015) To all heirs, beneficiaries, creditors, five years from the date on which it was CARMEL PINE CONE et seq., Business and Professions Code). St, Salinas, CA 93901, County of Mon- contingent creditors, and persons who filed in the office of the County Clerk, Publication dates: October 18, 25, Filing type: ORIGINAL FILING terey; Mailing Address: One CVS Drive, except, as provided in Subdivision (b) of Nov. 1, 8, 2019. (PC1028) Publication dates: Oct. 18, 25, Nov. 1, 8, Woonsocket, RI 02895 FICTITIOUS BUSINESS may otherwise be interested in the will Section 17920, where it expires 40 days 2019. (PC1032) Registered Owner(s): NAME STATEMENT or estate, or both, of JUAN LUIS MIJAR- after any change in the facts set forth in Longs Drug Stores California, L.L.C., One File No. 20192042 ES aka JUAN L. MIJARES aka JUAN the statement pursuant to Section 17913 FICTITIOUS BUSINESS NAME CVS Drive, Woonsocket, RI 02895; Cali- The following person(s) is(are) doing busi- MIJARES. other than a change in the residence ness as: STATEMENT FICTITIOUS BUSINESS fornia A PETITION FOR PROBATE has address of a registered owner. A new File No. 20192069 NAME STATEMENT This business is conducted by a limited lia- CVS/pharmacy #9320, 686 Light- LAURA MIJARES in the Fictitious Business Name Statement must The following person(s) is(are) doing busi- File No. 20192144 bility company. house Ave, Monterey, CA 93940, been filed by be filed before the expiration. The filing of ness as: The following person(s) is(are) doing Registrant commenced to transact business County of Monterey; Mailing Address: Superior Court of California, County of this statement does not of itself authorize business as: One CVS Drive, Woonsocket, RI 02895 Almalose, 27875 Berwick Drive, Suite THE FARM, 5 Foster Road, under the fictitious business name listed MONTEREY. the use in this state of a Fictitious Business A, Carmel, CA 93923, County of Mon- Salinas, CA 93908. above on 10/20/2008. Registered Owner(s): The Petition for Probate requests Name in violation of the rights of another terey Longs Drug Stores California, L.L.C., One Mailing address: P.O. Box 247, S/ Melanie K. Luker, Secretary that LAURA MIJARES be appointed as under Federal, State, or common law Registered Owner(s): Salinas, CA 93902. This statement was filed with the County CVS Drive, Woonsocket, RI 02895; Cali- personal representative to administer (See Section 14411 et seq., Business and NutJobs, Inc. 27875 Berwick Drive, Suite County of Principal Place of Business: Clerk of Monterey County on September fornia Professions Code). A, Carmel, CA 93923; DE Monterey. 20, 2019. This business is conducted by a limited lia- the estate of the decedent. Filing type: ORIGINAL FILING This business is conducted by a corpora- Name of Corporation of as shown in 10/11, 10/18, 10/25, 11/1/19 bility company. THE PETITION requests the dece- Publication dates: Oct. 18, 25, Nov. 1, 8, tion the Articles of Inc./Org./Reg.: CROWN CNS-3301853# Registrant commenced to transact business dent’s will and codicils, if any, be admit- 2019. (PC1024) Registrant commenced to transact business PACKING COMPANY INC., 5 Foster CARMEL PINE CONE under the fictitious business name listed ted to probate. The will and any codicils under the fictitious business name listed Road, Salinas, CA 93908. above on 10/20/2008. above on June 11, 2019 State of Inc./Org./Reg.: CA Publication dates: October 11, 18, 25, S/ Melanie K. Luker, Secretary are available for examination in the file Nov. 1, 2019. (PC1009) kept by the court. S/ Paul Sunshine, President This business is conducted by a corpora- This statement was filed with the County FICTITIOUS BUSINESS This statement was filed with the County tion. Clerk of Monterey County on September THE PETITION requests authority to NAME STATEMENT File No. 20192094 Clerk of Monterey County on September The registrant commenced to transact busi- 20, 2019. administer the estate under the Indepen- 25, 2019 ness under the fictitious business name or FICTITIOUS BUSINESS 10/11, 10/18, 10/25, 11/1/19 dent Administration of Estates Act. (This The following person(s) is(are) doing busi- 10/18, 10/25, 11/1, 11/8/19 NAME STATEMENT ness as: names listed above on March 1, 1999. File No. 20192043 CNS-3301883# authority will allow the personal repre- CNS-3304922# S/ Christopher Bunn, Vice President CARMEL PINE CONE La Buena Vida Mariscos of Salinas, CARMEL PINE CONE Oct. 8, 2019 The following person(s) is(are) doing busi- Publication dates: October 11, 18, 25, sentative to take many actions without 213A Monterey Street, Salinas, CA ness as: obtaining court approval. Before taking 93901, County of Monterey Publication dates: October 18, 25, BY SIGNING, I DECLARE THAT ALL IN- CVS/pharmacy #9186, 110 E Laurel Nov. 1, 2019. (PC1016) certain very important actions, howev- Registered Owner(s): Nov. 1, 8, 2019. (PC1029) FORMATION IN THIS STATEMENT IS Dr., Salinas, CA 93906, County of Mon- SCU Bros, Inc. 102 Vista Del Prado, Los TRUE AND CORRECT. A registrant who terey er, the personal representative will be Gatos, CA 95030; CA declares as true information pursuant to Mailing address: One CVS Drive, Woon- FICTITIOUS BUSINESS required to give notice to interested This business is conducted by a corpora- FICTITIOUS BUSINESS Section 17913 of the Business and Profes- socket, RI 02895 NAME STATEMENT persons unless they have waived notice tion NAME STATEMENT sions Code that the registrant knows to be Registered Owner(s): File No. 20192110 or consented to the proposed action.) Registrant commenced to transact business File No. 20192066 false is guilty of a misdemeanor punishable Longs Drug Stores California, L.L.C. One under the fictitious business name listed The following person(s) is(are) doing by a fine not to exceed one thousand dol- The following person(s) is(are) doing busi- The independent administration author- lars. CVS Drive, Woonsocket, RI 02895; Cal- ness as: ity will be granted unless an interested above on N/A business as: ECO CONCEPTS, 323688 I am also aware that all Information ifornia S/ Ehab F. Youssef, President Coast Ridge Road, Carmel, CA 93923. on this statement becomes public record This business is conducted by a limited lia- 1. LA TIERRA REALTY person files an objection to the petition This statement was filed with the County County of Principal Place of Business: upon filing pursuant to the California bility company 2. LA TIERRA HOMES AND RANCH and shows good cause why the court Clerk of Monterey County on September MONTEREY. Public Records Act (Government Code Registrant commenced to transact business 3. LA TIERRA HOME & RANCH should not grant the authority. 27, 2019 Registered Owner(s): Sections 6250-6277). This statement was filed with the County under the fictitious business name listed One Rancho San Carlos Rd., Carmel, A hearing on the petition will be 10/18, 10/25, 11/1, 11/8/19 JEDEDIAH SENGELOV WHEELER, above on 10/20/2008 CA 93923. 323688 Coast Ridge Road, Carmel, CA Clerk of Monterey County on Oct. 8, 2019 held in this court as follows: CNS-3299170# NOTICE-In accordance with Subdivision S/ Melanie K. Luker, Secretary Mailing Address: P.O. Box 221535, CARMEL PINE CONE 93923. This statement was filed with the County Date: Nov. 13, 2019 (a) of Section 17920, a Fictitious Name Carmel, CA 93922. Time: 9:00 a.m. Publication dates: October 18, 25, This business is conducted by an Statement generally expires at the end of Clerk of Monterey County on September County of Principal Place of Business: Nov. 1, 8, 2019. (PC1025) individual. 20, 2019 Monterey. Dept.: 13 The registrant commenced to transact five years from the date on which it was 10/11, 10/18, 10/25, 11/1/19 Address: Superior Court of Califor- filed in the office of the County Clerk, Name of Corporation of as shown in the business under the fictitious business name except, as provided in Subdivision (b) of CNS-3301838# Articles of Inc./Org./Reg.: LA TIERRA nia, County of Monterey, 1200 Aguaji- FICTITIOUS BUSINESS or names listed above on Nov. 10, 2010. Section 17920, where it expires 40 days CARMEL PINE CONE INC., One Rancho San Carlos Rd., Carm- to Road, Monterey, CA 93940. S/Jedediah Sengelov Wheeler Publication dates: October 11, 18, 25, NAME STATEMENT after any change in the facts set forth in the el, CA 93923. If you object to the granting of File No. 20192034 Sept. 24, 2019 statement pursuant to Section 17913 other Nov. 1, 2019. (PC1010) State of Inc./Org./Reg.: CA the petition, you should appear at the The following person(s) is(are) doing BY SIGNING, I DECLARE THAT ALL than a change in the residence address of This business is conducted by a corpora- business as: INFORMATION IN THIS STATEMENT a registered owner. A new Fictitious Busi- hearing and state your objections or file BANFIELD PET HOSPITAL, A registrant tion. written objections with the court before 2020 California Ave., Sand City, CA IS TRUE AND CORRECT. ness Name Statement must be filed before FICTITIOUS BUSINESS The registrant commenced to transact busi- 93955. who declares as true any material the expiration. The filing of this statement NAME STATEMENT ness under the fictitious business name or the hearing. Your appearance may be Mailing address: P.O. Box 87556, matter pursuant to Section 17913 of the does not of itself authorize the use in this File No. 20192046 in person or by your attorney. Business and Professions Code that the state of a Fictitious Business Name in viola- The following person(s) is(are) doing busi- names listed above on N/A. Vancouver, WA 98687. registrant knows to be false is guilty of a S/ Lisa Guthrie, President If you are a creditor or a con- County of Principal Place of Business: tion of the rights of another under Federal, ness as: you Monterey. misdemeanor punishable by a fine not to State, or common law (See Section 14411 CVS/pharmacy #3051, 17579 Vierra Oct. 1, 2019 tingent creditor of the decedent, exceed one thousand dollars ($1,000) I et seq., Business and Professions Code). County must file your claim with the court and Name of Corporation