Tetron Treatment Limited
Waste Treatment Facility, Wharf Road
Environmental Setting and Site Design Report Document Ref:(66''HFHPEHU
AA Environmental Limited &KROVZHOO&RXUW 6KLSSRQ $ELQJGRQ 2;+; T F LQIR#DDHOWGFRXN ZZZDDHOWGFRXN
Document Control Report for Wharf Road Waste 7HWURQ7UHDWPHQW/LPLWHG Treatment Facility +D]GRU&RXUW Wheatley, Doncaster 'URLWZLFK6SD :RUFHVWHUVKLUH DN1 2ST :5 '5 Issued by
«««««««««««««« (%URZQ%6F +RQV 0&,:0 Approved by
«««««««««««««« 0-0/DZPDQ06F%6F +RQV Issue Date Issue 'HFHPEHU ),1$/ Document Reference (66'
AA Environmental Limited &KROVZHOO&RXUW 6KLSSRQ $ELQJGRQ 2;+; T F E LQIR#DDHOWGFRXN W ZZZDDHOWGFRXN
Registered Office (England and Wales) as above Company No. 8474322
Table of Revisions
$$(QYLURQPHQWDO/LPLWHG 7HWURQ7UHDWPHQW/LPLWHG :KDUI5RDG'RQFDVWHU
Contents Page No 1.0Introduction 1
2.0Source Term Characterisation 3
3.0 Pathway and Receptor Term Characterisation 6
DRAWINGS '(66' 6LWH/RFDWLRQ3ODQ '(66' (QYLURQPHQWDO6LWH6HWWLQJ '(66' &XOWXUDODQG1DWXUDO+HULWDJH '(66' 5HJLRQDO+\GURJHRORJ\ '(66' /RFDO+\GURJHRORJ\DQG+\GURORJ\ '(66' 3DWKZD\VDQG5HFHSWRUV ' 'UDLQDJH3ODQ ' 6LWH,QYHVWLJDWLRQ3ODQ APPENDICES $SSHQGL[$ (QYLURFKHFN5HSRUW $SSHQGL[% 6LWH,QYHVWLJDWLRQ/RJV $SSHQGL[& &KHPLFDO5HVXOWV *URXQGZDWHU $SSHQGL[' &KHPLFDO5HVXOWV 6RLO
$$(QYLURQPHQWDO/LPLWHG 7HWURQ7UHDWPHQW/LPLWHG :KDUI5RDG'RQFDVWHU
1.0 INTRODUCTION Report Context 7KLV &RQFHSWXDO 0RGHO (QYLURQPHQWDO 6HWWLQJ DQG 6LWH 'HVLJQ (66' UHSRUW KDV EHHQ SUHSDUHG E\ $$ (QYLURQPHQWDO /LPLWHG RQ EHKDOI RI 7HWURQ 7UHDWPHQW /LPLWHG KHUHDIWHU UHIHUUHGWRDVWKH2SHUDWRULQVXSSRUWRIWKHSHUPLWDSSOLFDWLRQWRDOORZWKHIROORZLQJRSHUDWLRQV LQIRXUGLVWLQFWDUHDV
x $UHD 3K\VLFDOWUHDWPHQWLQFOXGLQJZDVKLQJPHFKDQLFDOVRUWLQJVHSDUDWLRQDQGVFUHHQLQJ RIQRQKD]DUGRXVPLQHUDOZDVWHVIRUUHFRYHU\ 555 x $UHD :DVWH WUDQVIHUVWDWLRQ ZLWK WUHDWPHQW IRU QRQRGRURXVQRQKD]DUGRXV ZDVWHV IRU RQZDUGUHFRYHU\LQFOXGLQJSK\VLFDOWUHDWPHQWFRQVLVWLQJRIVRUWLQJVHSDUDWLRQVFUHHQLQJ FUXVKLQJDQGEOHQGLQJRIZDVWHIRUUHFRYHU\DVDVRLOVRLOVXEVWLWXWHRUDJJUHJDWH 55 55' '' DQG x $UHD $VEHVWRVVWRUDJHRQO\QRWH[FHHGLQJPRUHWKDQWRQQHVSHUGD\ ' 7KHVLWHLVLQQRUWKHUQFHQWUDO'RQFDVWHUDFFHVVHGYLD:KDUI5RDG 1DWLRQDO*ULG5HIHUHQFH 6( ,WLVERXQGHGWRWKHQRUWKDQGZHVWE\WKH5LYHU'RQDQGWRWKHVRXWKDQG HDVWE\LQGXVWULDODQGFRPPHUFLDOSURSHUWLHVDQGDUHFUHDWLRQDOSDUNWRWKHVRXWKZHVW7KHVLWH ORFDWLRQLVVKRZQLQGUDZLQJ'(66'
7KH(QYLURFKHFN5HSRUWVKRZVWKDWWKHHDVWHUQKDOIRIWKHVLWHDVZHOODVDELJDUHDDFURVV ULYHU'RQLVUHJLVWHUHGDVDKLVWRULFDOODQGILOO0RUHLQIRUPDWLRQRQKLVWRULFDOODQGXVHLVSURYLGHG LQVHFWLRQ
Site Details 7KHVLWHLVORFDWHGLQWKH QRUWKRIFHQWUDO'RQFDVWHULQ :KHDWOH\3DUN)XUWKHUVLWHORFDWLRQ GHWDLOVDUHSURYLGHGLQ7DEOHEHORZ7KHVLWHDFFHVVLVORFDWHGGLUHFWO\RII:KDUI5RDGWRWKH VRXWKRIWKHVLWH Table 1. Application Details Site Address :KDUI5RDG:DVWH7UHDWPHQW)DFLOLW\ :KDUI5RDG:KHDWOH\ 'RQFDVWHU'167 Site National Grid 6( Area KHFWDUHV Operator and Applicant 7HWURQ7UHDWPHQW/LPLWHG +D]GRU&RXUW +D]GRU 'URLWZLFK :RUFHVWHUVKLUH :5 '5 Access :KDUI5RDG Annual Tonnage &XPXODWLYHWRQQDJHLVWRQQHVSHU DQQXP $UHDOLPLWHGWRWRQQHVSHUDQQXP 7KHVLWHLVORFNHGDQGVHFXUHRXWVLGHRIZRUNLQJKRXUV7KHUHLVRQO\RQHDFFHVVHJUHVVLQ XVHDWDQ\RQHWLPH
7KHVLWHVHWWLQJDQGFRQWH[WLQUHODWLRQWRVHQVLWLYHHQYLURQPHQWDOUHFHSWRUV LQFOXGLQJFXOWXUDO DQGQDWXUDOKHULWDJH DUHSUHVHQWHGLQGUDZLQJV'(66''(66'DQG'(66'7DEOH RXWOLQHVVHQVLWLYHUHFHSWRUV 7KHQHDUHVWKRVSLWDOVDUHFLUFDNPZHVWRIWKHVLWH &KHVZROG3DUN+RVSLWDO DQGP VRXWKHDVW 'RQFDVWHU5R\DO,QILUPDU\
$$(QYLURQPHQWDO/LPLWHG 7HWURQ7UHDWPHQW/LPLWHG :KDUI5RDG'RQFDVWHU
Table 2. Sensitive receptor locations Receptor Distance Residential 3DUNLQVRQ6WUHHW PVRXWKHDVW :KDUI5RDG7HPSRUDU\$FFRPPRGDWLRQ PHDVW :KHDWOH\3DUN5HVLGHQWLDO$UHD PVRXWK PHDVW PQRUWKHDVW 'RQFDVWHU%HQWOH\5HVLGHQWLDO$UHD PQRUWKZHVW :LOORZ%ULGJH&DUDYDQ6LWH PQRUWKZHVW 5LYHUVLGH&DUHDQG6XSSRUW PHDVW +03'RQFDVWHU 'RQFDVWHU3ULVRQ PVRXWKZHVW Industrial/Commercial 5HF\FOLQJ6LWH PHDVW :DVWH6WRUDJHDQG+*9SDUNLQJ PVRXWK &DU'HDOHUVKLS PVRXWKHDVW &DU'HDOHUVKLS PVRXWKHDVW 9LFWRULD0LOO%XVLQHVV3DUN PQRUWKHDVW 'LVXVHGLQGXVWULDOFRPPHUFLDOVSDFH PVRXWK 4XHVW3DUN PQRUWKHDVW &KXUFKLOO3DUN PQRUWKHDVW &KDSSHO'ULYH YDULRXVLQGXVWULDOFRPPHUFLDOXVHH[WHQGLQJZHVW PZHVW ,QJV5RDG,QGXVWULDODUHD LQFOXGLQJUHF\FOLQJFHQWUHSXPSLQJVWDWLRQDQGE\SURGXFW PQRUWKZHVW SURFHVVLQJ Transport :KDUI5RDG PVRXWK &KXUFK:D\$ PVRXWKHDVW 6W*HRUJHV%ULGJH$ PVRXWKZHVW 5DLOZD\/LQHV PQRUWK PQRUWK PQRUWK PQRUWKZHVW $JULFXOWXUDO 9DULRXVILHOGVEH\RQGWKHGLVWDQFH PQRUWK Schools 'RQFDVWHU&ROOHJH PVRXWKZHVW 7RZQ)LHOG3ULPDU\6FKRRO PVRXWKHDVW 0LVWHUWRQ3ULPDU\ 1XUVHU\6FKRRO PVRXWK +DOO&URVV$FDGHP\ PVRXWK %RE&URV(GXFDWLRQ&HQWUH PVRXWK Priority Habitat %HQWOH\&RPPRQ /RFDO:LOGOLIH6LWH PQRUWK 2OG5LYHU'RQ2[ERZ /RFDO:LOGOLIH6LWH PZHVW %ODFN3RQG /RFDO:LOGOLIH6LWH PZHVW :KHDWOH\3DUNDQG2OG'RQ2[ERZV /RFDO:LOGOLIH6LWH PQRUWKHDVW %HQWOH\5DLOZD\(PEDQNPHQWVDQG3RQGV /RFDO:LOGOLIH6LWH PQRUWK 'HFLGXRXV:RRGODQG PQRUWK 5HHGEHGV PQRUWKHDVW &RDVWDODQG)ORRGSODLQ*UD]LQJ0DUVK PQRUWK Statutory Designated habitat/site (SSSIs, SACs, SPAs, Ramsar, NNRs, LNRs)* 6DQGDOO%HDW 666, PHDVW Recreation $OORWPHQW*DUGHQV PQRUWKHDVW 2SHQ)LHOG PVRXWKZHVW 'RQFDVWHU0LQVWHU PVRXWKZHVW 7RZQ)LHOGV PVRXWKHDVW Statutory Historic Buildings /RFNDW6WUDZEHUU\/RFN /LVWHG%XLOGLQJ PQRUWKHDVW &KXUFKRI6W0DU\ /LVWHG%XLOGLQJ PVRXWKHDVW :DOORI5RPDQ)RUW 6FKHGXOHG0RQXPHQW PVRXWKZHVW &OHUJ\+RXVH /LVWHG%XLOGLQJ PVRXWKZHVW 0LQLVWHU&KXUFKRI6W*HRUJH /LVWHG%XLOGLQJ PVRXWKZHVW )RUPHU:RROOHQ0DUNHW+DOOWRQRUWKRIWKH0DJGDOHQ+RWHO PVRXWK
$$(QYLURQPHQWDO/LPLWHG 7HWURQ7UHDWPHQW/LPLWHG :KDUI5RDG'RQFDVWHU
Receptor Distance 1HWKHU+DOO /LVWHG%XLOGLQJ PVRXWK 666, 6LWHVRI6SHFLDO6FLHQWLILF,QWHUHVW 6$& 6SHFLDO$UHDRI&RQVHUYDWLRQ 63$ 6SHFLDO3URWHFWLRQ$UHDV 115 1DWLRQDO1DWXUH 5HVHUYH /15 /RFDO1DWXUH5HVHUYH
2.0 SOURCE TERM CHARACTERISATION Historical Development 7KHHDVWHUQ KDOIRIWKHVLWHLVUHJLVWHUHGDVDQ($UHJLVWHUHGKLVWRULFODQGILOO ZKLFKH[WHQGV IXUWKHUHDVWLQWRWKHDGMDFHQWVFUDS\DUG7KLVODQGILOOLVUHJLVWHUHGWR&XWWV%URWKHUVDQGZDV IRUWKHGHSRVLWLRQRILQGXVWULDOFRPPHUFLDOKRXVHKROGDQGVSHFLDOZDVWHDQGOLTXLGVOXGJH1R IXUWKHUGHWDLOVDUHDYDLODEOH$Q($UHJLVWHUHGKLVWRULFODQGILOOLVORFDWHGGLUHFWO\ZHVWDGMDFHQW DQG PQRUWKRIWKHVLWHZKLFKLVSDUWLDOO\EHQHDWKWKH5LYHU'RQ7KLVLVUHJLVWHUHGWR%ULWLVK 5DLOZD\V%RDUGIRUWKHGHSRVLWLRQRILQGXVWULDODQGFRPPHUFLDO ZDVWH1RIXUWKHUGHWDLOVDUH DYDLODEOH
1R SROOXWLRQ LQFLGHQWV DUH UHJLVWHUHG WR WKH VLWH 7KHUH KDYH EHHQ VXEVWDQWLDWHG SROOXWLRQ LQFLGHQWVZLWKLQNP7KHQHDUHVWRFFXUUHGFLUFDPVRXWKZHVWLQ7KHHYHQWZDV FODVVLILHGDVDPLQRULPSDFWWRZDWHUDVLJQLILFDQWLPSDFWWRDLUDQGRIQRLPSDFWWRODQG7KH FRQWDPLQDQWV LQFOXGHG VPRNH VRRW DQG ILUHILJKWLQJ UXQRII 7KHUH KDYH EHHQ SROOXWLRQ LQFLGHQWVWRFRQWUROOHGZDWHUVZLWKLQNPRIWKHVLWH7KHQHDUHVWLQFLGHQWRFFXUUHGFLUFDP HDVWRIWKHVLWHLQ IURPDQLQGXVWULDOSUHPLVH DQGZDVFODVVLILHG DPLQRULQFLGHQW7KH SROOXWDQW LV LGHQWLILHG DV ILUH ZDWHUIRDP LQWR DQ XQQDPHG IUHVKZDWHU VWUHDPULYHU 7DEOH RXWOLQHVWKHVLWHKLVWRU\
Table 3. Site History Year / Map Comment ± 7KHVLWHLVJUHHQILHOG7KHEURDGHUDUHDLVSUHGRPLQDQWO\JUHHQILHOG'RQFDVWHULVFLUFD PDS NPVRXWKZHVWRIWKHVLWHDQGWKHUHDUHVRPHUHVLGHQWLDOGZHOOLQJVFLUFDNP VRXWKHDVWRIWKHVLWH7KHUHLVDJDVZRUNVNPVRXWKRIWKHVLWHDQGDWREDFFRSLSH PDQXIDFWXUHUFLUFDNPWRWKHVRXWKHDVW0LOH7KRUG6LGLQJVLVORFDWHGFLUFDP QRUWKRIWKHVLWHEH\RQGZKLFKLVDµ)ORRG'UDLQ¶7KH5LYHU'RQLVVQDNHVDURXQGWKH VLWHDQGLVFLUFDPWRWKHVRXWKPWRWKHZHVWDQGPWRWKHHDVWRIWKHVLWH PDS 1RFKDQJHVWRWKHVLWH7KHUHLVDVHZDJHSXPSLQJVWDWLRQDSSUR[LPDWHO\NPVRXWK HDVWRIWKHVLWHDQGWKHJDVZRUNVLVQRZFLUFDNPVRXWKRIWKHVLWH$OORWPHQW JDUGHQVDUHORFDWHGWRWKHHDVWDQGVRXWKZHVWFLUFDNPDQGPUHVSHFWLYHO\ :KHDWOH\5HVLGHQWLDO$UHDLVFLUFDNPVRXWKHDVWRIWKHVLWH PDS 7KHVLWHKDVEHHQUHZRUNHGSRVVLEO\LQUHODWLRQWRWKHµQHZFXW¶ZKLFKLVGLUHFWO\QRUWK RIWKHVLWH7KHDOORWPHQWVWRWKHHDVWDUHQRZDVHULHVRILQGXVWULDODQGFRPPHUFLDO GHYHORSPHQWV PDS $UDLOZD\OLQHWUDQVHFWVWKHVLWHDORQJWKHVRXWKHUQERUGHUDQGLVQRZERXQGE\WKH 5LYHU'RQWRWKHQRUWKDQGHDVW7KH5LYHU'RQKDVEHHQUHGLYHUWHGWRWKHFXUUHQWGD\ OD\RXW ± PDS 7KHUHKDVEHHQVXEVWDQWLDOUHVLGHQWLDOH[SDQVLRQLQ:KHDWOH\3DUN 7KHVLWHLVVXEGLYLGHGLQWRXQNQRZQODQGXVHVZLWKVPDOOEXLOGLQJVDFURVVWKHVLWH PDS 7KHQRUWKHDVWHUQGLYLVLRQLVODEHOOHGDV$OORWPHQW*DUGHQV7KHUHLVDJUDYHOSLW PVRXWKRIWKHVLWHZLWKSDWKZD\VZKLFKFRQQHFWWRQHDUE\µZRUNV¶7KHUDLOZD\OLQHLQ WKHVRXWKRIWKHVLWHLVQRORQJHUVKRZQ 7KHEXLOGLQJVDUHQRORQJHUVKRZQDQGWKHVLWHLVODEHOOHGDV$OORWPHQW*DUGHQV$JDV PDS KROGHULVORFDWHGZKHUHWKHJUDYHOSLWZDVSUHYLRXVO\VKRZQ,QGXVWULDODQGFRPPHUFLDO ODQGXVHVDUHVKRZQFLUFDNPVRXWKZHVWRIWKHVLWH ± PDS :KDUI5RDGWRWKHVRXWKRIWKHVLWHLVVKRZQ PDS 7KHFXUUHQWOD\RXWLVVKRZQ $HULDOLPDJHU\ ± PDS 7KHJDVKROGHUDQGJDVZRUNVWRWKHVRXWKRIWKHVLWHLVQRORQJHUVKRZQ
$$(QYLURQPHQWDO/LPLWHG 7HWURQ7UHDWPHQW/LPLWHG :KDUI5RDG'RQFDVWHU
Proposed Development 7KHSURSRVHGGHYHORSPHQWLVIRUDQLQHUWDQGQRQKD]DUGRXVZDVWHWUHDWPHQWIDFLOLW\LQFOXGLQJ DQDUHDIRUVWRUDJHRIDVEHVWRVZDVWHRQO\
'HWDLOV RI WKH ZDVWH IDFLOLW\ GHVLJQ PDQDJHPHQW DQG ULVN DVVHVVPHQWV DUH SURYLGHG LQ WKH IROORZLQJUHSRUWV
x 2SHUDWLRQDO3ODQDQG7HFKQLFDO6WDQGDUG $$H x $VEHVWRV0DQDJHPHQW3ODQ $$H x +(QYLURQPHQWDO5LVN$VVHVVPHQW $$H x 3DUWLFXODWH(PLVVLRQV0DQDJHPHQW3ODQ $$H x )LUH3UHYHQWLRQ3ODQ $$H x 3DUWLFXODWHDQG(PLVVLRQV0DQDJHPHQW3ODQ $$H DQG x 1RLVH0DQDJHPHQW3ODQ $$H 7KHZDVWHWUHDWPHQWIDFLOLW\LVSURSRVHGWRWDNHXSWRWRQQHVSHUDQQXP$UHDLV UHVWULFWHGWRWRQQHVSHUDQQXP$SUHDFFHSWDQFHSURFHGXUHZLOOEHLPSOHPHQWHGDQGZLOO EHRXWOLQHGLQWKH2SHUDWLRQDO3ODQDQG7HFKQLFDO6WDQGDUG
Site Engineering
*URXQGZDWHU
7KHJURXQGZDWHUOHYHODWWKHVLWHLVDWFLUFDP$2'7KHJURXQGZDWHULVLQWKHXQGHUO\LQJ &KHVWHU 6DQGVWRQH )RUPDWLRQ 7KH H[LVWLQJ DYHUDJH JURXQG OHYHO LV FLUFD P $2' $OO RSHUDWLRQVZLOOEHFDUULHGRXWRQLPSHUPHDEOHVXUIDFHVDQGDOOVXUIDFHZDWHULVFRQWDLQHGZKLFK LQWHUFHSWVWKHVRXUFHWRUHFHSWRUSDWKZD\7KHUHLVQRUHTXLUHGJURXQGZDWHUPDQDJHPHQW
%DVDODQGVLGHVORSHHQJLQHHULQJ $EDVDOOLQHUDQGVLGHVORSHHQJLQHHULQJZLOOQRWEHQHFHVVDU\DVWKHZDVWHRSHUDWLRQLVDZDVWH UHFRYHU\IDFLOLW\DQRQODQGILOORSHUDWLRQ
&DSSLQJDQGUHVWRUDWLRQPDWHULDOV 7KH VLWH LV FDSSHG E\ FRQFUHWH 7KH FRQFUHWH VXUIDFHV ZLOO EH IXOO\ UHSDLUHG DQG GUDLQDJH LQVWDOOHGSULRUWRRSHUDWLRQ
5HVWRUDWLRQ $IWHUFDUH
7KHUHVWRUDWLRQDQGDIWHUFDUHSODQVDUHQRWQHFHVVDU\DVWKHZDVWHRSHUDWLRQLVDQRQODQGILOO RSHUDWLRQ
/HDFKDWH0DQDJHPHQWDQG0RQLWRULQJ,QIUDVWUXFWXUH
/HDFKDWHPDQDJHPHQWLVQRWDSSOLFDEOHDVWKHVLWHLVQRWDODQGILOO
/DQGILOO*DV0DQDJHPHQWDQG0RQLWRULQJ,QIUDVWUXFWXUH
/DQGILOOJDVPDQDJHPHQWLVQRWUHTXLUHGDVWKHVLWHLVQRWDODQGILOO
6XUIDFH:DWHU0DQDJHPHQW6\VWHP
$OORSHUDWLRQVZLOOEHXQGHUWDNHQRQLPSHUPHDEOHFRQFUHWHVXUIDFLQJZLWKDFRQWDLQHGGUDLQDJH V\VWHP$OOZDVWHRSHUDWLRQVRWKHUWKDQ$UHDVRLODQGDJJUHJDWHPDQXIDFWXUHZLOOEHXQGHU FRYHU7KHVXUIDFHZDWHUUXQRIIIURPUDLQIDOOZLOOEHFROOHFWHGLQVXEVXUIDFHGUDLQVDQGFROOHFW LQDVXEVXUIDFHDWWHQXDWLRQWDQNIRUUHXVH,QWKHHYHQWWKHWDQNLVIXOOWKHRYHUIORZZLOOUXQYLD
$$(QYLURQPHQWDO/LPLWHG 7HWURQ7UHDWPHQW/LPLWHG :KDUI5RDG'RQFDVWHU
DVLOWWUDSDQGSHWUROLQWHUFHSWRUDQGZLOOGLVFKDUJHWRVXUIDFHZDWHULQDJUHHPHQWZLWK 7KHSURFHVVZDWHUIURPWKH$UHDZDVKLQJSURFHVVZLOOEHWUHDWHGYLDDVLOWWUDSDQGSHWURO LQWHUFHSWRUSULRUWRGLVFKDUJHWR 7KHDWWHQXDWLRQWDQNDQGDGGLWLRQDOZDWHUVWRUDJHWDQNVSURPRWHZDWHUKDUYHVWLQJWHFKQLTXHV 7KH SURSRVHG GUDLQDJH GHVLJQ LV VKRZQ LQ WKH µ'UDLQDJH 3ODQ¶ GUDZLQJ UHIHUHQFH ' 3RVW&ORVXUH&RQWUROV 3RVWFORVXUHFRQWUROVDUHQRWDSSOLFDEOHIRUDZDVWHWUHDWPHQWIDFLOLW\ $$(QYLURQPHQWDO/LPLWHG 7HWURQ7UHDWPHQW/LPLWHG :KDUI5RDG'RQFDVWHU 3.0 PATHWAY AND RECEPTOR TERM CHARACTERISATION Air quality / climate 0HWHRURORJLFDO ZLQG GDWD IRU ILYH \HDUV KDYH EHHQ DFTXLUHGIURPWKH:LOO\:HDWKHUZHEVLWH7KHZLQGGDWD KDVEHHQWDNHQIURP6FDPSWRQ DSSUR[LPDWHO\PLOHV VRXWK HDVW RI WKH VLWH 7KH SUHYDLOLQJ ZLQG GLUHFWLRQ LV IURPWKHVRXWKDQGVRXWKZHVWTXDGUDQW '()5$ $LU 4XDOLW\ 0DQDJHPHQW $UHDV $40$V GDWD LQGLFDWHVWKDWWKHVLWHLVZLWKLQDQ$40$IRU12 Geology %*6 PDSSLQJ VKRZV WKH EHGURFN JHRORJ\ DV &KHVWHU )RUPDWLRQ 6DQGVWRQH 3HEEO\ DQG WKH VXSHUILFLDO GHSRVLWVDV$OOXYLXP &OD\6LOW6DQGDQG*UDYHO %RUHKROHORJVIURPWKH$$HVLWHLQYHVWLJDWLRQDUH DWWDFKHG LQ $SSHQGL[ % 7KH ORFDWLRQ RI WKH VLWH LQYHVWLJDWLRQDUHVKRZQLQGUDZLQJ'7KHLQYHVWLJDWLRQFRQILUPHGFLUFD±PRI 0DGH*URXQGEHQHDWKWKHFRQFUHWHVODEXQGHUODLQE\DOOXYLXP%+FRQILUPHG0DGH*URXQG VWUDLJKWRQWR&KHVWHU6DQGVWRQH)RUPDWLRQ 7KHUHDUHQR%*6ERUHKROHVZLWKLQWKHVLWHEXWWKHUHLVDPXOWLWXGHRIERUHKROHVZLWKLQP 7KHQHDUHVWERUHKROHVDUHORFDWHG PVRXWKZHVWDQGHDVWRIWKHVLWHWKHLUUHIHUHQFHV DUH6(6( 6(6(6(6(DQG6(6(7KHVRLOORJVVKRZ0DGH*URXQG GHSRVLWVDWWKHVXUIDFHEHWZHHQ PWR P EHORZWKH JURXQG OHYHO EJO 8QVSHFLILHG FRQWDPLQDWLRQLVLGHQWLILHGLQLQWKHQDWXUDOFOD\RIERUHKROH6(6(EHWZHHQPEJODQG PEJO 7KH %*6 PDSV KDYH GHYHORSHG D GDWDEDVH RI VRLO FKHPLVWU\ OHYHOV VKRZLQJ FRQWDPLQDQW GLVWULEXWLRQ7DEOHEHORZVXPPDULVHVWKHDQWLFLSDWHGUDQJHVLQFRQFHQWUDWLRQV Table 4. Normal Background Concentrations of Contaminants Contaminant Concentration range (mg/kg) $UVHQLF ± &DGPLXP ± &RSSHU 1LFNHO ± /HDG 0DGH*URXQGZDVWHVWHGDQGLVVKRZQLQ$SSHQGL['7KHUHVXOWVDUHIRULQIRUPDWLRQRQO\EXW VKRZHOHYDWLRQVLQPHWDOVZLWKLQWKH0DGH*URXQG7KLVLVW\SLFDOJLYHQWKHKLVWRULFODQGXVHRQ WKHVLWH Man-made Subsurface Pathways 7KHUHDUHQRPDQPDGHSDWKZD\VVXFKDVILHOGGUDLQVEXULHGVHUYLFHVPLQHZRUNLQJVZLWKLQ WKHVLWH Hydrology 7KHQHDUHVWVXUIDFHZDWHUFRXUVHLV5LYHU'RQFLUFDPQRUWKRIWKHVLWH7KHUHLVDODQGGUDLQ VKRZQPVRXWKHDVWRIWKHVLWHZKLFKFRQQHFWVWRDVOXLFHFLUFDPVRXWKRIWKHVLWHDQG KWWSV ZLQGZLOO\ZHDWKHUFRXN\KVRXWK\RUNVKLUHGRQFDVWHUKWPO$FFHVVHG $$(QYLURQPHQWDO/LPLWHG 7HWURQ7UHDWPHQW/LPLWHG :KDUI5RDG'RQFDVWHU LQWR WKH VOLSZD\ FXW LQWR WKH 5LYHU 'RQ 7KH ORFDO K\GURORJ\ DQG K\GURJHRORJ\ LV VKRZQ LQ GUDZLQJ'(66' 7KHVLWHLVLQ*URXQGZDWHU3URWHFWLRQ=RQH7RWDO&DWFKPHQW 7KHVLWHLVORFDWHGZLWKLQ)ORRG=RQHLGHQWLILHGDVDQDUHDEHQHILWLQJIURPIORRGGHIHQFHV 7KH(QYLURFKHFNUHSRUWUHFRUGVVHYHQUHJLVWHUHGGLVFKDUJHFRQVHQWVZLWKLQPRIWKHVLWH 1RQHDUHUHJLVWHUHGWRWKHVLWH 7KHUHDUHQRGHVLJQDWHGDUHDVRIKHULWDJHRUQDWXUHFRQVHUYDWLRQZLWKLQNPRIWKHVLWHWKDW UHO\RQDQ\VXUIDFHZDWHUIHDWXUHVRQRULPPHGLDWHO\VXUURXQGLQJWKHVLWH Hydrogeology 7KHDTXLIHUZLWKLQWKHEHGURFNJHRORJ\LVFDWHJRULVHGDV3ULQFLSDO7KHVXSHUILFLDOGHSRVLWVDUH GHVLJQDWHG DV D 6HFRQGDU\ µ$¶ DTXLIHU &KHPLFDO UHVXOWV IURP JURXQGZDWHU PRQLWRULQJ DUH VKRZQLQ$SSHQGL[& 7KHUHDUHQRUHJLVWHUHGJURXQGZDWHUDEVWUDFWLRQSRLQWVZLWKLQPRIWKHVLWH7KHQHDUHVW ZDWHUDEVWUDFWLRQSRLQWLVFLUFDPQRUWKZHVWRIWKHVLWHDQGLVUHJLVWHUHGWR6DULD/WG7KH DEVWUDFWLRQSHUPLWVWDUWGDWHLVQG2FWREHUZLWKQRHQGGDWHSURYLGHG7KHJURXQGZDWHU DEVWUDFWLRQSRLQWVDUHVKRZQLQGUDZLQJ'(66' 7KHJURXQGZDWHUOHYHOVDWWKHVLWHZHUHWDNHQLQ-XQH7DEOHGHWDLOVWKHJURXQGZDWHU GHSWKLQPEJODQGP$2'DORQJZLWKWKHEDVHOHYHORIWKHERUHKROH*URXQGZDWHUTXDOLW\LV SURYLGHGDVLQIRUPDWLRQLQ$SSHQGL[&7KHK\GUDXOLFJUDGLHQWJHQHUDOO\IDOOVZHVWWRZDUGV%+ DQGWKH5LYHU'RQ Table 5. Groundwater Levels 23/06/2020 ID Groundwater level (m bgl) Base level (m bgl) Depth of water (m AOD) BH01 BH02 BH03 BH04 BH05 Receptors and Compliance Points 7KHVHQVLWLYHUHFHSWRUVDUHVKRZQLQGUDZLQJV'(66'DQG'(66' x 7KHQHDUHVWUHVLGHQWLDOSURSHUWLHVDUHRQ3DUNLQVRQVWUHHWFLUFDPVRXWKHDVWRIWKHVLWH x 7KHVLWHLVERXQGHGWRWKHQRUWKDQGZHVWE\5LYHU'RQZKLFKPD\EHDWULVNGXULQJSHULRGV RIIORRGLQJ x 7KHVWDIIDQGYLVLWRUVRIWKHLQGXVWULDODQGFRPPHUFLDOSURSHUWLHVVXUURXQGLQJWKHVLWHVKRXOG DOVREHFRQVLGHUHGVHQVLWLYHUHFHSWRUV x 7KHQHDUHVWVFKRROLV'RQFDVWHU&ROOHJHFLUFDPVRXWKZHVWRIWKHVLWH DQG x 7KHQHDUHVWKRVSLWDOLV3DUN+LOO+RVSLWDODSSUR[LPDWHO\NPVRXWKHDVWRIWKHVLWH $OOPDWHULDOVZLOOEHVWRUHGRQLPSHUPHDEOHFRQFUHWHVXUIDFLQJZLWKDFRQWDLQHGGUDLQDJHV\VWHP GLVFKDUJLQJ WR VHZHU 6XUIDFH ZDWHU ZLOO EH FROOHFWHG DQG UHXVHG LQ VLWH RSHUDWLRQV ZKHUH SRVVLEOH6XUIDFHZDWHUGUDLQDJHLVVKRZQZLWKLQWKH'UDLQDJH3ODQLQGUDZLQJ' 7KHSURFHVVZDWHUIURP$UHDZDVKLQJZLOOEHIXOO\FRQWDLQHGZLWKQRPL[LQJZLWKWKHVXUIDFH ZDWHU V\VWHP 7KH SURFHVV ZDWHU LI QRW UHXVHG ZLOO EH GLVFKDUJHG WR WKH IRXO VHZHU LQ DJUHHPHQWZLWK $3DUWLFXODWH(PLVVLRQV0DQDJHPHQW3ODQDQGDQ$VEHVWRV0DQDJHPHQW3ODQSURYLGLQJIXOO GHWDLOVRIWKHPLWLJDWLRQDQGPRQLWRULQJGXULQJWKHVLWHZRUNVKDYHEHHQGHYHORSHGWRFRQWURO $$(QYLURQPHQWDO/LPLWHG 7HWURQ7UHDWPHQW/LPLWHG :KDUI5RDG'RQFDVWHU SRWHQWLDOHPLVVLRQVRIDVEHVWRVILEUHVDQGGXVWVRXUFHV,WVKRXOGEHQRWHGWKDWWKHDVEHVWRV ILEUHULVNLVFRQVLGHUHGORZDVLWLVVWRUDJHRI WRQQHVDQGDOOLQFRPLQJDVEHVWRVZDVWHLV DOUHDG\LQVHDOHGFRQWDLQHUVRUGRXEOHEDJJHG 7KHSURSRVHGZDVWHW\SHVWREHLPSRUWHGWRWKHVLWHDUHDOOQRQRGRURXVDQGORZSXWUHVFLEOH FRQWHQW DQGQRDGGLWLRQDO FRQWUROVDUHUHTXLUHG,IWKHUHDUHVXEVWDQWLDWHG RGRXUFRPSODLQWV RSHUDWLRQDO DFWLYLWLHV FRQWULEXWLQJ WR IXJLWLYH RGRXU HPLVVLRQV ZLOO VWRSSHG XQWLO DQ 2GRXU 0DQDJHPHQW3ODQKDVEHHQZULWWHQDQGFRQWUROVLPSOHPHQWHGDWWKHVLWH 6XUIDFH:DWHU 6XUIDFHZDWHUZLOOEHGUDLQLQWRDVXEVXUIDFHVHDOHGGUDLQVLQWRDVXEVXUIDFHDWWHQXDWLRQWDQN IRU UHXVH 7KH RYHUIORZ VXUIDFH ZDWHU ZLOO GLVFKDUJH YLD D VLOW WUDS DQG SHWURO LQWHUFHSWRU WR VXUIDFH ZDWHU VHZHU LQ DJUHHPHQW ZLWK /DQGILOO*DV 1RWUHTXLUHGDVWKLVLVDQRQODQGILOOSHUPLW7KHVLWHLVSDUWLDOO\VLWXDWHGRQWRSRIDQH[LVWLQJ ODQGILOOGHSRVLW7KHVLWHLVVXUIDFHGE\DQH[LVWLQJFRQFUHWHVODEDQGLQIUDVWUXFWXUHZLWKVXIILFLHQW ORDGEHDULQJFDSDFLW\7KHUHLVQRFKDQJHLQXQGHUO\LQJJDVULVNIURPWKHH[LVWLQJGHSRVLW /RVVRI$PHQLW\ $ 3DUWLFXODWH DQG (PLVVLRQV 0DQDJHPHQW 3ODQ KDV EHHQ GHYHORSHG WR VXSSOHPHQW WKH DSSOLFDWLRQ)XOOGHWDLOVRIWKHPLWLJDWLRQDQGPRQLWRULQJGXULQJRSHUDWLRQVDUHVHWRXWLQWKH'XVW (PLVVLRQV0DQDJHPHQW3ODQ '(03 )XOOGHWDLOVRIWKHDVVHVVPHQWDQGSRWHQWLDOQRLVHLPSDFWVDQGPLWLJDWLRQPHDVXUHVKDYHEHHQ SURYLGHGLQWKH1RLVH0DQDJHPHQW3ODQ 103 +DELWDWV ZKHUHUHTXLUHG 7KHUHDUHQR666,V/15V115V6$&V63$VRU5DPVDU6LWHVZLWKLQNPRIWKHVLWH7KH QHDUHVW 666, LV 6DQGDOO %HDW VLWXDWHG DSSUR[LPDWHO\ NP HDVW RI WKH VLWH 7KHUH DUH QR SURWHFWHG KDELWDWV ZLWKLQ WKH VLWH 'HFLGXRXV :RRGODQG SULRULW\KDELWDWFDQEHIRXQGRQWKH QRUWKHUQVLGHRI5LYHU'RQ /DQGVFDSHDQG9LVXDO 1RWUHTXLUHG Other matters 7KHUHDUHQROLVWHGEXLOGLQJVZLWKLQPRIWKHVLWH7KHQHDUHVWVFKHGXOHGPRQXPHQWLVµ¶:DOO RI5RPDQIRUW¶¶DSSUR[LPDWHO\PVRXWKZHVWRIWKHVLWH (66' $$(QYLURQPHQWDO/LPLWHG 'HFHPEHU $$(QYLURQPHQWDO/LPLWHG 7HWURQ7UHDWPHQW/LPLWHG :KDUI5RDG'RQFDVWHU Drawings $$(QYLURQPHQWDO/LPLWHG 7HWURQ7UHDWPHQW/LPLWHG :KDUI5RDG'RQFDVWHU APPENDIX A (QYLURFKHFN5HSRUW $$(QYLURQPHQWDO/LPLWHG 7HWURQ7UHDWPHQW/LPLWHG :KDUI5RDG'RQFDVWHU Groundwater Vulnerability Site Sensitivity Context Map - Slice A Order Details Order Number: 242475436_1_1 Customer Ref: 203162 National Grid Reference: 457660, 404230 Slice: A Site Area (Ha): 0.01 Search Buffer (m): 1000 Site Details Saica Natur, Wharf Road, Wheatley, DONCASTER, DN1 2ST Tel: 0844 844 9952 Fax: 0844 844 9951 Web: www.envirocheck.co.uk A Landmark Information Group Service v15.0 12-May-2020 Page 1 of 6 Bedrock Aquifer Designation Site Sensitivity Context Map - Slice A Order Details Order Number: 242475436_1_1 Customer Ref: 203162 National Grid Reference: 457660, 404230 Slice: A Site Area (Ha): 0.01 Search Buffer (m): 1000 Site Details Saica Natur, Wharf Road, Wheatley, DONCASTER, DN1 2ST Tel: 0844 844 9952 Fax: 0844 844 9951 Web: www.envirocheck.co.uk A Landmark Information Group Service v15.0 12-May-2020 Page 2 of 6 Superficial Aquifer Designation Site Sensitivity Context Map - Slice A Order Details Order Number: 242475436_1_1 Customer Ref: 203162 National Grid Reference: 457660, 404230 Slice: A Site Area (Ha): 0.01 Search Buffer (m): 1000 Site Details Saica Natur, Wharf Road, Wheatley, DONCASTER, DN1 2ST Tel: 0844 844 9952 Fax: 0844 844 9951 Web: www.envirocheck.co.uk A Landmark Information Group Service v15.0 12-May-2020 Page 3 of 6 Source Protection Zones Site Sensitivity Context Map - Slice A Order Details Order Number: 242475436_1_1 Customer Ref: 203162 National Grid Reference: 457660, 404230 Slice: A Site Area (Ha): 0.01 Search Buffer (m): 1000 Site Details Saica Natur, Wharf Road, Wheatley, DONCASTER, DN1 2ST Tel: 0844 844 9952 Fax: 0844 844 9951 Web: www.envirocheck.co.uk A Landmark Information Group Service v15.0 12-May-2020 Page 4 of 6 Sensitive Land Uses Site Sensitivity Context Map - Slice A Order Details Order Number: 242475436_1_1 Customer Ref: 203162 National Grid Reference: 457660, 404230 Slice: A Site Area (Ha): 0.01 Search Buffer (m): 1000 Site Details Saica Natur, Wharf Road, Wheatley, DONCASTER, DN1 2ST Tel: 0844 844 9952 Fax: 0844 844 9951 Web: www.envirocheck.co.uk A Landmark Information Group Service v15.0 12-May-2020 Page 5 of 6 BGS Flood GFS Data Site Sensitivity Context Map - Slice A Order Details Order Number: 242475436_1_1 Customer Ref: 203162 National Grid Reference: 457660, 404230 Slice: A Site Area (Ha): 0.01 Search Buffer (m): 1000 Site Details Saica Natur, Wharf Road, Wheatley, DONCASTER, DN1 2ST Tel: 0844 844 9952 Fax: 0844 844 9951 Web: www.envirocheck.co.uk A Landmark Information Group Service v15.0 12-May-2020 Page 6 of 6 Envirocheck ® Report: Datasheet Order Details: Order Number: 242475436_1_1 Customer Reference: 203162 National Grid Reference: 457660, 404230 Slice: A Site Area (Ha): 0.01 Search Buffer (m): 1000 Site Details: Saica Natur, Wharf Road Wheatley DONCASTER DN1 2ST Client Details: Mr I Markidis AA Environmental Ltd 4-8 Cholswell Court Shippon Abingdon OX13 6HX Order Number: 242475436_1_1 Date: 12-May-2020 rpr_ec_datasheet v53.0 A Landmark Information Group Service Contents Report Section Page Number Summary - Agency & Hydrological 1 Waste 42 Hazardous Substances 51 Geological 52 Industrial Land Use 58 Sensitive Land Use 96 Data Currency 97 Data Suppliers 103 Useful Contacts 104 Introduction The Environment Act 1995 has made site sensitivity a key issue, as the legislation pays as much attention to the pathways by which contamination could spread, and to the vulnerable targets of contamination, as it does the potential sources of contamination. For this reason, Landmark's Site Sensitivity maps and Datasheet(s) place great emphasis on statutory data provided by the Environment Agency/Natural Resources Wales and the Scottish Environment Protection Agency; it also incorporates data from Natural England (and the Scottish and Welsh equivalents) and Local Authorities; and highlights hydrogeological features required by environmental and geotechnical consultants. It does not include any information concerning past uses of land. The datasheet is produced by querying the Landmark database to a distance defined by the client from a site boundary provided by the client. In this datasheet the National Grid References (NGRs) are rounded to the nearest 10m in accordance with Landmark's agreements with a number of Data Suppliers. Copyright Notice © Landmark Information Group Limited 2020. The Copyright on the information and data and its format as contained in this Envirocheck® Report ("Report") is the property of Landmark Information Group Limited ("Landmark") and several other Data Providers, including (but not limited to) Ordnance Survey, British Geological Survey, the Environment Agency/Natural Resources Wales and Natural England, and must not be reproduced in whole or in part by photocopying or any other method. The Report is supplied under Landmark's Terms and Conditions accepted by the Customer. A copy of Landmark's Terms and Conditions can be found with the Index Map for this report. Additional copies of the Report may be obtained from Landmark, subject to Landmark's charges in force from time to time. The Copyright, design rights and any other intellectual rights shall remain the exclusive property of Landmark and /or other Data providers, whose Copyright material has been included in this Report. © Environment Agency & United Kingdom Research and Innovation 2020. © Natural Resources Wales & United Kingdom Research and Innovation 2020. Natural England Copyright Notice Site of Special Scientific Interest, National Nature Reserve, Ramsar, Special Protection Area, Special Conservation Area, Marine Nature Reserve data (derived from Ordnance Survey 1:10000 raster) is provided by, and used with the permission of, Natural England who retain the copyright and Intellectual Property Rights for the data. Scottish Natural Heritage Copyright Contains SNH information licensed under the Open Government Licence v3.0. Ove Arup Copyright Notice The Mining Instability data was obtained on licence from Ove Arup & Partners Limited (for further information, contact [email protected]). No reproduction or further use of such Data is to be made without the prior written consent of Ove Arup & Partners Limited. The supplied Mining Instability data is derived from publicly available records and other third party sources and neither Ove Arup & Partners nor Landmark warrant the accuracy or completeness of such information or data. Peter Brett Associates Copyright Notice The cavity data presented has been extracted from the PBA enhanced version of the original DEFRA national cavity databases. PBA/DEFRA retain the copyright & intellectual property rights in the data. Whilst all reasonable efforts are made to check that the information contained in the cavity databases is accurate we do not warrant that the data is complete or error free. The information is based upon our own researches and those collated from a number of external sources and is continually being augmented and updated by PBA. In no event shall PBA/DEFRA or Landmark be liable for any loss or damage including, without limitation, indirect or consequential loss or damage arising from the use of this data. Radon Potential dataset Copyright Notice Information supplied from a joint dataset compiled by The British Geological Survey and Public Health England. Natural Resources Wales Copyright Notice Contains Natural Resources Wales information © Natural Resources Wales and Database Right. All rights Reserved. Contains Ordnance Survey Data. Ordnance Survey Licence number 100019741. Crown Copyright and Database Right. Contains Natural Resources Wales information © Natural Resources Wales and Database Right. All rights Reserved. Some features of this information are based on digital spatial data licensed from the Centre for Ecology & Hydrology © NERC (CEH). Defra, Met Office and DARD Rivers Agency © Crown copyright. © Cranfield University. © James Hutton Institute. Contains OS data © Crown copyright and database right 2020. Land & Property Services © Crown copyright and database right. Report Version v53.0 Order Number: 242475436_1_1 Date: 12-May-2020 rpr_ec_datasheet v53.0 A Landmark Information Group Service Summary Page 501 to 1000m On Site 0 to 250m 251 to 500m Data Type Number (*up to 2000m) Agency & Hydrological BGS Groundwater Flooding Susceptibility pg 1 Yes Yes Yes n/a Contaminated Land Register Entries and Notices Discharge Consents pg 2 7 10 Prosecutions Relating to Controlled Waters n/a n/a n/a Enforcement and Prohibition Notices Integrated Pollution Controls pg 6 4 Integrated Pollution Prevention And Control pg 7 1 4 Local Authority Integrated Pollution Prevention And Control Local Authority Pollution Prevention and Controls pg 9 5 10 Local Authority Pollution Prevention and Control Enforcements Nearest Surface Water Feature pg 11 Yes Pollution Incidents to Controlled Waters pg 11 4 13 19 Prosecutions Relating to Authorised Processes Registered Radioactive Substances River Quality pg 17 2 River Quality Biology Sampling Points pg 17 1 1 River Quality Chemistry Sampling Points Substantiated Pollution Incident Register pg 18 1 4 3 Water Abstractions pg 19 8 11 (*33) Water Industry Act Referrals Groundwater Vulnerability Map pg 32 Yes n/a n/a n/a Groundwater Vulnerability - Soluble Rock Risk n/a n/a n/a Groundwater Vulnerability - Local Information n/a n/a n/a Bedrock Aquifer Designations pg 32 Yes n/a n/a n/a Superficial Aquifer Designations pg 32 Yes n/a n/a n/a Source Protection Zones pg 32 1 Extreme Flooding from Rivers or Sea without Defences pg 32 Yes Yes n/a n/a Flooding from Rivers or Sea without Defences pg 33 Yes n/a n/a Areas Benefiting from Flood Defences pg 33 Yes Yes n/a n/a Flood Water Storage Areas n/a n/a Flood Defences pg 33 Yes n/a n/a OS Water Network Lines pg 33 4 14 49 Order Number: 242475436_1_1 Date: 12-May-2020 rpr_ec_datasheet v53.0 A Landmark Information Group Service Summary Page 501 to 1000m On Site 0 to 250m 251 to 500m Data Type Number (*up to 2000m) Waste BGS Recorded Landfill Sites Historical Landfill Sites pg 42 1 1 1 Integrated Pollution Control Registered Waste Sites Licensed Waste Management Facilities (Landfill Boundaries) Licensed Waste Management Facilities (Locations) pg 42 4 Local Authority Landfill Coverage pg 43 1 n/a n/a n/a Local Authority Recorded Landfill Sites pg 43 1 1 Potentially Infilled Land (Non-Water) pg 43 2 Potentially Infilled Land (Water) pg 44 4 16 49 Registered Landfill Sites pg 47 1 1 Registered Waste Transfer Sites pg 48 2 1 1 Registered Waste Treatment or Disposal Sites pg 49 1 1 2 Hazardous Substances Control of Major Accident Hazards Sites (COMAH) pg 51 1 Explosive Sites Notification of Installations Handling Hazardous Substances (NIHHS) pg 51 1 Planning Hazardous Substance Consents pg 51 4 1 Planning Hazardous Substance Enforcements Order Number: 242475436_1_1 Date: 12-May-2020 rpr_ec_datasheet v53.0 A Landmark Information Group Service Summary Page 501 to 1000m On Site 0 to 250m 251 to 500m Data Type Number (*up to 2000m) Geological BGS 1:625,000 Solid Geology pg 52 Yes n/a n/a n/a BGS Estimated Soil Chemistry pg 52 Yes Yes Yes Yes BGS Recorded Mineral Sites pg 53 2 BGS Urban Soil Chemistry pg 54 Yes Yes Yes BGS Urban Soil Chemistry Averages pg 56 Yes CBSCB Compensation District n/a n/a n/a Coal Mining Affected Areas pg 56 Yes n/a n/a n/a Mining Instability pg 56 Yes n/a n/a n/a Man-Made Mining Cavities Natural Cavities Non Coal Mining Areas of Great Britain n/a n/a Potential for Collapsible Ground Stability Hazards pg 56 Yes n/a n/a Potential for Compressible Ground Stability