of as shown in the Canyon Rd, Salinas, CA 93907, BY SIGNING, I DECLARE THAT ALL IN- Articles of Inc./Org./Reg.: MEDICAL am also aware that all information on Filing type: ORIGINAL FILING of Monterey FORMATION IN THIS STATEMENT IS mail a copy to the personal represen- this statement becomes a public record Publication dates: Oct. 18, 25, Nov. 1, 8, Mailing Address: One CVS Drive, Woon- TRUE AND CORRECT. A registrant who tative appointed by the court within the MANAGEMENT INTERNATIONAL, INC., upon filing pursuant to the California 2019. (PC1033) socket, RI 02895 declares as true information, which he or later of either (1) four months from 18101 SE 6th Way, Vancouver, WA Public Records Act (Government Code Registered Owner(s): she knows to be false, is guilty of a misde- the date of first issuance of letters to a 98683 Longs Drug Stores California, L.L.C., One meanor punishable by a fine not to exceed State of Inc./Org./Reg.: Delaware CVS Drive, Woonsocket, RI 02895; Cali- general personal representative, as de- one thousand dollars ($1,000) (B&P Code fined in section 58(b) of the California This business is conducted by a corpora- fornia 17913). tion. This business is conducted by A Limited I am also aware that all Infor- Probate Code, or (2) 60 days from The registrant commenced to transact busi- Liability Company mation on this statement becomes Public the date of mailing or personal deliv- ness under the fictitious business name or — Be prepared for emergencies — Registrant commenced to transact business Record upon filing pursuant to the Cal- ery to you of a notice under section names listed above on April 9, 2012. under the fictitious business name listed ifornia Public Records Act (Government 9052 of the California Probate Code. above on 10/20/2008 Code Sections 6250-6277). S/ Ludek Tanousek Register your phone number at S/ Melanie K. Luker, Secretary This statement was filed with the County Other California statutes and legal Aug. 23, 2019 This statement was filed with the County Clerk of Monterey County on Oct. 1, 2019 authority may affect your rights as BY SIGNING, I DECLARE THAT ALL IN- www.alertmontereycounty.org Clerk of Monterey County on September NOTICE-In accordance with Subdivision a creditor. You may want to consult FORMATION IN THIS STATEMENT IS 20, 2019 (a) of Section 17920, a Fictitious Name with an attorney knowledgeable in TRUE AND CORRECT. A registrant who November 1, 2019 The Carmel Pine Cone 39A PUBLIC NOTICES Fictitious Business Name Statement must NOTICE OF PETITION terested in the estate, you may file with DEBORAH ANN RIANDA, 34501 Business and Professions Code that the Service Commercial (SC) Zoning District. the court a Request for Special Notice Chualar Canyon Road, Chualar, CA be filed before the expiration. The filing of registrant knows to be false is guilty of a TO ADMINISTER ESTATE (form DE-154) of the filing of an inven- 93925. this statement does not of itself authorize misdemeanor punishable by a fine not to SUB 18-048 & DS 18-049 (Yonekura) of DORIS E. CAMPANELLI PATRICIA DIANE FUQUA, 19 Del Rey the use in this state of a Fictitious Business exceed one thousand dollars ($1,000) James Newhall Smith, Architect tory and appraisal of estate assets or of Name in violation of the rights of another I aka DORIS CAMPANELLI any petition or account as provided in Circle, Salinas, CA 93901. am also aware that all information on Carmelo Street, 3 SW of 7th Avenue This business is conducted by a general under Federal, State, or common law Block: T; Lots: 7 & 9 Case Number 19PR000400 Probate Code section 1250. A (See Section 14411 et seq., Business and this statement becomes a public record To all heirs, beneficiaries, creditors, Request partnership. upon filing pursuant to the California APN: 010-268-003 for Special Notice form is available The registrant commenced to transact Professions Code). Consideration of a Subdivision applica- contingent creditors, and persons who Filing type: ORIGINAL FILING Public Records Act (Government Code from the court clerk. business under the fictitious business name Sections 6250-6277). tion (SUB 18-048, Yonekura), Concept may otherwise be interested in the will Attorney for Petitioner: or names listed above on Jan 1, 2019. Publication dates: Nov. 1, 8, 15, 22, 2019. This statement was filed with the County Design Study (DS 18-049, Yonekura) and or estate, or both, of DORIS E. CAM- Michael A. Roosevelt S/Deborah Ann Rianda (PC1101) Clerk of Monterey County on Oct. 7, associated Coastal Development Permit to PANELLI aka DORIS CAMPANELLI. Friedman McCubbin Law Group LLP Oct. 17, 2019 2019. subdivide an existing 8,000 square foot lot BY SIGNING, I DECLARE THAT ALL NOTICE-In accordance with Subdivision and construct a two-story addition to an ex- A PETITION FOR PROBATE has 425 California St., 25th Fl. (a) of Section 17920, a Fictitious Name isting single-story accessory dwelling unit been filed by JON CAMPANELLI and San Francisco, CA 94104 INFORMATION IN THIS STATEMENT FICTITIOUS BUSINESS IS TRUE AND CORRECT. A registrant NAME STATEMENT Statement generally expires at the end of on lot 9 (south lot) located on Carmelo, NICOLE CAMPANELLI in the Superior (415) 434-1363 who declares as true any material File No. 20192244 five years from the date on which it was 3 SW of 7th Avenue in the Single-Family Court of California, County of MON- This statement was filed by Superi- matter pursuant to Section 17913 of the The following person(s) is(are) doing filed in the office of the County Clerk, Residential (R-1) Zoning District. TEREY. or Court of California, County of Mon- Business and Professions Code that the business as: except, as provided in Subdivision (b) of The Petition for Probate requests terey on October 15, 2019. registrant knows to be false is guilty of a 1. CALESTATE PROPERTIES Section 17920, where it expires 40 days APP 19-251 & UP 19-411 (Dolores LLC) misdemeanor punishable by a fine not to after any change in the facts set forth in Pamela Silkwood, Attorney that JON CAMPANELLI and NICOLE Publication dates: October 18, 25, 2. MUSIC BOX EMPORIUM, Dolores, 3 SE 7th CAMPANELLI be appointed as per- exceed one thousand dollars ($1,000) I 1100 Pacific Ave., Monterey, CA the statement pursuant to Section 17913 Nov. 1, 2019. (PC1034) other than a change in the residence Block: 91 Lot: 12 sonal representative to administer the am also aware that all information on 93940. APN: 010-411-003 estate of the decedent. this statement becomes a public record Mailing address: 680 Lighthouse Ave. address of a registered owner. A new Consideration of an Appeal (APP 19-251, upon filing pursuant to the California #51693, Pacific Grove, CA 93950 Fictitious Business Name Statement must THE PETITION requests the dece- FICTITIOUS BUSINESS County of Principal Place of Business: Dolores, LLC) of the denial of a Transient Public Records Act (Government Code be filed before the expiration. The filing of Rental Business License Application for an dent’s will and codicils, if any, be admit- NAME STATEMENT Sections 6250-6277). MONTEREY. this statement does not of itself authorize File No. 20192164 Registered Owner(s): existing condominium and a Use Permit ted to probate. The will and any codicils The following person(s) is(are) doing busi- This statement was filed with the County the use in this state of a Fictitious Business Amendment (UP 19-411, Dolores, LLC) are available for examination in the file Clerk of Monterey County on Oct. 17, WILLIAM EDWARD KUZMIN, 1100 Name in violation of the rights of another ness as: 2019. Pacific Ave., Monterey, CA 93940. under Federal, State, or common law to allow for the operation of a Transient kept by the court. Bridge Hospice, 601 E. Romie Ln. Suite NOTICE-In accordance with Subdivision This business is conducted by an (See Section 14411 et seq., Business and (Short Term) Rental located on Dolores, THE PETITION requests authority to 4, Salinas, CA 93901, County of Mon- (a) of Section 17920, a Fictitious Name individual. Professions Code). 3 SE 7th in the Service Commercial (SC) administer the estate under the Indepen- terey Zoning District. Registered Owner(s): Statement generally expires at the end of The registrant commenced to transact Filing type: ORIGINAL FILING dent Administration of Estates Act. (This Bridge Hospice Central Coast LLC, 601 E. five years from the date on which it was business under the fictitious business name Publication dates: Nov. 1, 8, 15, 22, 2019. DS 18-327 (Garren) authority will allow the personal repre- Romie Ln. Suite 4, Salinas, CA 93901; CA filed in the office of the County Clerk, or names listed above on Oct. 24, 2019. (PC1103) Glenn Warner, Architect sentative to take many actions without This business is conducted by a limited lia- except, as provided in Subdivision (b) of S/William Edward Kuzmin Santa Rita, 4 NE 6th obtaining court approval. Before taking bility companty Section 17920, where it expires 40 days Oct. 24, 2019 Block: 62 Lots: 12 Registrant commenced to transact business after any change in the facts set forth in BY SIGNING, I DECLARE THAT ALL APN: 010-035-014 certain very important actions, howev- the statement pursuant to Section 17913 PUBLIC NOTICE er, the personal representative will be under the fictitious business name listed INFORMATION IN THIS STATEMENT Consideration of a combined Concept and above on not applicable other than a change in the residence IS TRUE AND CORRECT. A registrant NOTICE IS HEREBY GIVEN that the Final Design Study (DS 18-327, Garren) required to give notice to interested S/ Joseph Monteforte, CFO address of a registered owner. A new who declares as true any material Planning Commission of the City of and associated Coastal Development Per- persons unless they have waived notice This statement was filed with the County Fictitious Business Name Statement must matter pursuant to Section 17913 of the Carmel-by-the-Sea will conduct a mit for an addition to an existing residence or consented to the proposed action.) Clerk of Monterey County on October be filed before the expiration. The filing of Business and Professions Code that the public hearing in the City Hall Council located on San Rita, 4 northeast of 6th in The independent administration author- 10, 2019 this statement does not of itself authorize registrant knows to be false is guilty of a Chambers, located on the east side the Single Family Residential (R-1) Zoning 10/25, 11/1, 11/8, 11/15/19 the use in this state of a Fictitious Business misdemeanor punishable by a fine not to of Monte Verde between Ocean and District. ity will be granted unless an interested Name in violation of the rights of another exceed one thousand dollars ($1,000) person files an objection to the petition CNS-3303278# I Seventh Avenues, on Wednesday, CARMEL PINE CONE under Federal, State, or common law am also aware that all information on November 13, 2019 at 4:00 p.m. or DS 19-302 (Adams) and shows good cause why the court Publication dates: October 25, Nov. 1, 8, (See Section 14411 et seq., Business and this statement becomes a public record as soon thereafter as possible. Imme- Adam Jeselnick, Architect should not grant the authority. 15, 2019. (PC1035) Professions Code). upon filing pursuant to the California diately prior to the public hearing, the Perry Newberry, 2 SW 4th A hearing on the petition will be Filing type: ORIGINAL FILING Public Records Act (Government Code Commission will visit some or all of the Block: 2A Lots: 3 held in this court as follows: Publication dates: Oct. 25, Nov. 1, 8, 15, Sections 6250-6277). project sites as part of a Tour of Inspec- APN: 009-164-002 Date: Dec. 18, 2019 FICTITIOUS BUSINESS 2019. (PC1039) This statement was filed with the County tion. Interested members of the public Consideration of a combined Concept and NAME STATEMENT Clerk of Monterey County on Oct. 24, are invited to attend. For the items Final Design Study (DS 19-302, Adams) Time: 9:00 a.m. File No. 20192181 2019. on the agenda, staff will present the and associated Coastal Development Per- Dept.: 13 The following person(s) is(are) doing busi- NOTICE-In accordance with Subdivision project, then the applicant and all in- mit for an addition to an existing residence FICTITIOUS BUSINESS (a) of Section 17920, a Fictitious Name Address: Superior Court of Califor- ness as: NAME STATEMENT terested members of the public will be and construction of a new detached ga- nia, County of Monterey, 1200 Aguaji- Pacific Rehabilitation & Sports Thera- File No. 20192265 Statement generally expires at the end of allowed to speak or offer written tes- rage in the front setback located on Perry to Road, Monterey, CA 93940. py, 2000 Garden Rd., Monterey, CA The following person(s) is(are) doing five years from the date on which it was timony before the Commission takes Newberry 2 SW 4th in the Single Family to the granting of 93940, County of Monterey business as: filed in the office of the County Clerk, action. Decisions to approve or deny Residential (R-1) Zoning District. If you object Registered Owner(s): NEW SHINE SOLAR, except, as provided in Subdivision (b) of the project may be appealed to the the petition, you should appear at the California Sports Physical Therapy Center, 22521 Murietta Rd., Salinas, CA Section 17920, where it expires 40 days UP 19-334 (Pantilimon’s) 93908. City Council by filing a written notice of hearing and state your objections or file Inc., 2000 Garden Rd., Monterey, CA County of Principal Place of Business: after any change in the facts set forth in appeal with the office of the City Clerk Diane G. Brown, Business Owner written objections with the court before 93940; CA MONTEREY. the statement pursuant to Section 17913 within ten (10) working days follow- San Carlos 2 SW of 5th Ave the hearing. Your appearance may be This business is conducted by a corpora- Registered Owner(s): other than a change in the residence ing the date of action by the Planning Block: 56, Lot: 3 in person or by your attorney. tion JOHN JEFFREY ELLIS, 22521 Murietta address of a registered owner. A new Commission and paying the requisite APN: 010-135-002 Registrant commenced to transact business Rd., Salinas, CA 93908. Fictitious Business Name Statement must appeal fee. Consideration of a Use Permit (UP 19-334, If you are a creditor or a con- under the fictitious business name listed This business is conducted by an be filed before the expiration. The filing of Pantilimon’s) to establish a specialty food tingent creditor of the decedent, you above on N/A this statement does not of itself authorize If you challenge the nature of the pro- store as an ancillary use to an existing individual. posed action in court, you may be limited must file your claim with the court and S/ Mark Fuller, Secretary The registrant commenced to transact the use in this state of a Fictitious Business home furnishings store located on San mail a copy to the personal represen- This statement was filed with the County Name in violation of the rights of another to raising only those issues you or someone Carlos 2 SW of 5th Ave in the Service business under the fictitious business name else raised at the public hearing described tative appointed by the court within the Clerk of Monterey County on October or names listed above on Oct. 25, 2019. under Federal, State, or common law Commercial (SC) Zoning District. 14, 2019 (See Section 14411 et seq., Business and in this notice, or in written correspondence later of either (1) four months from S/John J. Ellis delivered to the Planning Commission or 10/25, 11/1, 11/8, 11/15/19 Oct. 25, 2019 Professions Code). DS 19-448 (Durkheimer) the date of first issuance of letters to a CNS-3304153# Filing type: ORIGINAL FILING the City Council at, or prior to, the public Harlan Bradley general personal representative, as de- CARMEL PINE CONE BY SIGNING, I DECLARE THAT ALL Publication dates: Nov. 1, 8, 15, 22, 2019. hearing. Camino Real 2 SW of 12th Ave fined in section 58(b) of the California Publication dates: October 25, Nov. 1, 8, INFORMATION IN THIS STATEMENT (PC1102) Block: CC, Lot 5 Probate Code, or (2) from 15, 2019. (PC1038) IS TRUE AND CORRECT. A registrant DR 19-227 & UP 19-228 (Great Valley APN: 010-285-012 60 days who declares as true any material Holdings, LLC) Consideration of a Track 1 Design Study the date of mailing or personal deliv- matter pursuant to Section 17913 of the Peter Silva, Architect (DS 19-448, Durkheimer) to change the ery to you of a notice under section Business and Professions Code that the FICTITIOUS BUSINESS 5th Avenue 2 NW of San Carlos exterior wall cladding from stained wood FICTITIOUS BUSINESS registrant knows to be false is guilty of a 9052 of the California Probate Code. NAME STATEMENT NAME STATEMENT Block: 51; Lots: 17 & 18 shake siding to stucco on a residence Other California statutes and legal File No. 20192212 misdemeanor punishable by a fine not to File No. 20192134 APN: 010-136-018 currently under construction located at The following person(s) is(are) doing exceed one thousand dollars ($1,000) I The following person(s) is(are) Consideration of a Design Review (DR Camino Real 2 SW of 12th Ave in the Sin- authority may affect your rights as doing business as: PACIFIC GROVE 19-227, Great Valley Holdings, LLC), Use a creditor. You may want to consult business as: H & A RANCHES, 34501 am also aware that all information on gle-Family Residential (R-1) Zoning District. Chualar Canyon Road, Chualar, CA this statement becomes a public record CLEANING COMPANY, 406 Willow Permit (UP 19-228, Great Valley Holdings, with an attorney knowledgeable in 93925. upon filing pursuant to the California St., Pacific Grove, CA 93950. LLC) and associated Coastal Development City of Carmel-by-the-Sea California law. County of Principal Place of Business: Public Records Act (Government Code County of Principal Place of Business: Permit for the demolition and reconstruc- Marc Wiener, AICP, Community Planning You may examine the file kept MONTEREY. Sections 6250-6277). MONTEREY. tion of a mixed-use building located on 5th and Building Director If you are a person in- Registered Owner(s): This statement was filed with the County Registered Owner(s): Avenue 2 northwest of San Carlos in the Publication dates: Nov. 1, 2019. (PC1108) by the court. Clerk of Monterey County on Oct. 25, RHIANNON ROSE TOWNSHEND, 408 2019. Willow St., Pacific Grove, CA 93950. NOTICE-In accordance with Subdivision This business is conducted by an LIEN SALE ADVERTISEMENT (a) of Section 17920, a Fictitious Name individual. Statement generally expires at the end of The registrant commenced to transact LIEN SALE ADVERTISEMENT The contents of the storage spaces rented by the listed parties five years from the date on which it was business under the fictitious business name Notice is hereby given that pursuant to the California Self-Service Storage filed in the office of the County Clerk, or names listed above on Sept. 15, 2019. Facility Act, (B&P Code 21700 et. seq.), the undersigned will sell at public will be sold to satisfy the storage lien pursuant to section 21700- except, as provided in Subdivision (b) of S/Rhiannon Townshend Oct. 7, 2019 auction; personal property including but not limited to furniture, clothing, tools, 217500 of the California Self Storage Facility Act. The sale will Section 17920, where it expires 40 days and/or other misc. items. be held at Ustor Self Storage, 441 Espinosa Rd, Salinas, CA after any change in the facts set forth in BY SIGNING, I DECLARE THAT ALL the statement pursuant to Section 17913 INFORMATION IN THIS STATEMENT Auction to be held at 1PM on November 15th, 2019 93907 on Tuesday, November 5th at 9:15 AM. Contents of other than a change in the residence IS TRUE AND CORRECT. A registrant at www.selfstorageauction.com. address of a registered owner. A new who declares as true any material purchased units must be removed on the day of the sale and matter pursuant to Section 17913 of the The property is stored at: StoragePro of Carmel, are sold as is. 9640 Carmel Valley Road, Carmel, CA 93923.