Hazards pg 57 Yes n/a n/a Potential for Ground Dissolution Stability Hazards n/a n/a Potential for Landslide Ground Stability Hazards pg 57 Yes n/a n/a Potential for Running Sand Ground Stability Hazards pg 57 Yes n/a n/a Potential for Shrinking or Swelling Clay Ground Stability Hazards pg 57 Yes n/a n/a Radon Potential - Radon Affected Areas n/a n/a n/a Radon Potential - Radon Protection Measures n/a n/a n/a Industrial Land Use Contemporary Trade Directory Entries pg 58 9 35 167 Fuel Station Entries pg 76 1 1 Points of Interest - Commercial Services pg 76 9 10 35 Points of Interest - Education and Health pg 81 3 Points of Interest - Manufacturing and Production pg 81 3 66 67 Points of Interest - Public Infrastructure pg 92 9 6 12 Points of Interest - Recreational and Environmental pg 95 3 Gas Pipelines Underground Electrical Cables Order Number: 242475436_1_1 Date: 12-May-2020 rpr_ec_datasheet v53.0 A Landmark Information Group Service Summary Page 501 to 1000m On Site 0 to 250m 251 to 500m Data Type Number (*up to 2000m) Sensitive Land Use Ancient Woodland Areas of Adopted Green Belt pg 96 2 Areas of Unadopted Green Belt Areas of Outstanding Natural Beauty Environmentally Sensitive Areas Forest Parks Local Nature Reserves Marine Nature Reserves National Nature Reserves National Parks Nitrate Sensitive Areas Nitrate Vulnerable Zones pg 96 1 1 Ramsar Sites Sites of Special Scientific Interest Special Areas of Conservation Special Protection Areas World Heritage Sites Order Number: 242475436_1_1 Date: 12-May-2020 rpr_ec_datasheet v53.0 A Landmark Information Group Service Agency & Hydrological Quadrant Estimated Map Reference Details Distance Contact NGR ID (Compass Direction) From Site BGS Groundwater Flooding Susceptibility Flooding Type: Potential for Groundwater Flooding of Property Situated Below Ground Level A13NE 0 1 457660 (NE) 404233 BGS Groundwater Flooding Susceptibility Flooding Type: Potential for Groundwater Flooding of Property Situated Below Ground Level A13NW 11 1 457650 (W) 404233 BGS Groundwater Flooding Susceptibility Flooding Type: Potential for Groundwater Flooding to Occur at Surface A13NW 91 1 457600 (NW) 404300 BGS Groundwater Flooding Susceptibility Flooding Type: Potential for Groundwater Flooding to Occur at Surface A13NW 112 1 457550 (W) 404250 BGS Groundwater Flooding Susceptibility Flooding Type: Potential for Groundwater Flooding of Property Situated Below Ground Level A13NW 174 1 457500 (NW) 404300 BGS Groundwater Flooding Susceptibility Flooding Type: Potential for Groundwater Flooding of Property Situated Below Ground Level A13NE 190 1 457850 (E) 404233 BGS Groundwater Flooding Susceptibility Flooding Type: Potential for Groundwater Flooding to Occur at Surface A13NW 199 1 457500 (NW) 404350 BGS Groundwater Flooding Susceptibility Flooding Type: Limited Potential for Groundwater Flooding to Occur A13NW 201 1 457550 (NW) 404400 BGS Groundwater Flooding Susceptibility Flooding Type: Potential for Groundwater Flooding to Occur at Surface A13NW 211 1 457450 (W) 404233 BGS Groundwater Flooding Susceptibility Flooding Type: Potential for Groundwater Flooding of Property Situated Below Ground Level A13NW 211 1 457450 (W) 404250 BGS Groundwater Flooding Susceptibility Flooding Type: Potential for Groundwater Flooding to Occur at Surface A13NE 222 1 457700 (N) 404450 BGS Groundwater Flooding Susceptibility Flooding Type: Limited Potential for Groundwater Flooding to Occur A13NW 241 1 457450 (NW) 404350 BGS Groundwater Flooding Susceptibility Flooding Type: Potential for Groundwater Flooding to Occur at Surface A13NE 254 1 457850 (NE) 404400 BGS Groundwater Flooding Susceptibility Flooding Type: Potential for Groundwater Flooding of Property Situated Below Ground Level A13SE 254 1 457900 (E) 404150 BGS Groundwater Flooding Susceptibility Flooding Type: Potential for Groundwater Flooding of Property Situated Below Ground Level A13NE 268 1 457660 (N) 404500 BGS Groundwater Flooding Susceptibility Flooding Type: Potential for Groundwater Flooding of Property Situated Below Ground Level A13NW 269 1 457450 (NW) 404400 BGS Groundwater Flooding Susceptibility Flooding Type: Potential for Groundwater Flooding of Property Situated Below Ground Level A13NW 271 1 457500 (NW) 404450 BGS Groundwater Flooding Susceptibility Flooding Type: Potential for Groundwater Flooding to Occur at Surface A13NE 283 1 457750 (N) 404500 BGS Groundwater Flooding Susceptibility Flooding Type: Limited Potential for Groundwater Flooding to Occur A13NW 318 1 457350 (W) 404300 BGS Groundwater Flooding Susceptibility Flooding Type: Potential for Groundwater Flooding to Occur at Surface A13NE 398 1 457900 (NE) 404550 BGS Groundwater Flooding Susceptibility Flooding Type: Limited Potential for Groundwater Flooding to Occur A12NE 411 1 457250 (W) 404250 BGS Groundwater Flooding Susceptibility Flooding Type: Limited Potential for Groundwater Flooding to Occur A14SW 412 1 458050 (E) 404100 Order Number: 242475436_1_1 Date: 12-May-2020 rpr_ec_datasheet v53.0 A Landmark Information Group Service Page 1 of 104 Agency & Hydrological Quadrant Estimated Map Reference Details Distance Contact NGR ID (Compass Direction) From Site BGS Groundwater Flooding Susceptibility Flooding Type: Potential for Groundwater Flooding to Occur at Surface A8NW 415 1 457500 (SW) 403850 BGS Groundwater Flooding Susceptibility Flooding Type: Potential for Groundwater Flooding of Property Situated Below Ground Level A18SE 427 1 457750 (N) 404650 BGS Groundwater Flooding Susceptibility Flooding Type: Potential for Groundwater Flooding to Occur at Surface A18SE 441 1 457800 (N) 404650 BGS Groundwater Flooding Susceptibility Flooding Type: Potential for Groundwater Flooding of Property Situated Below Ground Level A12SE 449 1 457250 (SW) 404050 BGS Groundwater Flooding Susceptibility Flooding Type: Potential for Groundwater Flooding to Occur at Surface A12SE 468 1 457200 (W) 404150 BGS Groundwater Flooding Susceptibility Flooding Type: Potential for Groundwater Flooding to Occur at Surface A12NE 490 1 457200 (W) 404400 Discharge Consents 1 Operator: C F Booth (Don.) Ltd A13NE 44 2 457700 Property Type: Undefined Or Other (NE) 404250 Location: C F Booth (Don.) Ltd, Wharf Road, Wheatley, Doncaster Authority: Environment Agency, North East Region Catchment Area: Don Tributaries Reference: Wra7211 Permit Version: 1 Effective Date: 19th April 1996 Issued Date: 19th April 1996 Revocation Date: Not Supplied Discharge Type: Trade Discharges - Site Drainage (Contaminated Surface Water, Not Waste Sites) Discharge Freshwater Stream/River Environment: Receiving Water: Culverted Trib. Of Don Navigan Status: New Consent, by Application (Water Resources Act 1991, Section 88) Positional Accuracy: Located by supplier to within 100m Discharge Consents 2 Operator: Transco A13SW 113 2 457660 Property Type: SUB-STATION/ELECTRICITY/GAS/AIR CONDITIONING SUPPLY (S) 404120 Location: Gasholder No 6 Doncaster Holder Station, Transco Bg, Church Way, Doncaster Authority: Environment Agency, North East Region Catchment Area: Don Tributaries Reference: Wra7570 Permit Version: 1 Effective Date: 11th February 2000 Issued Date: 11th February 2000 Revocation Date: 31st May 2000 Discharge Type: Trade Effluent Discharge Land/Soakaway Environment: Receiving Water: Into Land Status: Consent expired Positional Accuracy: Located by supplier to within 10m Discharge Consents 3 Operator: Do Not Usewater Services Limited A13SE 180 2 457766 Property Type: PUMPING STATION ON SEWERAGE NETWORK (WATER COMPANY) (SE) 404088 Location: Wheatly/No 2 Sps, Whittington Street, Doncaster, South Yorkshire, Dn1 2sg Authority: Environment Agency, North East Region Catchment Area: Don Tributaries Reference: Npswqd008129 Permit Version: 1 Effective Date: 1st July 2009 Issued Date: 4th June 2009 Revocation Date: Not Supplied Discharge Type: Sewage Discharges - Pumping Station - Water Company Discharge Canal Environment: Receiving Water: An Unnamed Trib Shef & Sy Navi Status: New Consent (Water Resources Act 1991, Section 88 & Schedule 10 as amended by Environment Act 1995) Positional Accuracy: Located by supplier to within 10m Order Number: 242475436_1_1 Date: 12-May-2020 rpr_ec_datasheet v53.0 A Landmark Information Group Service Page 2 of 104 Agency & Hydrological Quadrant Estimated Map Reference Details Distance Contact NGR ID (Compass Direction) From Site Discharge Consents 3 Operator: Do Not Usewater Services Limited A13SE 180 2 457766 Property Type: PUMPING STATION ON SEWERAGE NETWORK (WATER COMPANY) (SE) 404088 Location: Wheatly/No 2 Sps, Whittington Street, Doncaster, South Yorkshire, Dn1 2sg Authority: Environment Agency, North East Region Catchment Area: Don Tributaries Reference: Npswqd008129 Permit Version: 1 Effective Date: 1st July 2009 Issued Date: 4th June 2009 Revocation Date: Not Supplied Discharge Type: Sewage Discharges - Stw Storm Overflow/Storm Tank - Water Company Discharge Canal Environment: Receiving Water: An Unnamed Trib Shef & Sy Navi Status: New Consent (Water Resources Act 1991, Section 88 & Schedule 10 as amended by Environment Act 1995) Positional Accuracy: Located by supplier to within 10m Discharge Consents 3 Operator: Yorkshire Water Services Ltd A13SE 183 2 457760 Property Type: PUMPING STATION ON SEWERAGE NETWORK (WATER COMPANY) (SE) 404080 Location: Holmes Market Sps Whittington Road, Wheatley, Doncaster, South Yorkshire Authority: Environment Agency, North East Region Catchment Area: Don Tributaries Reference: 2568 Permit Version: 2 Effective Date: 21st July 2003 Issued Date: 21st July 2003 Revocation Date: 28th September 2009 Discharge Type: Sewage Discharges - Stw