D081 - Walter Loveday LIEN SALE AUCTION ADVERTISEMENT NAME OF TENANT D116, D110, B037 - Gino Guitierez Notice is hereby given that Pursuant to the California Cara Hopkins E104 - Sonny R Davis Publication dates: Nov. 1, 8, 2019 (PC1107) E024 - Emmanuel M Rodriquez Self-Service Storage Facility Act, (B&P Code 21700 et. seq.), E038,D072 - Adrian Ayon the undersigned will sell at public auction; personal property C037 - Luis Bravo including but not limited to furniture, clothing, tools, PUBLIC NOTICE Publication dates: Oct. 25, Nov. 1, 2019 (PC1041) and/or other misc. items ) ( $@ ):E=6 %C56C $@ &$ F101 - Eduardo Campos &C@A6CEJ 55C6DD %''" '*$ '#" $%) % Auction to be held at 1pm on November 19th, 2018 )'*()( (" $%) )' ( (*##'. % ) at www.selfstorageauction.com. $%'#) %$ $ ) ( %*#$) )) CITY OF CARMEL-BY-THE-SEA The property is stored at: $%)( *$)*$'(*#$" $%'# U$ NOTICE OF ELECTION ()%*#$)%)"#.'%%$*%$ #&%'#(.%$( Leonards Lockers 816 Elvee Dr Salinas Ca 93901. %!*#$)%$ )%$$!"! &"[*X!S#)%YR."N`$ MEASURE TO BE VOTED ON )'T$ N. )U# "[c +a )V$ ) $ )'%$ )N " b* $N. NAME OF TENANT /&*'(*$) )% + " % L 2 ) (*##'. % NOTICE IS HEREBY GIVEN that the following measure is to be voted on $%'#) %$ ''' )% %+ ( $%) )) )% ) at the Special Municipal Election to be held in the City of Carmel-by-the- Peter Aguilar Lisa A Reynolds '%'%'&*" (%&.%) (%*#$)*)%$".)% Sea on Tuesday, March 3, 2020: ) %& ( &'%+ )% ) )'*()%' 0 .%* ' $ *") Victor Manuel De La Cruz Victoria E Gonzalez *$' % )'*() ) *$"(( .%* )! ) %$ )% &'%)) .%*' &'%&'). ) #. (%" ) “Shall the Ordinance to increase the City of Carmel-by-the-Sea’s current Dorthy Ramirez Alonso Melena &*" (" .%* $ $ -&"$) %$ % ) $)*' % 1% sales tax to 1.5% to generate an estimated $4.5 million per year for Terra Marie Melville Andrew Munoz ) &'% $ $() .%* .%* (%*" %$)) 20 years to enhance the City’s green infrastructure of parks, trails, beach- ",.' AF3=:42F4E:@?D2=6@7E96)CFDE@CQD:?E6C6DEH:==36>256E@E96 Stephani Mercado Thomas Munoz 9:896DE3:556C7@C=2H7F=>@?6J@7E96*?:E65(E2E6DA2J23=62EE96E:>6@7 es and trees; invest in community facilities and spaces; maintain public D2=6 :? 42D9 42D9:6CD 4964< 5C2H? @? 2 DE2E6 @C ?2E:@?2= 32?< 42D9:6CQD safety and emergency preparation; fund capital needs; address pension 4964<5C2H?3J2DE2E6@C7656C2=4C65:EF?:@?@C242D9:6CQD4964<5C2H?3J liabilities and provide general City services, with all funds staying local, Publication date: Nov. 1, 8, 2019 (PC1105) 2 DE2E6 @C 7656C2= D2G:?8D 2?5 =@2? 2DD@4:2E:@? @C D2G:?8D 2DD@4:2E:@? @C D2G:?8D32?256 3FE H:E9@FE 4@G6?2?E @C HOLIDAY GIFT GUIDE H2CC2?EJ 6IAC6DD65 @C :>A=:65 C682C5:?8 E:E=6 A@DD6DD:@? @C The polls will be open between the hours of 7:00 a.m. and 8:00 p.m. 6?4F>3C2?46DE@A2JE96C6>2:?:?8AC:?4:A2=DF>@7E96?@E6DD64FC653J E96665@7)CFDEH:E9:?E6C6DE2?5=2E6492C86DE96C6@?2DAC@G:565:?E96 Britt S. Avrit, MMC, City Clerk Friday, November 29 ?@E6D 25G2?46D F?56C E96 E6C>D @7 E96 665 @7 )CFDE :?E6C6DE E96C6@? Carmel-by-the-Sea, CA 766D492C86D2?56IA6?D6D@7E96)CFDE667@CE96E@E2=2>@F?E2EE96E:>6 Dated: November 1, 2019 CALL OR EMAIL TO RESERVE YOUR AD SPACE TODAY! @7E96:?:E:2=AF3=:42E:@?@7E96$@E:46@7(2=6C62D@?23=J6DE:>2E65E@36D6E Jessica (831) 274-8590 | [email protected] 7@CE936=@H )962>@F?E>2J368C62E6C@?E9652J@7D2=6 )CFDE@C $ Publish Date: November 1, 2019 # - '$'$%) $ + *"".*)(%"".()'*()%) Publication dates: Nov. 1, 2019 (PC1109) Meena (831) 274-8655 | [email protected] $ # - '$' )'*() * ( #$ F=J AA@:?E65)CFDE66&"#"%$#$#$)('+ ( $ '64@C565 2D ?DECF>6?E$@ @7%77:4:2='64@C5D:?E96@77:46@7 E96 '64@C56C @7 #@?E6C6J @F?EJ 2=:7@C?:2 2E6 @7 (2=6 2E CITY OF CARMEL-BY-THE-SEA, CALIFORNIA #&=246@7(2=6EE96>2:?6?EC2?46E@E96@F?EJ5>:?:DEC2E:@? F:=5:?8 , =:D2=(EC66E(2=:?2D >@F?E@7F?A2:532=2?46 NOTICE INVITING BIDS 2?5@E96C492C86D 6DE:>2E652D@7E967:CDEAF3=:42E:@?52E6 $%) ) "$' , "" &) #- #*# % For HARRISON MEMORIAL LIBRARY MEETING ROOM REMODEL RE-BID (EC66E 55C6DD @C @E96C 4@>>@? 56D:8?2E:@? @7 C62= AC@A6CEJ %''" Notice is hereby given that the City of Carmel-by-the-Sea is soliciting bids from qualified Contractors for work including but not limited to: relocation of '*$ '#" & $ )96 F?56CD:8?65 )CFDE665:D4=2:>D2?J=:23:=:EJ7@C2?J:?4@CC64E?6DD@7E96DEC66E255C6DD@C existing bookcases, hazardous material abatement, selective demolition, electrical & minor mechanical, modification to the existing fire sprinkler system, @E96C 4@>>@? 56D:8?2E:@? :7 2?J D9@H? 23@G6 )96 AC@A6CEJ 96C6E@7@C6 new framing, insulation, drywall, doors, windows, casework, handrail, paint, carpet, frameless glass partition wall and doors as shown or indicated in the 56D4C:365:D36:?8D@=5O2D:DP 7E96)CFDE66:DF?23=6E@4@?G6JE:E=67@C2?J Drawings and Specifications. C62D@? E96 DF446DD7F= 3:556CQD D@=6 2?5 6I4=FD:G6 C6>65J D92== 36 E96 C6EFC?@7>@?:6DA2:5E@E96)CFDE662?5E96DF446DD7F=3:556CD92==92G6?@ There will be a Non-Mandatory Pre-Bid Conference and Site Tour on Tuesday, November 5, 2019 at 9:30 AM for all interested Contractors. The 7FCE96CC64@FCD6 7?@DEC66E255C6DD@C@E96C4@>>@?56D:8?2E:@?:DD9@H? tour will meet at the City of Carmel-by-the-Sea Harrison Memorial Library NE corner of Ocean Avenue & Lincoln Street. On street parking is available on 5:C64E:@?D E@ E96 =@42E:@? @7 E96 AC@A6CEJ >2J 36 @3E2:?65 3J D6?5:?8 2 Lincoln Street near the Library. HC:EE6? C6BF6DE E@ E96 36?67:4:2CJ H:E9:? 52JD @7 E96 52E6 @7 7:CDE AF3=:42E:@? @7 E9:D $@E:46 @7 (2=6 )96 7@==@H:?8 DE2E6>6?ED $%) )% The Invitation for Bids is available at http://ci.carmel.ca.us/carmel (under the tab “I Want to Submit a Bid or Proposal”) or by contacting Carmel &%)$) " '(2?5$%) )%&'%&').%,$'2C6DE2EFE@CJ Public Works Department at 831-620-2070. At the time of the Bid opening, the successful Bidder must be legally entitled to perform Contracts requiring ?@E:46D7@C2==@?6E@7@FCD:?8=672>:=JC6D:56?46D2?524@FCE6DJ?@E:467@C a California Type B Contractor’s License. Questions regarding this solicitation are to be directed to Robert Estrella, Public Works Project Manager, at 2==@E96CEJA6D@7AC@A6CE:6D $%) )%&%)$) " '( 7J@F2C6 4@?D:56C:?83:55:?8@?E9:DAC@A6CEJ=:6?J@FD9@F=5F?56CDE2?5E92EE96C6 [email protected]. All questions must be in writing, submitted via email by November 12, 2019 at 11:00 AM. Responses will be posted 2C6 C:D2E:42==J 6?E:E=6 J@F E@ 7C66 2?5 4=62C @H?6CD9:A @7 E96 Tuesday, November 19, 2019 and shall be submitted to the attention of the City Clerk with the envelope clearly labeled “Harrison Memorial Library AC@A6CEJ .@FD9@F=52=D@362H2C6E92EE96=:6?36:?82F4E:@?65@77>2J36 Meeting Room Remodel Invitation for Bids 19-20-006-Re-Bid” and showing the name of the Contractor. 2;F?:@C=:6? 7J@F2C6E969:896DE3:556C2EE962F4E:@?J@F2C6@C>2J36 C6DA@?D:3=6 7@C A2J:?8 @77 2== =:6?D D6?:@C E@ E96 =:6? 36:?8 2F4E:@?65 @77 367@C6 J@F 42? C646:G6 4=62C E:E=6 E@ E96 AC@A6CEJ .@F 2C6 6?4@FC2865 E@ Bid may be hand delivered or mailed as follows: :?G6DE:82E6 E96 6I:DE6?46 AC:@C:EJ 2?5 D:K6 @7 @FEDE2?5:?8 =:6?D E92E >2J 6I:DE @? E9:D AC@A6CEJ 3J 4@?E24E:?8 E96 4@F?EJ C64@C56CD @77:46 @C 2 E:E=6 :?DFC2?46 4@>A2?J 6:E96C @7 H9:49 >2J 492C86 J@F 2 766 7@C E9:D US Post Office FedEx/UPS/ Courier Service or Hand Delivery :?7@C>2E:@? 7 J@F 4@?DF=E 6:E96C @7 E96D6 C6D@FC46D J@F D9@F=5 36 2H2C6 City of Carmel-By-the-Sea City of Carmel-By-the-Sea E92EE96D2>6=6?56C>2J9@=5>@C6E92?@?6>@CE8286@C5665@7ECFDE@? City Clerk OR City Clerk E96 AC@A6CEJ $%) )% &'%&'). %,$' )96 D2=6 52E6 D9@H? @? P.O. Box CC East side of Monte Verde Street between Ocean & 7th Avenues E9:D?@E:46@7D2=6>2J36A@DEA@?65@?6@C>@C6E:>6D3JE96>@CE82866 36?67:4:2CJECFDE66@C24@FCEAFCDF2?EE@(64E:@? 8@7E962=:7@C?:2 Carmel-by-the-Sea, CA 93921 Carmel-by-the-Sea, CA 93921 :G:= @56 )96 =2H C6BF:C6D E92E :?7@C>2E:@? 23@FE ECFDE66 D2=6 A@DEA@?6>6?ED36>2562G2:=23=6E@J@F2?5E@E96AF3=:42D24@FCE6DJE@ E9@D6?@EAC6D6?E2EE96D2=6 7J@FH:D9E@=62C?H96E96CJ@FCD2=652E692D Bids will be publicly opened at the City Hall Council Chambers, located on the eastside of Monte Verde Street between Ocean and Seventh 366? A@DEA@?65 2?5 :7 2AA=:423=6 E96 C6D4965F=65 E:>6 2?5 52E6 7@C E96 Avenues, at 2:00 PM on Tuesday, November 19, 2019. Bids received after the stated deadline will be returned unopened. D2=6@7E9:DAC@A6CEJJ@F>2J42== @CG:D:EE9:D ?E6C?6E,63 D:E6 9EEA HHH ?2E:@?H:56A@DE:?8 4@> FD:?8 E96 7:=6 ?F>36C 2DD:8?65 E@ Bid E9:D42D6 ?7@C>2E:@?23@FEA@DEA@?6>6?EDE92E2C6G6CJD9@CE Bids must be accompanied by a ten percent (10%) bid bond, certified check, or cashier’s check payable to “City of Carmel-by-the-Sea.” :? 5FC2E:@? @C E92E @44FC 4=@D6 :? E:>6 E@ E96 D4965F=65 D2=6 >2J ?@E bonds shall be in original form (no fax or photocopy) and executed by the Bidder and an acceptable surety. Bids shall be in accordance with the prevailing :>>65:2E6=J36C67=64E65:?E96E6=6A9@?6:?7@C>2E:@?@C@?E96 ?E6C?6E,63 hourly rate of per diem wages for this locality and project as determined by the State of California, Department of Industrial Relations, pursuant to California D:E6 )96 36DE H2J E@ G6C:7J A@DEA@?6>6?E :?7@C>2E:@? :D E@ 2EE6?5 E96 Labor Code Sections 1770, 1773, and 1782. D4965F=65D2=6 2E6 &"#"%$#$#$)('+ ( $ 2D )CFDE66 &9@?6 $ (64@?5 (EC66E 2>A36== 2=:7@C?:2 =:K236E9 @536J +:46 &C6D:56?E &"# "%$ Per Sections 1725.5, 1771.1, 1771.3, and 1771.4 of the Labor Code, this project is subject to compliance monitoring and enforcement by the #$#$) ('+ ( $ ( ) %"")%' ))#&) $ All Contractors and Subcontractors shall be listed in the bid proposal, subject to the requirements of Section 4104 )% %"") ) $. $%'#) %$ %) $ , "" *( Department of Industrial Relations. %' )) &*'&%( $&& )@ '#" & $ %$ of the Public Contract Code, and shall be currently registered to perform public work pursuant to Section 1725.5 of the Labor Code. Publication date: Oct. 25, Nov. 1, 2019 (PC1040) Publication dates: Nov. 1, 8, 15, 2019. (PC1104) 40A The Carmel Pine Cone November 1, 2019

ranch and toasted pecans, turkey fricassee MORE FOOD with mushrooms and bacon, long-cooked From page 37A greens, skillet cornbread and cupcakes. Founded by Big Sur Bakery & Restau- rant chef Philip Wojtowicz and Big Sur making whisky from their surplus grain for Roadhouse chef Brendan Esons, Poppy centuries. Alexander Reid, a barley farmer Hall “is a community gathering place serv- and schoolteacher, founded the company ing unique rustic California food for the that makes The Macallan in 1824. It was soul” nightly, as well as during weekend one of Scotland’s first licensed distillers brunch from 10 a.m. to 2 p.m. and is highly respected today, with some For reservations, call (831) 204-9990 or of its more aged offerings, like the 18-year go to poppyhallpg.com. and 25-year whiskies, fetching high prices and being difficult to acquire. Tom Tobar, western regional manager QBeer beer beer beer for Edrington — the company that owns Edgar’s Restaurant in the Quail Lodge The Macallan and describes it as “the clubhouse at 800 Valley Greens Drive will #$&+"+"+#"'%*+''%&&+ world’s most precious single malt whis- celebrate “Beer, Sausage, Cheese, Prost!” ky” by which all others must be judged — Nov. 7-10, with specials on cold beers and will pour a selection of Scotches perfectly traditional German fare every evening #!+'+ paired with the four-course dinner the culi- from 5 to 9 p.m. Reservations are required nary team at the Portola Hotel has created. for dining. Visit quaillodge.com/edgars. #"#(%&++ "+ %+"'(&&'&+ The evening will begin with socializing and a sip of The Macallan Sherry Cask 12 +'#+'+#"'%*+""&( + Year, after which guests will sit down for QBubbly dinner at Highlands Monterey Mattress Marquee traditional “white pudding” with apple and California Market at Pacific’s Edge will chestnut paired with 12 Year Double Cask, hold its final “Forks Corks Action” wine- proudly Supports then Scotch egg with arugula and 15 Year maker dinner of the year when executive Triple Cask, followed by wild Scottish chef Chris Vacca pairs his excellent food game birds paired with Rare Cask. The with exceptional champagne from Perri- dinner will wrap up with cheeses, quince er-Jouet and G.H. Mumm in the restau- and Scottish tablet served with The Macal- rant’s famous wine room Nov. 7. lan 18. The four-course dinner will begin at 6 Dinner is $125 per person and reserva- p.m. with a glass of G.H. Mumm Brut and tions are required. Call (831) 649-7874. fried oysters and deviled eggs, followed by in their mission to stimulate the local economy and The Portola Hotel is located at the foot of a sit-down dinner in the wine room, start- Alvarado Street in Monterey. ing with Perrier-Jouet Blanc de Blancs and donate event proceeds to support local nonprofits, warm Laura Chanel goat cheese on crosti- benefiting Health, Safety, Education and Arts in Big Sur. Q45 rpm party ni with tarragon, orange oil and figs. Perri- at Poppy Hall er-Jouet Brut will be served with hamachi Please join us this year! crudo, and G.H. Mumm rosé will be paired Poppy Hall restaurant at 589 Light- with Vacca’s Duck Duo — lacquered duck #%++##+'&+ $+ house Ave. in Pacific Grove will present breast, duck confit dumplings, sunchoke November 7-9, 2019 “45 Live! A Prix-Fixe Record Party” Nov. purée, bok choy and mushrooms. For the &+#"'%*+''%&&+'+ 7 from 6 to 9 p.m. final course, Perrier-Jouet Belle Epoque bigsurfoodandwine.org That evening, while DJ Leo “spins from will be poured alongside local berries and )+#"'%*+''%&&+#!+ his vast collection of ultra-rare 45s and dis- sabayon. For a Good Nights Sleep see Monterey Mattress at plays vintage multi-media projections,” the Dinner costs $130 per person, including restaurant will offer a $45 prix-fixe menu tax and tip. Reservations are required and Gingerich-Built.com | 831-899-5464 that should be a good match for 1960s must be made through Eventbrite.com. The soul, with garden salad with homemade inn is located at 120 Highlands Drive.