Storm Overflow/Storm Tank - Water Company Discharge Freshwater Stream/River Environment: Receiving Water: Trib Of River Don Status: Revoked (Water Resources Act 1991, Section 88 & Schedule 10 as amended by Environment Act 1995) Positional Accuracy: Located by supplier to within 10m Discharge Consents 4 Operator: Yorkshire Water Services Ltd A13SE 183 2 457670 Property Type: PUMPING STATION ON SEWERAGE NETWORK (WATER COMPANY) (S) 404050 Location: Holmes Market Sps Whittington Road, Wheatley, Doncaster, South Yorkshire Authority: Environment Agency, North East Region Catchment Area: Don Tributaries Reference: 2568 Permit Version: 2 Effective Date: 21st July 2003 Issued Date: 21st July 2003 Revocation Date: 28th September 2009 Discharge Type: Sewage Discharges - Stw Storm Overflow/Storm Tank - Water Company Discharge Freshwater Stream/River Environment: Receiving Water: Trib Of River Don Status: Revoked (Water Resources Act 1991, Section 88 & Schedule 10 as amended by Environment Act 1995) Positional Accuracy: Located by supplier to within 10m Discharge Consents 4 Operator: Yorkshire Water Services Ltd A13SE 183 2 457670 Property Type: PUMPING STATION ON SEWERAGE NETWORK (WATER COMPANY) (S) 404050 Location: Holmes Market Sps Whittington Road, Wheatley, Doncaster, South Yorkshire Authority: Environment Agency, North East Region Catchment Area: Don Tributaries Reference: 2568 Permit Version: 2 Effective Date: 21st July 2003 Issued Date: 21st July 2003 Revocation Date: 28th September 2009 Discharge Type: Sewage Discharges - Pumping Station - Water Company Discharge Freshwater Stream/River Environment: Receiving Water: Trib Of River Don Status: Revoked (Water Resources Act 1991, Section 88 & Schedule 10 as amended by Environment Act 1995) Positional Accuracy: Located by supplier to within 10m Order Number: 242475436_1_1 Date: 12-May-2020 rpr_ec_datasheet v53.0 A Landmark Information Group Service Page 3 of 104 Agency & Hydrological Quadrant Estimated Map Reference Details Distance Contact NGR ID (Compass Direction) From Site Discharge Consents 5 Operator: Prosper De Mulder, A12SE 503 2 457170 Property Type: MAKING OF FOOD PRODUCTS/DAIRY (W) 404120 Location: Prosper De Mulder Ltd Ings Road, Bentley, Doncaster, South Yorkshire Authority: Environment Agency, North East Region Catchment Area: Don Tributaries Reference: E547 Permit Version: 5 Effective Date: 3rd December 1997 Issued Date: 3rd December 1997 Revocation Date: 19th July 2005 Discharge Type: Trade Discharge - Process Water Discharge Freshwater Stream/River Environment: Receiving Water: River Don Status: Revoked (Water Resources Act 1991, Section 88 & Schedule 10 as amended by Environment Act 1995) Positional Accuracy: Located by supplier to within 10m Discharge Consents 5 Operator: Prosper De Mulder, A12SE 503 2 457170 Property Type: MAKING OF FOOD PRODUCTS/DAIRY (W) 404120 Location: Prosper De Mulder Ltd Ings Road, Bentley, Doncaster, South Yorkshire Authority: Environment Agency, North East Region Catchment Area: Don Tributaries Reference: E547 Permit Version: 4 Effective Date: 22nd September 1997 Issued Date: 22nd September 1997 Revocation Date: 2nd December 1997 Discharge Type: Trade Discharge - Process Water Discharge Freshwater Stream/River Environment: Receiving Water: River Don Status: Revised Consent, by Notice (Section 37(1)) Positional Accuracy: Located by supplier to within 10m Discharge Consents 5 Operator: Prosper De Mulder, A12SE 503 2 457170 Property Type: MAKING OF FOOD PRODUCTS/DAIRY (W) 404120 Location: Prosper De Mulder Ltd Ings Road, Bentley, Doncaster, South Yorkshire Authority: Environment Agency, North East Region Catchment Area: Don Tributaries Reference: E547 Permit Version: 3 Effective Date: 19th June 1985 Issued Date: 19th June 1985 Revocation Date: 21st September 1997 Discharge Type: Trade Discharge - Process Water Discharge Freshwater Stream/River Environment: Receiving Water: River Don Status: Transferred from COPA 1974 Positional Accuracy: Located by supplier to within 10m Discharge Consents 5 Operator: Prosper De Mulder, A12SE 503 2 457170 Property Type: MAKING OF FOOD PRODUCTS/DAIRY (W) 404120 Location: Prosper De Mulder Ltd Ings Road, Bentley, Doncaster, South Yorkshire Authority: Environment Agency, North East Region Catchment Area: Don Tributaries Reference: E547 Permit Version: 2 Effective Date: 18th April 1980 Issued Date: 18th April 1980 Revocation Date: 18th June 1985 Discharge Type: Trade Discharge - Process Water Discharge Freshwater Stream/River Environment: Receiving Water: River Don Status: Transferred from Rivers (Prevention of Pollution) Act 1951-1961 Positional Accuracy: Located by supplier to within 10m Order Number: 242475436_1_1 Date: 12-May-2020 rpr_ec_datasheet v53.0 A Landmark Information Group Service Page 4 of 104 Agency & Hydrological Quadrant Estimated Map Reference Details Distance Contact NGR ID (Compass Direction) From Site Discharge Consents 5 Operator: Prosper De Mulder, A12SE 503 2 457170 Property Type: MAKING OF FOOD PRODUCTS/DAIRY (W) 404120 Location: Prosper De Mulder Ltd Ings Road, Bentley, Doncaster, South Yorkshire Authority: Environment Agency, North East Region Catchment Area: Don Tributaries Reference: E547 Permit Version: 1 Effective Date: 3rd March 1980 Issued Date: 3rd March 1980 Revocation Date: 17th April 1980 Discharge Type: Trade Discharge - Process Water Discharge Freshwater Stream/River Environment: Receiving Water: River Don Status: Transferred from Rivers (Prevention of Pollution) Act 1951-1961 Positional Accuracy: Located by supplier to within 10m Discharge Consents 6 Operator: Yorkshire Water Services Ltd A7NE 783 2 457200 Property Type: PUMPING STATION ON SEWERAGE NETWORK (WATER COMPANY) (SW) 403600 Location: Grey Friar'S Road Sps, Grey Friar'S Road, Doncaster, South Yorkshire Authority: Environment Agency, North East Region Catchment Area: Don Tributaries Reference: Ywucd1/31 Permit Version: 1 Effective Date: 12th November 1997 Issued Date: 12th November 1997 Revocation Date: 6th March 2002 Discharge Type: Sewage Discharges - Pumping Station - Water Company Discharge Freshwater Stream/River Environment: Receiving Water: River Don Status: Revoked (Water Resources Act 1991, Section 88 & Schedule 10 as amended by Environment Act 1995) Positional Accuracy: Located by supplier to within 100m Discharge Consents 7 Operator: Croda (Goole) Ltd, A19SW 925 2 458300 Property Type: Undefined Or Other (NE) 404900 Location: Croda Chemicals (Ex Thelson Oils) L, Td Authority: Environment Agency, North East Region Catchment Area: Don Tributaries Reference: 3786 Permit Version: 2 Effective Date: 12th December 1989 Issued Date: 12th December 1989 Revocation Date: 2nd September 1993 Discharge Type: Trade Effluent Discharge Freshwater Stream/River Environment: Receiving Water: To River Don Status: Authorisation revoked Positional Accuracy: Manually corrected supplier location Discharge Consents 8 Operator: Yorkshire Water Services Ltd A7SE 932 2 457180 Property Type: STORM TANK/CSO ON SEWERAGE NETWORK (WATER COMPANY) (SW) 403434 Location: Doncaster Interchange Cso, North Bridge Road, Doncaster, South Yorkshire, Dn1 1la Authority: Environment Agency, North East Region Catchment Area: Don Tributaries Reference: Wra8327 Permit Version: 2 Effective Date: 15th November 2017 Issued Date: 15th November 2017 Revocation Date: Not Supplied Discharge Type: Sewage Discharges - Stw Storm Overflow/Storm Tank - Water Company Discharge Freshwater Stream/River Environment: Receiving Water: Culverted River Cheswold Status: Varied under EPR 2010 Positional Accuracy: Located by supplier to within 10m Order Number: 242475436_1_1 Date: 12-May-2020 rpr_ec_datasheet v53.0 A Landmark Information Group Service Page 5 of 104 Agency & Hydrological Quadrant Estimated Map Reference Details Distance Contact NGR ID (Compass Direction) From Site Discharge Consents 8 Operator: Yorkshire Water Services Ltd A7SE 936 2 457180 Property Type: STORM TANK/CSO ON SEWERAGE NETWORK (WATER COMPANY) (SW) 403430 Location: Doncaster Interchange Cso, North Bridge Road, Doncaster, South Yorkshire, Dn1 1la Authority: Environment Agency, North East Region Catchment Area: Don Tributaries Reference: Wra8327 Permit Version: 1 Effective Date: 26th May 2006 Issued Date: 26th May 2006 Revocation Date: 14th November 2017 Discharge Type: Sewage Discharges - Stw Storm Overflow/Storm Tank - Water Company Discharge Freshwater Stream/River Environment: Receiving Water: Culverted River Cheswold Status: New Consent (Water Resources Act 1991, Section 88 & Schedule 10 as amended by Environment Act 1995) Positional Accuracy: Located by supplier to within 10m Discharge Consents 9 Operator: Yorkshire Water Services Limited A19SE 940 2 458390 Property Type: STORM TANK/CSO ON SEWERAGE NETWORK (WATER COMPANY) (NE) 404825 Location: Harrowden Road Cso, O/S 2a Harrowden Road, Doncaster, South Yorkshire, Dn2 4eh Authority: Environment Agency, North East Region Catchment Area: Not Supplied Reference: Eprup3225xv Permit Version: 1 Effective Date: 6th October 2016 Issued Date: 6th October 2016 Revocation Date: Not Supplied Discharge Type: Sewage Discharges - Stw Storm Overflow/Storm Tank - Water Company Discharge Freshwater Stream/River Environment: Receiving Water: Drain Leading To The River Don Status: New issued under EPR 2010 Positional Accuracy: Located by supplier to within 10m Integrated Pollution Controls 10 Name: Croda Application Chemicals Ltd A19SW 763 2 458197 Location: Churchill Road, DONCASTER, South Yorkshire, DN1 2TH (NE) 404774 Authority: Environment Agency, North East Region Permit Reference: BA1672 Dated: 26th January 1998 Process Type: IPC