$1495 Anniversary Savings make this the perfect time to furnish your home for the holidays. Come in today.

Champion LLEGACEGACY Maximus . . . Sofa Elegant Cal-King Canopy Bed • Includes headboard, footboard, rails, canopy $ 1295 FINE HOME FURNISHINGS

MONDAY - SATURDAY 10-7, SUNDAY 11-6 422-1500 1228 SOUTH MAIN STREET, SALINAS, CA (where Highway 68 turns into Main Street) Rhapsody . . . Photographs for illustration only. Six-Piece Sectional with Three Power Recliners $3899

$ Burton Sofa 899 November 1, 2019 The Carmel Pine Cone 41A QGroovin’ on a Sunday afternoon Danko Drusko, and will showcase violinist Rose Vinn, MUSIC the winner of its 2019 concerto competition. From page 32A If you like classical or Celtic music, Sunday afternoon Tickets are $19 for general admission, $9 for seniors offers three enticing options. and $4 for children. Sunset Center is located at San Carlos At Hidden Valley Music Seminars at 3 p.m., the Mon- and Ninth. For more details, call (831) 375-1992. terey County Composers’ Forum presents “Still Life with The same afternoon at 4 p.m., Alasdair Fraser and album, “Love Fell On Me,” which featured a cameo by Cello,” when a member of San Francisco’s experimental Natalie Hall take the stage at the International School of Wonder and wowed the critics. Friction String Quartet, cellist Douglas Machiz — along Monterey in Seaside. Fraser is one of Scotland’s premier Sheléa is co-starring in a biopic on the legendary gos- with others — will play music by an assortment of local fiddlers, while Hall is a gifted cellist from California. To- pel group, the Clark Sisters. Titled “The First Ladies of composers, including Carleton Macy, Edward Mon- gether, they have recorded five albums that have stretched Gospel,” the miniseries is set to be released in January. crief, Hana Ettinger, Steve Ettinger and Paula Kaiser. the boundaries of Celtic music. The concert is presented Earlier this year, Sheléa released her third LP, “Pret- A reception follows the show. Tickets are $10. Hidden by the Seaside nonprofit, Palenke Arts. ty Things,” which pays tribute to the songwriting team of Valley is located at Carmel Valley and Ford roads. Tickets are $20 for adults and $12 for students and se- Alan and Marilyn Bergman. Also Sunday at 3 p.m., Youth Music Monterey kicks off niors. The school is located at 1720 Yosemite Street. Showtime is 8 p.m. Tickets are $39 to $59. Sunset Cen- its new season with a concert at Sunset Center. The event ter is located at San Carlos and Ninth. Call (831) 620-2048. marks the debut of the nonprofit’s new music director, See MORE MUSIC page 43A The SPCA for Monterey County CALENDAR Kitties of the Week

Bronco Bronco is a wild and adven- Nov. 4 — “Delicious & Easy Holiday Dinners for Busy has been canceled. Visit www.carmelorchidsociety.org turous kitty looking for new Hosts/Hostesses” will be presented by gourmet chef 1 year old Nov. 9 — Asilomar Neighborhood Artisan Fair, 11th and exciting things! He is Joan McHenry at the Carmel Woman’s Club, 2 p.m., Ninth annual craft fair (Nov. 10 if rain), 9 a.m. to 3 p.m. at 1150 Pico going to need the ultimate & San Carlos, Carmel. The public is invited. McHenry, a buck-a-roo to understand $YH3DFLƓF*URYH$OOKDQGPDGHFUDIWVIURPZRRGZRUNLQJ and love him for the rest of hostess known for putting on large fundraising dinners at WR MHZHOU\ WR ZUHDWKV %DNH VDOH DQG KRW FLGHU WR EHQHƓW home will share time-saving prep methods and distribute his life. Are you the one for Peace of Mind Dog Rescue, with dogs on site for adoption. him? copies of her coveted make-ahead recipes. There will also be some tastings. Members, free; guests $10, includes recipe Nov. 9-10 — “Of Artistry & Angels” … Baum & Blume’s Who doesn’t handouts and coffee/tea reception immediately following 2019 Holiday Extravaganza! 11-7 p.m. Shop for Simba 12 years old love a senior pet? the program. (831) 624-2866 or 915-8184. handcrafted holiday gifts while enjoying free hosted wine They are sweet, tastings, live music, hors d’oeuvres, live and chef’s kitchen Nov. 6 — Community Night with the Library program, wise, gentle, and demonstrations. Handmade gourmet products for sale too! Cognitive Reserve: Maintaining Cognitive Function extremely cuddly. Baum & Blume and The Carriage House, 4 El Caminito Rd, Simba has all these into Late Adulthood, 7 p.m. in Carpenter Hall, Sunset Carmel Valley. 659-0400 qualities and more. Center. Guest speaker Dr. Quinn Kennedy will show Come see him, you you strategies for staving off age-related declines in Nov. 21 — Carmel City Administrator Chip Rerig and might find love today. cognitive function. Hosted by the Carmel Public Library Planning Director Marc Weiner will discuss the “State Call us at (831) 373-2631 )RXQGDWLRQ &RVW )UHH VHDWLQJ ƓUVWFRPH ƓUVWVHUYH of the Village,” 5 p.m. at Carpenter Hall at Sunset Center, for more information about adopting Bronco & Simba $10 suggested contribution. Questions? afallon@ Carmel-by-the-Sea. This program, presented by the Carmel Sponsored by Friends of All Cats carmelpubliclibraryfoundation.org or (831) 624-2811 Residents Association, is free and open to the public. Wine and social hour will follow. Nov. 8 & 9 — Carmel Orchid Society’s Fall Orchid Festival: “Your SPCA Vet Clinic offers low-cost, high-quality spay/neuter for dogs ($100), and for cats ($25). We also offer walk-ins for vaccines Due to circumstances beyond their control this annual event ($20) and microchips ($25). Call (831) 264-5400 to make your appointment today. No appointments are required for vaccines and microchips! To advertise, email [email protected] $0.50 per word ($25 min. charge) • Add a photo for your event for only $25 • www.SPCAmc.org

up to OFF* Recliners from $349 Reclining Sofa $499

12 MONTHS NO INTEREST*OAC Queen Size Storage Bed 0UJS\KLZOLHKIVHYK MVV[IVHYKHUKYHPSZ $ 595 Sofa $399

1467 North Davis Road, Westridge Shopping Center, Salinas 771-1780 Monday through Saturday 10:00 A.M. until 7:00 P.M., Sunday 11 A.M. until 6:00 P.M.

Over 30 Years as the Premier (SSÄUHUJPUNVɈLYZ^P[OUVPU[LYLZ[HUKVYUVWH`TLU[ZYLX\PYLJYLKP[HWWYV]HSHTPUPT\TW\YJOHZLHUKH KV^UWH`TLU[:LLZ[VYLMVYKL[HPSZ5V[PUJVUQ\UJ[PVU^P[OHU`V[OLYVɈLY(SSZHSLP[LTZZ\IQLJ[[VH]HPSHIPSP[` La-Z-Boy® Retailer in Monterey County HUKL_JS\KLJSLHYHUJLP[LTZ7OV[VNYHWOZHYLMVYPSS\Z[YH[PVUW\YWVZLZVUS` 42A The Carmel Pine Cone November 1, 2019 SERVICE DIRECTORY DeadlineDeadline: Monday, 1 p.m. • Email your ad to: [email protected] NOTICE: SERVICE DIRECTORY ADS ARE ACCEPTED ONLY BY EMAIL.

Z ARCHITECT Z CHIROPRACTIC Z ELECTRICAL CONTRACTOR Z GARDEN•LANDSCAPE•IRRIGATION CASTRO Carmel Valley Electric Inc. ADAN’S CHIROPRACTIC ServingS the Peninsula since 1960 LANDSCAPE - MAINTENANCE Se Habla Español Residential/Commercial, Residential/Commercial Su Vecino Courtyard-Upstairs Service Repairs Automatic Sprinklers & Irrigation Systems Dolores St. between 5th & 6th Remodels, Custom Homes New Sod or Seed Carmel-by-the-Sea, CA 93923 LED Lighting, Yard Lighting & Solar New Fences & Repair * Retaining Walls * Hauling CA Certified Electricians • Lic. # 464846 Ornamental Trimming & Tree Pruning 714.313.5558 Dr. Oscar Castro www.oscarcastrochiropractic.com (831) 659-2105 Pavers & Stamped Concrete Let Me Help You with Your Active Lifestyle Credit Cards Accepted General Yard Clean-up, and etc. ~ FREE ESTIMATES ~ Z CONSTRUCTION/REMODEL Z FENCES AND DECKS Over 20 years exp. - References Proudly Given Lic. # 949011 Tel: (831) 601-9225 Lifestyle- It’s time for a change! ON-LINE FFENCEENCE Caribou Construction Co. All Types & Styles EXPRESSLY CARMEL DESIGN - BUILD - REMODEL New & Repairs Gates, Power Washing,ng, SealSealinging GARDEN SERVICE Serving Carmel & the Entire Central Coast Since 1979 ART SERVICES Unparalleled Customer Service - Uncommon Professional Results Call Jimmy (831) 915-355715-3557 Z Custom Homes Kitchens Hardwood Floors Fireplaces Lic. # 830762 Remodeling Bathrooms Doors Porches/Decks 831-620-5436 Additions Cabinetry Windows Fences/Gates ILLUMINATION STUDIO Interior Design Granite/Marble Plastering Patios/Trellises Z FIREWOOD Professional - Trustworthy - Punctual - Clean - Affordable OAK FIRE WOOD Z GROCERY DELIVERY 624-1311 FREE ESTIMATE Quality, well split dry oak, delivered. ART SERVICES California State License # 385545 (831) 601-9728 TF CARMEL A+ Rating BETTER BUSINESS BUREAU www.caribouconstruction.com MARKET & DELI GRAPHICS www.BBB.org/SanJose/ FIREWOOD GROCERY DELIVERY MONDAY - FRIDAY DESIGN OAK, PINE or EUCALYPTUS SPLIT & DELIVERED LOCALLY Orders taken over the phone Magazine Ads . Presentations RANDAZZO ENTERPRISES, INC. Call by 11am for same day delivery Newspaper Ads . Websites (831) 633-4420 Delivering to the Peninsula . . Portfolios Maps Books 831-624-3821 831-264-7858 FIREWOOD www.illumination.studio HANDYMAN DRY OAK Z Split and Delivered. HONEY DO LIST? BOOKKEEPING/ACCOUNTING Free delivery. Carpentry, Painting, Interior/Exterior, Repairs, Z Doors & Windows, Fences, Gates, Posts, Sid- BUILDER BY THE SEA (831) 385-5371 ing, Shelving, Cabinets, Carpentry, Roof Debris, Liz Passanisi Custom Homes – Estates Plumbing/Electrical Repairs, Drywall/Paint Re- pairs, Gutter/Roof Cleaning. JOHN QUINN (831) LEAVE THE Remodels – Additions Get your complete Pine Cone by email 402-1638 Lic. #821763 / Bonded BOOKKEEPING TO US. Building Custom Estates to Kitchen & Bath Free subscriptions at www.carmelpinecone.com Office management/bill paying/bookkeeping. Remodels, Carpentry, Concrete, Stone, Tile, Doors HANDYMAN SERVICE Monthly or hourly rates available. Windows, Decks, Plastering, Hardwood Floors, etc.! Electrical, plumbing, carpentry, painting and We also provide construction management. Quickbooks in your home or office. FLOOR CLEANING more! No Job Too NoSmall Job - CONTRACTOR to Small ON SITE Z Making Your Life Easier! 831.917.3962 Licensed, bonded and insured contractor Carmel, CA #889019. Call 831-238-8289 CA Lic# B803407 Call John (831) 595-9799 TF Z CABINETRY DIRTY HAULING AMBROSE POLLOCK Z CABINETRY, FURNITURE & MILLWORK FLOORS? TRASH IT BY THE SEA Handmade furniture, cabinetry, fine woodwork- LOORAM BUILDERS Hauling is my calling. Yard waste and house- ing since 1979 by craftsman Ambrose Pollock. OVER 40 YEARS EXPERIENCE ACROSS PENINSULA Professional Cleaning at Affordable Prices hold debris. Call Michael (831) 624-2052 or Millwork welcomed, wide belt sanding service ͻĂƚŚͻ<ŝƚĐŚĞŶͻĚĚŝƟŽŶƐ Stone • Tile & Grout • Vinyl (831) 521-6711. TF ZĞŵŽĚĞůƐͻ&ƌĞĞƐƟŵĂƚĞ available, repairs on valued antiques, slabs Call Steve today for a free estimate! and local woods available at our local shop ĞƐŝŐŶǀĂŝůĂďůĞ Z HOUSE CLEANING at 26550 Rancho San Carlos Road, Carmel. • CSL#469152 CALL: 831-624-5043 (831) 899-5613 Licensed state contractor #409836, bonded, insured, “old school” service and guarantee. Call Lily’s House Cleaning 831.625.6554, email [email protected] FURNISHINGS & FINE GIFTS Excellent References Available. and website carmelfurnituremaker.com . TF Z 20 Years Experience. Reliable and Thorough Cleaning Reach the people who need (831) 917-3937 (831) 324-4431 your service for as little as $20 per week. Put The Carmel Pine Cone to work for you! TWO GIRLS DEADLINE: Monday 1 p.m. • Email [email protected] FROM CARMEL Artist Made Original + Limited Edition Experienced • Professional Fine Furnishings & Accessories Friendly Touch for 30 years CARETAKER Fine Art — Fine Gifts Z BONDED HOUSECLEANING LOOKING FOR A LOCAL HOMESITTER/ 5TH AVE & SAN CARLOS SPECIALISTS CARETAKER for your home? Call Joel at (610) CARMEL-BY-THE-SEA 816-8867. 10 years experience. Information So Many Dust#VOOJFT 831-626-4426 (831) 293-8190 • SHOP ONLINE OR IN-STORE So Little Time TwoGirlsFromCarmel.com upon request. TUESDAY - SATURDAY 10AM-5PM Lewellen Built Marcos’ House Cleaning Service Z CARPET CLEANING SUNDAY-MONDAY: BY APPOINTMENT GENERAL CONTRACTOR • CUSTOM CABINETS Residential/Commercial/Move-outs Paul Lewellen 831.917.4698 Windows • Pressure Washing Construction Cleaning • Vacation Homes DRYGREEN [email protected] • CA Lic#1010385 Z GARAGE DOOR Offices • Floor Cleaning • Strip & Wax Carpet & Upholstery Cleaning (831) 264-3697 Serving the Monterey Peninsula for 18 years! CA LIC 658346 Free Estimates • Guaranteed Jobs • Lic. 342947 Deadline: 1 p.m. Monday A-1 OVERHEAD Non-Allergenic • Low Moisture Cleaning INTERIOR DESIGN Specializing in: Email your ad to: DOOR CO. Z Pet Odor/Stains, Red Wine Spills, Coffee, and Soda [email protected] Serving Monterey & Santa Cruz Counties Since 1969 Safe for Kids and Pets Sales, Repairs & Service of Garage Doors & Garage Door Openers Insured • Residential • Commercial NOTICE: Service Directory ads are www.drygreen.biz Family owned & operated • Free estimates accepted ONLY by email. (831) 655-2176 • (800) 969-8821 831-210-9471 www.aonedoor.com Z GARDEN•LANDSCAPE•IRRIGATION NOTICE TO READERS: California law requires that contractors taking jobs that total $500 or more (labor or materials) be licensed by the Contractors State License Board. State law also MATIAS GARDENING requires that contractors include their license number on all advertising. You can check the status Full Tree Service • Poison Oak Removal of your licensed contractor at www2.cslb.ca.gov or 1-800-321-CSLB. Unlicensed contractors Garden Maintenance & Planting taking jobs that total less than $500 must state in their advertisements that they are not licensed Fence Construction/Repair • Hauling by the Contractors State License Board. The PUBLIC UTILITIES COMMISSION requires household 19 Yrs Experience • Excellent references movers to include their PUC license number in their ads. Contact the PUC at [email protected] (831) 800-6520 Service Directory continues on next page November 1, 2019 The Carmel Pine Cone 43A

Fernwood Resort in Big Sur — Songs Hotbox Har- tionov (jazz, Sunday at 10 a.m., Monday through Thurs- MORE MUSIC ry Taught Us (“Big Sur country,” Friday at 10 p.m.). On day at 8 p.m.). 26270 Dolores St., (831) 625-9040. From page 41A Highway 1, 26 miles south of Carmel, (831) 667-2422. Sunset Lounge at Hyatt Carmel Highlands — singer Fireplace Lounge in the Hyatt Regency Monterey Neal Banks (pop and rock, Friday at 7 p.m.); and singer Hotel — singer Lauri Hofer, guitarist Mike Lent, bass- and pianist Dino Vera (jazz, blues and r&b, Saturday at 7 Live performances Nov. 1-7 ist Zach Westfall and drummer David Morwood (jazz, p.m. and Thursday at 6 p.m.). 120 Highlands Drive, (831) Q Friday at 7 p.m.); and guitarist Mike Lent, saxophonist 620-1234. Barmel — Drifting Compass (rock, Friday at 7 p.m.); Ben Herod, bassist Zach Westfall and drummer David Terry’s Lounge at Cypress Inn — singer and pianist and singer-songwriter Emmanuel Selassie (reggae and Morwood (jazz, Saturday at 7 p.m.). 1 Old Golf Course Dino Vera (jazz, blues and r&b, Friday at 7 p.m.); pia- jazz, Saturday at 7 p.m.). In Carmel Square at San Carlos Road, (831) 372-1234. nist Gennady Loktionov and singer Debbie Davis (cab- and Seventh, (831) 626-3400. Folktale Winery in Carmel Valley — singer-song- aret, Saturday at 7 p.m.); Andrea’s Fault (jazz and blues, Cibo Ristorante Italiano in Monterey — The Lang- writer Lou Evans (Friday at 5 p.m.); singer-songwriter Sunday at 11 a.m.); guitarist Richard Devinck (classical, street Band (soul and r&b, Friday at 9 p.m.); Paciﬁc Talmon Owens (Saturday at 5 p.m.); and singer-songwrit- Sunday at 6 p.m.); and singer Lee Durley and pianist Joe Groove (rock and funk, Sunday at 7 p.m.); singers Lee er Rob Armenti (Sunday at 2 p.m.). 8940 Carmel Valley Indence (jazz, Thursday at 6 p.m.). Lincoln and Seventh, Durley and Scotty Wright (jazz and swing, Tuesday at Road, (831) 293-7500. (831) 624-3871. 7 p.m.); Andrea’s Fault (jazz and blues, Wednesday at 7 The Inn at Spanish Bay in Pebble Beach — The Jazz The Trailside Cafe in Carmel Valley — singer and p.m.); and The Ben Herod Trio (jazz and swing, Thursday Trio (jazz, in the lobby, Friday and Saturday at 7 p.m.); guitarist Rick Chelew (folk, Friday at 6 p.m.); and sing- at 7 p.m.). 301 Alvarado St., (831) 649-8151. and The Dottie Dodgion Trio (jazz, Thursday at 7 p.m.); er-songwriter Pythias Braswell (Saturday at 6 p.m.). 3 East Village Coffee Lounge in Monterey — sing- also, a bagpiper plays every evening at sunset. 2700 17 Del Fino Place, (831) 298-7453. er-songwriter Renee Wahl with drummer David Strayer Mile Drive, (831) 647-7500. Wild Fish restaurant in Paciﬁc Grove — singer and (Friday at 7 p.m.); Grumbling Ginger (folk rock, Satur- Mission Ranch — singer and pianist Maddaline Ed- guitarist Andrea Carter and saxophonist Ben Herod day at 7 p.m.); The Gary Meek Quartet (jazz, Sunday at strom (jazz and pop, Friday, Saturday and Sunday at 5 (jazz, Friday at 6 p.m.); and guitarist Grover Coe and 5 p.m.); and Open Mic Night (Wednesday at 7 p.m.). 498 p.m.); singer and pianist David Kempton (jazz, Monday trombonist Craig Jardstrom (jazz, Sunday at 12:30 p.m.). Washington St., (831) 373-5601. through Thursday at 5 p.m.); and pianist Gennady Lok- 545 Lighthouse Ave., (831) 373-8523.