minor (non-substantial) variation to previous variation Description: 1.4 A (A) Petroleum processes within the Fuel & Power Industry Status: Authorisation superseded by a substantial or non substantial variation Positional Accuracy: Automatically positioned to the address Integrated Pollution Controls 10 Name: Croda Application Chemicals Ltd A19SW 766 2 458197 Location: Churchill Road, DONCASTER, South Yorkshire, DN1 2TH (NE) 404779 Authority: Environment Agency, North East Region Permit Reference: Bq3967 Dated: 6th February 2002 Process Type: IPC minor (non-substantial) variation to previous variation Description: 1.4 A (A) Petroleum processes within the Fuel & Power Industry Status: Authorisation revoked Positional Accuracy: Automatically positioned to the address Integrated Pollution Controls 10 Name: Croda Application Chemicals Ltd A19SW 766 2 458202 Location: Churchill Road, DONCASTER, South Yorkshire, DN1 2TH (NE) 404774 Authority: Environment Agency, North East Region Permit Reference: BE2140 Dated: 24th November 1998 Process Type: IPC minor (non-substantial) variation to previous variation Description: 1.4 A (A) Petroleum processes within the Fuel & Power Industry Status: Authorisation superseded by a substantial or non substantial variation Positional Accuracy: Automatically positioned to the address Integrated Pollution Controls 10 Name: Croda Application Chemicals Ltd A19SW 766 2 458197 Location: Churchill Road, DONCASTER, South Yorkshire, DN1 2TH (NE) 404779 Authority: Environment Agency, North East Region Permit Reference: AF7673 Dated: 31st March 1993 Process Type: IPC application for process that was regulated by HMIP for air releases under previous legislation Description: 1.4 A (A) Petroleum processes within the Fuel & Power Industry Status: Authorisation superseded by a substantial or non substantial variation Positional Accuracy: Automatically positioned to the address Order Number: 242475436_1_1 Date: 12-May-2020 rpr_ec_datasheet v53.0 A Landmark Information Group Service Page 6 of 104 Agency & Hydrological Quadrant Estimated Map Reference Details Distance Contact NGR ID (Compass Direction) From Site Integrated Pollution Prevention And Control 11 Name: Saria Limited A12NE 485 2 457234 Location: Saria Limited, Ings Road, Doncaster, South Yorkshire, DN5 9TL (NW) 404462 Authority: Environment Agency, North East Region Permit Reference: GP3603PD Original Permit Ref: Up3637py Effective Date: 6th September 2019 Status: Effective Application Type: Variation App. Sub Type: Simple Standard Variation Positional Accuracy: Automatically positioned to the address Activity Code: 6.8 A(1) (C) Activity Description: Animal, Vegetable And Food; Disposing Etc. Animal Carcasses Etc. Greater Than 10 T/Day Primary Activity: N Activity Code: 5.4 A(1) a) (i) Activity Description: DISPOSAL OF > 50 T/D NON-HAZARDOUS WASTE (> 100 T/D IF ONLY AD) INVOLVING BIOLOGICAL TREATMENT Primary Activity: N Activity Code: 0.0 Associated Process Activity Description: Associated Process Primary Activity: N Activity Code: 6.8 A(1) d) (iii) Activity Description: CREATED BY IED - TREATMENT AND PROCESSING (OTHER THAN PACKAGING) OF ANIMAL OR VEGETABLE RAW MATERIALS (OTHER THAN MILK ONLY) WITH FINISHED PRODUCT CAPACITY GREATER THAN FORMULA SHOWN IN REGS Primary Activity: Y Activity Code: 6.8 A(1) (D) (I) Activity Description: Animal Vegetable & Food; Treating Etc Animal Raw Materials (Not Milk) For Food >75T/D Primary Activity: N Activity Code: 6.8 B a) Activity Description: Dead Animal Or Vegetable Matter; Processing, Storing Or Drying Not Otherwise Listed With Release To Air Or Odour Primary Activity: N Integrated Pollution Prevention And Control 12 Name: Prosper De Mulder Ltd A17SE 556 2 457227 Location: Prosper De Mulder Limited, Pdm Group, Ings Road,Bentley,, DONCASTER, (NW) 404581 South Yorkshire, DN5 9SW Authority: Environment Agency, North East Region Permit Reference: DP3630ZP Original Permit Ref: Up3637py Effective Date: 13th June 2013 Status: Superseded By Variation Application Type: Variation App. Sub Type: Standard Positional Accuracy: Automatically positioned to the address Activity Code: 6.8 B a) Activity Description: Dead Animal Or Vegetable Matter; Processing, Storing Or Drying Not Otherwise Listed With Release To Air Or Odour Primary Activity: N Activity Code: 6.8 A(1) (D) (I) Activity Description: Animal Vegetable & Food; Treating Etc Animal Raw Materials (Not Milk) For Food >75T/D Primary Activity: N Activity Code: 6.8 A(1) (D) (I) Activity Description: Animal Vegetable & Food; Treating Etc Animal Raw Materials (Not Milk) For Food >75T/D Primary Activity: Y Activity Code: 0.0 Associated Process Activity Description: Associated Process Primary Activity: N Order Number: 242475436_1_1 Date: 12-May-2020 rpr_ec_datasheet v53.0 A Landmark Information Group Service Page 7 of 104 Agency & Hydrological Quadrant Estimated Map Reference Details Distance Contact NGR ID (Compass Direction) From Site Integrated Pollution Prevention And Control 12 Name: Prosper De Mulder Ltd A17SE 556 2 457227 Location: Food And Drink, Bentley Doncaster, Pdm Group, Ings Road,Bentley,, (NW) 404581 DONCASTER, South Yorkshire, DN5 9SW Authority: Environment Agency, North East Region Permit Reference: BP3136KT Original Permit Ref: Up3637py Effective Date: 15th August 2011 Status: Superseded By Variation Application Type: Variation App. Sub Type: Substantial Positional Accuracy: Automatically positioned to the address Activity Code: 6.8 A(1) (D) (I) Activity Description: Animal Vegetable & Food; Treating Etc Animal Raw Materials (Not Milk) For Food >75T/D Primary Activity: N Activity Code: 0.0 Associated Process Activity Description: Associated Process Primary Activity: N Activity Code: 6.8 A(1) (D) (I) Activity Description: Animal Vegetable & Food; Treating Etc Animal Raw Materials (Not Milk) For Food >75T/D Primary Activity: Y Activity Code: 6.8 B a) Activity Description: Dead Animal Or Vegetable Matter; Processing, Storing Or Drying Not Otherwise Listed With Release To Air Or Odour Primary Activity: N Integrated Pollution Prevention And Control 12 Name: Saria Limited A17SE 561 2 457220 Location: Saria - Ings Road - Epr/Up3637py, Ings Road, Doncaster, South Yorkshire, (NW) 404580 DN5 9TL Authority: Environment Agency, North East Region Permit Reference: EP3736VF Original Permit Ref: Up3637py Effective Date: 14th November 2014 Status: Superseded By Variation Application Type: Variation App. Sub Type: Standard Positional Accuracy: Located by supplier to within 10m Activity Code: 6.8 A(1) (D) (I) Activity Description: Animal Vegetable & Food; Treating Etc Animal Raw Materials (Not Milk) For Food >75T/D Primary Activity: Y Activity Code: 6.8 B a) Activity Description: Dead Animal Or Vegetable Matter; Processing, Storing Or Drying Not Otherwise Listed With Release To Air Or Odour Primary Activity: N Activity Code: 0.0 Associated Process Activity Description: Associated Process Primary Activity: N Activity Code: 6.8 A(1) (D) (I) Activity Description: Animal Vegetable & Food; Treating Etc Animal Raw Materials (Not Milk) For Food >75T/D Primary Activity: N Integrated Pollution Prevention And Control 13 Name: Prosper De Mulder Ltd A12NW 719 2 456956 Location: Food And Drink, Bentley Doncaster, Pdm Group, Ings Road, Bentley, South (W) 404373 Yorkshire, DN5 9SW Authority: Environment Agency, North East Region Permit Reference: Up3637py Original Permit Ref: Up3637py Effective Date: 30th June 2005 Status: Superseded By Variation Application Type: Application App. Sub Type: New Positional Accuracy: Manually positioned to the road within the address or location Activity Code: 0.0 Associated Process Activity Description: Associated Process Primary Activity: N Activity Code: 6.8 B a) Activity Description: Dead Animal Or Vegetable Matter; Processing, Storing Or Drying Not Otherwise Listed With Release To Air Or Odour Primary Activity: N Activity Code: 6.8 A(1) (D) (I) Activity Description: Animal Vegetable & Food; Treating Etc Animal Raw Materials (Not Milk) For Food >75T/D Primary Activity: Y Activity Code: 6.8 A(1) (D) (I) Activity Description: Animal Vegetable & Food; Treating Etc Animal Raw Materials (Not Milk) For Food >75T/D Primary Activity: N Order Number: 242475436_1_1 Date: 12-May-2020 rpr_ec_datasheet v53.0 A Landmark Information Group Service Page 8 of 104 Agency & Hydrological Quadrant Estimated Map Reference Details Distance Contact NGR ID (Compass Direction) From Site Local Authority Pollution Prevention and Controls 14 Name: St Georges Service Station A13SE 360 3 457964 Location: 4 Church Way, Doncaster, DN1 2RE (SE) 404040 Authority: Doncaster Metropolitan Borough Council, Environmental Services Permit Reference: EPR P10 T8 Dated: Not Supplied Process Type: Local Authority Pollution Prevention and Control Description: PG1/14 Petrol filling station Status: Permitted Positional Accuracy: Manually positioned to the road within the address or location Local Authority Pollution Prevention and Controls 15 Name: Robin G Ltd A8NE 456 3 457698 Location: Church Way, Doncaster, South Yorkshire, DN1 2RE (S) 403779 Authority: Doncaster Metropolitan Borough Council, Environmental Services Permit Reference: LAPPC 70 Dated: 8th January 1999 Process Type: Local Authority Pollution Prevention and Control Description: PG1/14 Petrol filling station Status: Permitted Positional Accuracy: Automatically positioned to the address Local Authority Pollution Prevention and Controls 16 Name: Malden Timber Ltd A14NW 480 3 458095 Location: 1 Radiant Road, DONCASTER, South Yorkshire, DN1 2TE (NE) 404434 Authority: Doncaster Metropolitan Borough Council, Environmental Services Permit Reference: Not Given Dated: 30th September 1991 Process Type: Local Authority Air Pollution Control Description: PG6/2 Manufacture of timber and wood-based products Status: Authorised Positional Accuracy: Manually positioned to the address or location Local Authority Pollution Prevention and Controls 16 Name: Hall And Company A14NW 495 3 458117 Location: 1 Radiance Road, DONCASTER, South Yorkshire, DN1 2TE (NE) 404423 Authority: Doncaster Metropolitan Borough Council, Environmental Services Permit Reference: EPA 13 Dated: 30th August 1993 Process Type: Local Authority Air Pollution Control Description: PG6/2 Manufacture of timber and wood-based products Status: Authorisation revoked Positional Accuracy: Manually positioned to the address or location Local Authority Pollution Prevention and Controls 17 Name: M & G Auto Electrics A9NW 495 3 458000 Location: Unit 8 Athron Developments, Athron Street, Doncaster, DN1 2ND (SE) 403874 Authority: Doncaster Metropolitan Borough Council, Environmental Services Permit Reference: LAPPC 8 Dated: 23rd March 2004 Process Type: Local Authority Pollution Prevention and Control Description: PG1/1Waste oil burners, less than 0.4MW net rated thermal input Status: Permitted Positional Accuracy: Located by supplier to within 10m Local Authority Pollution Prevention and Controls 18 Name: Apc (Gb) Ltd A17SE 563 3 457270 Location: Ings Road, Doncaster, DN5 9SW (NW) 404638 Authority: Doncaster Metropolitan Borough Council, Environmental Services Permit Reference: EPA 90 Dated: 21st April 2003 Process Type: Local Authority Air Pollution Control Description: PG6/38 Blood processing Status: Transferred to IPPC Positional Accuracy: Manually positioned to the road within the address or location Local Authority Pollution Prevention and Controls 19 Name: Prosper De Mulder Ltd A12NE 584 3 457176 Location: Ings Road, DONCASTER, DN5 9SW (NW) 404559 Authority: Doncaster Metropolitan Borough Council, Environmental Services Permit Reference: EPA 53 Dated: 14th June 1993 Process Type: Local Authority Air Pollution Control Description: PG6/24 Pet food manufacturing Status: Transferred to IPPC Positional Accuracy: Manually positioned to the road within the address or location Order Number: 242475436_1_1 Date: 12-May-2020 rpr_ec_datasheet v53.0 A Landmark Information Group Service Page 9 of 104 Agency & Hydrological Quadrant Estimated Map Reference Details Distance Contact NGR ID (Compass Direction) From Site Local Authority Pollution Prevention and Controls 20 Name: Nortec Ltd A12NE 637 3 457070 Location: Ings Road, Bentley, Doncaster (W) 404470 Authority: Doncaster Metropolitan Borough Council, Environmental Services Permit Reference: 90 Dated: Not Supplied Process Type: Local Authority Air Pollution Control Description: PG6/25 Vegetable oil extraction and fat and oil refining Status: Authorised Positional Accuracy: Manually positioned to the road within the address or location Local Authority Pollution Prevention and Controls 21 Name: Nortech Ltd A12NE 691 3 456992 Location: Ings Road, Doncaster, Dn5 9sw (W) 404405 Authority: Doncaster Metropolitan Borough Council, Environmental Services Permit Reference: EPA 99 Dated: Not Supplied Process Type: Local Authority Air Pollution Control Description: PG6/39 Animal by-products dealers Status: Transferred to IPPC Positional Accuracy: Manually positioned to the road within the address or location Local Authority Pollution Prevention and Controls 22 Name: Autobodies A7NE 858 3 457016 Location: Ropewalk, Marshgate, DONCASTER, DN5 8AF (SW) 403666 Authority: Doncaster Metropolitan Borough Council, Environmental Services Permit Reference: Not Supplied Dated: Not Supplied Process Type: Local Authority Air Pollution Control Description: PG1/1Waste oil burners, less than 0.4MW net rated thermal input Status: Authorisation revoked Positional Accuracy: Manually positioned to the road within the address or location Local Authority Pollution Prevention and Controls 23 Name: Pentagon Toyota Ltd A19SW 861 3 458281 Location: Wheatley Hall Road, Wheatley, Doncaster, Dn2 4lt (NE) 404829 Authority: Doncaster Metropolitan Borough Council, Environmental Services Permit Reference: LAPPC 104 Dated: 12th December 2005 Process Type: Local Authority Pollution Prevention and Control Description: PG6/34 Respraying of road vehicles Status: Permitted Positional Accuracy: Manually positioned to the address or location Local Authority Pollution Prevention and Controls 24 Name: Carnell Motor Group A7NW 874 3 456960 Location: Marshgate Industrial Estate, Doncaster, DN5 8AF (SW) 403711 Authority: Doncaster Metropolitan Borough Council, Environmental Services Permit Reference: Not Given Dated: Not Supplied Process Type: Local Authority Air Pollution Control Description: PG6/34 Respraying of road vehicles Status: Authorisation revoked Positional Accuracy: Manually positioned to the road within the address or location Local Authority Pollution Prevention and Controls 25 Name: Bentley Road Service Station A12NW 910 3 456752 Location: Bentley Road, DONCASTER, DN2 9AS (W) 404280 Authority: Doncaster Metropolitan Borough Council, Environmental Services Permit Reference: LAPPC 64 Dated: 31st December 1998 Process Type: Local Authority Pollution Prevention and Control Description: PG1/14 Petrol filling station Status: Permitted Positional Accuracy: Manually positioned to the address or location Local Authority Pollution Prevention and Controls 26 Name: Du Pont Uk Ltd A19SE 942 3 458404 Location: Wheatley Hall Road, Doncaster, DN2 (NE) 404809 Authority: Doncaster Metropolitan Borough Council, Environmental Services Permit Reference: EPA 80 Dated: 18th April 1994 Process Type: Local Authority Air Pollution Control Description: Part B - General Coating Process (No Specific Reference) Status: Authorisation revoked Positional Accuracy: Manually positioned to the road within the address or location Order Number: 242475436_1_1 Date: 12-May-2020 rpr_ec_datasheet v53.0 A Landmark Information Group Service Page 10 of 104 Agency & Hydrological Quadrant Estimated Map Reference Details Distance Contact NGR ID (Compass Direction) From Site Local Authority Pollution Prevention and Controls 27 Name: Johnsons Cleaners Uk Ltd A8SW 987 3 457543 Location: 41 High Street, Doncaster, Dn1 1de (S) 403253 Authority: Doncaster Metropolitan Borough Council, Environmental Services Permit Reference: LAPPC 121 Dated: 10th October 2007 Process Type: Local Authority Pollution Prevention and Control Description: PG6/46 Dry cleaning Status: Authorisation revoked Positional Accuracy: Manually positioned to the address or location Nearest Surface Water Feature A13NW 30 - 457646 (NW) 404259 Pollution Incidents to Controlled Waters 28 Property Type: Industrial Premises A13SE 144 2 457800 Location: St Marys Bridge/Jun Canal & Riv Don 17 (E) 404200 Authority: Environment Agency, North East Region Pollutant: Miscellaneous - Fire water / Foam Note: Not Supplied Incident Date: 19th December 1993 Incident Reference: 149312 Catchment Area: Not Given Receiving Water: Freshwater Stream/River Cause of Incident: Not Given Incident Severity: Category 3 - Minor Incident Positional Accuracy: Located by supplier to within 100m Pollution Incidents to Controlled Waters 29 Property Type: Industrial Premises A13NW 174 2 457500 Location: Ing Lane End/St Marys Bridge Don 16 (NW) 404300 Authority: Environment Agency, North East Region Pollutant: Crude Sewage Note: Not Supplied Incident Date: 28th September 1994 Incident Reference: 153439 Catchment Area: Not Given Receiving Water: Freshwater Stream/River Cause of Incident: Not Given Incident Severity: Category 2 - Significant Incident Positional Accuracy: Located by supplier to within 100m Pollution Incidents to Controlled Waters 30 Property Type: Fire Water A13NE 219 2 457800 Location: Strawberry Island Boat Club, Mildthorne Lane, DONCASTER (NE) 404400 Authority: Environment Agency, North East Region Pollutant: Oils - Waste Oil Note: Sheffield And South Yorkshire Navigation; No Fish Killed Incident Date: 23rd October 1998 Incident Reference: SH980371 Catchment Area: Don Tributaries Receiving Water: Canal Cause of Incident: Not Given Incident Severity: Category 2 - Significant Incident Positional Accuracy: Located by supplier to within 100m Pollution Incidents to Controlled Waters 31 Property Type: Miscellaneous Premises: Unknown A13NE 250 2 457900 Location: Mouth/Penistone Don Afl (E) 404300 Authority: Environment Agency, North East Region Pollutant: Not Given Note: Not Supplied Incident Date: 19th February 1990 Incident Reference: 107921 Catchment Area: Not Given Receiving Water: Freshwater Stream/River Cause of Incident: Not Given Incident Severity: Category 3 - Minor Incident Positional Accuracy: Located by supplier to within 100m Pollution Incidents to Controlled Waters 32 Property Type: Industrial Premises A13SE 275 2 457900 Location: Ing Lane End/St Marys Bridge Don 16 (SE) 404100 Authority: Environment Agency, North East Region Pollutant: Miscellaneous - Fire water / Foam Note: Not Supplied Incident Date: 17th October 1993 Incident Reference: 148658 Catchment Area: Not Given Receiving Water: Freshwater Stream/River Cause of Incident: Not Given Incident Severity: Category 3 - Minor Incident Positional Accuracy: Located by supplier to within 100m Order Number: 242475436_1_1 Date: 12-May-2020 rpr_ec_datasheet v53.0 A Landmark Information Group Service Page 11 of 104 Agency & Hydrological Quadrant Estimated Map Reference Details Distance Contact NGR ID (Compass Direction) From Site Pollution Incidents to Controlled Waters 33 Property Type: Road A13NE 290 2 457900 Location: Milethorn