SERVICE DIRECTORY

Z INTERIOR DESIGN Z ROOFING Z TREE SERVICE Z WINDOW CLEANING 20 Years of Experience IVERSON’S TREE SERVICE JB Window Cleaning JC Penney’s 0DQ\6DWLVÀHG&XVWRPHUV In-Home Custom Design & STUMP REMOVAL Residential & Commercial Window Treatments • Custom Pillows/Cushions Complete Tree Service Mirrors - Screens - Solar Panels - Graffiti Bedding & Accessories Fully Insured Skylights - Rain Gutters - Hard Water Stains Complimentary consultations with all the top brands Specializing in: Lic. # 677370 Jorge Bracamontes 831.601.1206 Call your Monterey Bay design consultant today "TILE ROOF Call (831) 625-5743 Cell phone: 469.971.6062 "SLATE ROOF WWW.JBWINDOWCLEANING.NET "COMPOSITION MOBILE DOG GROOMING "TORCH DOWN LICENSE #1045785 Z "WATER PROOFING Z WINDOW CLEANING Z WINDOW & FLOOR COVERINGS ASK FOR OUR SUMMER SPECIAL SHELLEY’S MOBILE GROOMING SERVICE "ROOF COATING FREE ESTIMATES! Since 2000 "METAL ROOFS “Dogs’ stamp of approval!” "GUTTERS Call (831) 998-7775 Del Mar Window Cleaning Rod Woodard – Interiors Full "LIGHTWEIGHT CONCRETE DECKS Window & Floor Coverings, Since 1986 service for Let the light shine in "CUSTOM METAL FABRICATIONS ROD WOODARD, OWNER all ages, sizes & Prestigeroofingandsheetmetal.com Israel Lagunas Owner Free In-Home Shopping Shelley Serrano breeds Miguelprestigeroofi[email protected] (831) 625-5339 530.680.4887 (831) 521-0570 Carmel, CA carmelgoingtothedogs.com [email protected] 25270 Allen Place, Carmel CA 93923 Z MOVING J & M MOVING AND STORAGE, INC. We can handle all your moving and storage needs, local or nationwide. Located in new 20,000 sf Castroville warehouse. We specialize in high-value household goods. Excellent referenc- RoofingRfi & &SlPftd Solar Perfected es available. MTR 0190259, MC 486132. Call Jim Stracuzzi at (831) 633-5903 or (831) 901-5867. (831) 375-8158

ZZZGRULW\URR¿QJFRP Lic. #728609 SERVICE DIRECTORY DEADLINE: MONDAY 1 PM • EMAIL: [email protected]

Z PAINTING INTERIOR License # 710688 67 YEARS SERVING YOUR ROOFING NEEDS EXTERIOR POWER WASHING FAUX FINISHES Roof and ground mount systems (831) 394-8581 P.O. Box 4691 C-(831) 238-1095 ROSSROOFING1950.COM Carmel, CA 93921 (831) 622-7339

Z SOLAR PANEL CLEANING WILL BULLOCK PAINTING & RESTORING over 37 years on the Peninsula NEW SHINE SOLAR Exteriors and Interiors • Historical and Remodel Solar Panel Cleaning Residential Specialist • Many Local References 831.625.3307 cell 831.277.8952 Free Lic. #436767 BBB EPA certiﬁed estimates Z PERSONAL ASSISTANT Jeff Ellis, owner STAY INDEPENDENT Licensed with Your Personal Assistant & Insured *See our ad in this paper [email protected] CALL 831-915-4001 831-596-7591 TREE SERVICE Your Gal Friday Z Let me help you tackle your To Do List: Shop, cook, garden, organize cupboards – garages, holiday preparation ... whatever you need done. Let’s simplify your life together. Local References & Reasonable Rates [email protected] 831-277-6776 Z PIANO GILROY PIANO OUTLET QUALITY & LOW COST FREE DELIVERY COMPLETE NEW PIANOPIANO STORE STORE with this AD SALES • RENTALS • LESSONS TREE SERVICE SALES - RENTALS - CONSIGN Digital Hybrid Pianos KAWAIKAWAI - STEINWAY • YAMAHA - YAMAHA Trimming, Topping, DIGITAL HYBRIDS Large Selection of Used Pianos Removal, Oak and Pine SMART PLAYER SYSTEMS Open Mon-Tues-Thurs-FriPlease Call or Check 10 Website am to 3 pmfor firewood & more. We pay for news photos! SaturdaySTORE 10-5 HOURS • Sunday or 1-5 for Closed Appointments Wednesday We beat any bid. Free estimates. The Carmel Pine Cone will pay up to $50 for photos of newsworthy events around the Monterey Peninsula. First time 10% OFF 408-767-2990 • 8401 Church Street/Welburn Bonded & ensured. Submit yours to [email protected] See Our Website for Bargains & Inventory Payment made for photos accepted for publication. Lorem ipsumWWW.GILROYPIANOOUTWWW.GILROYPIANOOUTLET.COMLET.COM Lic. #1031715 831.402.2746 44A The Carmel Pine Cone November 1, 2019 Mercedes-Benz of Monterey Express Price Specials Mercedes-Benz Certified Pre-Owned Details: Includes Trip Interruption Reimbursement and 7 days/500 miles Exchange Privilege • 165 Point Inspection Limited Warranty: 12 Month/Unlimited Mile beginning after new car warranty expires or from certified purchase date Transferable Warranty • Vehicle History • Roadside Assistance • Warranty Deductible: $0

Certified Pre-Owned Certified Pre-Owned 2014 Ford Explorer 2017 Mercedes Benz C63 Coupe 2016 Mercedes Benz GLE350 4Matic vin # 1FM5K8GT2EGA04575 STOCK# 10529 vin # WDDWJ8GB3HF435414 STOCK # 10530 vin# 4JGDA5HB5GA765125 STOCK# 10455 Express Price $18,897 Express Price $59,388 CPO Express Price $33,547 CPO

Certified Pre-Owned 2014 Mercedes Benz CLA250 4Matic 2017 E400 Coupe 2016 Mercedes Benz CLS400 vin # WDDSJ4GB8EN092981 STOCK #10457 vin# WDDKJ6FB4HF356418 STOCK# 10499 vin# WDDLJ6FB5GA175568 STOCK# 10469 Express Price $14,548 Express Price $37,598 Express Price $36,898 CPO

2018 Mercedes Benz GTC Roadster 2018 Mercedes Benz GT Roadster 2018 Mercedes Benz C63S Sedan vin # WDDYK8AA8JA015852 Stock # s9038 vin # WDDYK7HA5JA021396 Stock # 20015 vin # 55SWF8HB9JU266373 Stock # S9205 Express Price $145,988 Express Price $125,988 Express Price $74,988

Certified Pre-Owned Certified Pre-Owned Certified Pre-Owned 2018 Mercedes Benz SLC43 Roadster 2017 Mercedes Benz C63 Cabriolet 2016 Mercedes Benz CLA250 Sedan vin # WDDPK6GA6JF149611 STOCK#10503 vin # WDDWK8GB1HF518143 STOCK# 10532 vin # WDDSJ4GB2GN387514 Stock # 10410 Express Price $55,488 CPO Express Price $67,371 CPO Express Price $22,494 CPO

Certified Pre-Owned Certified Pre-Owned Certified Pre-Owned 2019 Mercedes Benz GLC300 2016 Mercedes Benz GLE350 4 Matic 2016 Mercedes Benz C300 Sedan vin # WDC0G4JB8KV123984 STOCK# 10510 vin # 4JGDA5HB0GA793401 STOCK # 10493 vin # 55SWF4JB4GU146718 Stock # 10394 Express Price $40,398 CPO Express Price $33,897 CPO Express Price $21,487 CPO WE’RE HIRING FOR ALL POSITIONS NOW! To apply, please go to montereymercedes.com/employment-application.htm

8+'9174'06+4' Mercedes-Benz of Monterey 0'924'190'& +08'0614;#6 498 FREMONT ST • MONTEREY • (831) 264-9888 /106'4';/'4%'&'5%1/ 2TKEGRNWUVCZGUIQXGTPOGPVHGGUCP[ƂPCPEGEJCTIGUFGCNGTFQEWOGPVRTGRGTCVKQPEJCTIGUCPFGOKUUKQPVGUVKPIEJCTIGU 8GJKENGUWDLGEVVQRTKQTUCNG/CPCIGT5RGEKCN1HHGTGZRKTGU