Lane, DONCASTER (NE) 404395 Authority: Environment Agency, North East Region Pollutant: Miscellaneous - Vehicle Washings And De Waxing Note: Watercourse :Sheffield And South Yorkshire Navigation; From Doncaster To Bramwith Junction Incident Date: 9th January 1998 Incident Reference: SH980005 Catchment Area: Sheffield And South Yorkshire Canal Receiving Water: Canal Cause of Incident: Unknown Incident Severity: Category 3 - Minor Incident Positional Accuracy: Unknown Pollution Incidents to Controlled Waters 33 Property Type: Industrial Premises A13NE 293 2 457900 Location: Ing Lane End/St Marys Bridge Don 16 (NE) 404400 Authority: Environment Agency, North East Region Pollutant: Oils - Lubricating Note: Not Supplied Incident Date: 22nd August 1994 Incident Reference: 152960 Catchment Area: Not Given Receiving Water: Freshwater Stream/River Cause of Incident: Not Given Incident Severity: Category 3 - Minor Incident Positional Accuracy: Located by supplier to within 100m Pollution Incidents to Controlled Waters 34 Property Type: Not Given A13SW 325 2 457500 Location: Ssy Navigation At, DONCASTER (SW) 403950 Authority: Environment Agency, North East Region Pollutant: Rubbish Note: No Pollution Found; No Fish Killed Incident Date: 1st January 1996 Incident Reference: SH960005 Catchment Area: Sheffield And South Yorkshire Canal Receiving Water: Freshwater Stream/River Cause of Incident: Unknown Incident Severity: Category 3 - Minor Incident Positional Accuracy: Located by supplier to within 100m Pollution Incidents to Controlled Waters 34 Property Type: Other General Premises A13SW 330 2 457500 Location: Ssy Navigation At, DONCASTER (SW) 403945 Authority: Environment Agency, North East Region Pollutant: Rubbish Note: No Fish Killed Incident Date: 1st January 1996 Incident Reference: SH960005 Catchment Area: Sheffield And South Yorkshire Canal Receiving Water: Freshwater Stream/River Cause of Incident: Not Given Incident Severity: Category 3 - Minor Incident Positional Accuracy: Located by supplier to within 100m Pollution Incidents to Controlled Waters 34 Property Type: Not Given A13SW 370 2 457500 Location: South Yorks Navigation, DONCASTER (SW) 403900 Authority: Environment Agency, North East Region Pollutant: Oils - Waste Oil Note: Pollution Found; No Fish Killed Incident Date: 9th June 1996 Incident Reference: SH960251 Catchment Area: Sheffield And South Yorkshire Canal Receiving Water: Canal Cause of Incident: Unknown Incident Severity: Category 3 - Minor Incident Positional Accuracy: Located by supplier to within 100m Pollution Incidents to Controlled Waters 35 Property Type: Surface Water Sewers A13NE 360 2 457900 Location: Ind Est/Ing Lane End Arksey Don 15 (NE) 404500 Authority: Environment Agency, North East Region Pollutant: Oils - Unknown Note: Not Supplied Incident Date: 12th July 1991 Incident Reference: 124386 Catchment Area: Not Given Receiving Water: Freshwater Stream/River Cause of Incident: Not Given Incident Severity: Category 3 - Minor Incident Positional Accuracy: Located by supplier to within 100m Order Number: 242475436_1_1 Date: 12-May-2020 rpr_ec_datasheet v53.0 A Landmark Information Group Service Page 12 of 104 Agency & Hydrological Quadrant Estimated Map Reference Details Distance Contact NGR ID (Compass Direction) From Site Pollution Incidents to Controlled Waters 36 Property Type: Other General Premises A8NW 374 2 457500 Location: South Yorks Navigation, DONCASTER (SW) 403895 Authority: Environment Agency, North East Region Pollutant: Oils - Waste Oil Note: No Fish Killed Incident Date: 9th June 1996 Incident Reference: SH960251 Catchment Area: Sheffield And South Yorkshire Canal Receiving Water: Canal Cause of Incident: Not Given Incident Severity: Category 3 - Minor Incident Positional Accuracy: Located by supplier to within 100m Pollution Incidents to Controlled Waters 37 Property Type: Industrial Premises A12NE 449 2 457300 Location: Ing Lane End/St Marys Bridge Don 16 (NW) 404500 Authority: Environment Agency, North East Region Pollutant: Sewage - Treated Effluent Note: Not Supplied Incident Date: 1st September 1994 Incident Reference: 153366 Catchment Area: Not Given Receiving Water: Freshwater Stream/River Cause of Incident: Not Given Incident Severity: Category 2 - Significant Incident Positional Accuracy: Located by supplier to within 100m Pollution Incidents to Controlled Waters 38 Property Type: Industrial Premises A12SE 462 2 457200 Location: Ing Lane End/St Marys Bridge Don 16 (W) 404200 Authority: Environment Agency, North East Region Pollutant: Industrial Effluent Note: Not Supplied Incident Date: 8th October 1990 Incident Reference: 118016 Catchment Area: Not Given Receiving Water: Freshwater Stream/River Cause of Incident: Not Given Incident Severity: Category 3 - Minor Incident Positional Accuracy: Located by supplier to within 100m Pollution Incidents to Controlled Waters 39 Property Type: Industrial Premises A12NE 465 2 457200 Location: Fishlake Drain/Stainforth Bridge Don 10 (W) 404295 Authority: Environment Agency, North East Region Pollutant: Unknown Note: Not Supplied Incident Date: 7th February 1990 Incident Reference: 107559 Catchment Area: Not Given Receiving Water: Not Given Cause of Incident: Not Given Incident Severity: Category 2 - Significant Incident Positional Accuracy: Located by supplier to within 100m Pollution Incidents to Controlled Waters 39 Property Type: Industrial Premises A12NE 466 2 457200 Location: Ing Lane End/St Marys Bridge Don 16 (W) 404300 Authority: Environment Agency, North East Region Pollutant: Sewage - Treated Effluent Note: Not Supplied Incident Date: 9th November 1994 Incident Reference: 153632 Catchment Area: Not Given Receiving Water: Freshwater Stream/River Cause of Incident: Not Given Incident Severity: Category 3 - Minor Incident Positional Accuracy: Located by supplier to within 100m Pollution Incidents to Controlled Waters 40 Property Type: Industrial Premises A12NE 490 2 457200 Location: Ing Lane End/St Marys Bridge Don 16 (W) 404400 Authority: Environment Agency, North East Region Pollutant: Industrial Effluent Note: Not Supplied Incident Date: 28th February 1991 Incident Reference: 120158 Catchment Area: Not Given Receiving Water: Freshwater Stream/River Cause of Incident: Not Given Incident Severity: Category 2 - Significant Incident Positional Accuracy: Located by supplier to within 100m Order Number: 242475436_1_1 Date: 12-May-2020 rpr_ec_datasheet v53.0 A Landmark Information Group Service Page 13 of 104 Agency & Hydrological Quadrant Estimated Map Reference Details Distance Contact NGR ID (Compass Direction) From Site Pollution Incidents to Controlled Waters 41 Property Type: Fire Water A8NW 573 2 457450 Location: South Yorkshire Navigation Canal, Doncaster Lock, Greyfriars Road, (S) 403700 DONCASTER Authority: Environment Agency, North East Region Pollutant: Chemicals - Paints / Dyes Note: Sheffield And South Yorkshire Navigation; No Fish Killed Incident Date: 2nd June 1998 Incident Reference: SH980243 Catchment Area: Sheffield And South Yorkshire Canal Receiving Water: Pond/Lake Cause of Incident: Not Given Incident Severity: Category 3 - Minor Incident Positional Accuracy: Located by supplier to within 100m Pollution Incidents to Controlled Waters 41 Property Type: Miscellaneous Premises: Unknown A8NW 587 2 457405 Location: St Marys Bridge/Jun Canal & Riv Don 17 (SW) 403705 Authority: Environment Agency, North East Region Pollutant: Oils - Unknown Note: Not Supplied Incident Date: 1st July 1992 Incident Reference: 134408 Catchment Area: Not Given Receiving Water: Freshwater Stream/River Cause of Incident: Not Given Incident Severity: Category 2 - Significant Incident Positional Accuracy: Located by supplier to within 100m Pollution Incidents to Controlled Waters 41 Property Type: Rail A8NW 591 2 457405 Location: Boat Dock In Canal To Rear Of, Greyfriars Road, DONCASTER (SW) 403700 Authority: Environment Agency, North East Region Pollutant: Oils - Waste Oil Note: Pollution Found; No Fish Killed Incident Date: 12th August 1996 Incident Reference: SH960389 Catchment Area: Sheffield And South Yorkshire Canal Receiving Water: Canal Cause of Incident: Unknown Incident Severity: Category 3 - Minor Incident Positional Accuracy: Located by supplier to within 100m Pollution Incidents to Controlled Waters 41 Property Type: Miscellaneous Premises: Unknown A8NW 593 2 457400 Location: Ing Lane End/St Marys Bridge Don 16 (SW) 403700 Authority: Environment Agency, North East Region Pollutant: Oils - Diesel (Including Agricultural) Note: Not Supplied Incident Date: 16th May 1994 Incident Reference: 152035 Catchment Area: Not Given Receiving Water: Freshwater Stream/River Cause of Incident: Not Given Incident Severity: Category 3 - Minor Incident Positional Accuracy: Located by supplier to within 100m Pollution Incidents to Controlled Waters 41 Property Type: Miscellaneous Premises: Unknown A8NW 596 2 457405 Location: Ing Lane End/St Marys Bridge Don 16 (SW) 403695 Authority: Environment Agency, North East Region Pollutant: Oils - Unknown Note: Not Supplied Incident Date: 22nd September 1994 Incident Reference: 153174 Catchment Area: Not Given Receiving Water: Freshwater Stream/River Cause of Incident: Not Given Incident Severity: Category 2 - Significant Incident Positional Accuracy: Located by supplier to within 100m Pollution Incidents to Controlled Waters 41 Property Type: Industrial Premises A8NW 598 2 457400 Location: Ing Lane End/St Marys Bridge Don 16 (SW) 403695 Authority: Environment Agency, North East Region Pollutant: Oils - Diesel (Including Agricultural) Note: Not Supplied Incident Date: 25th July 1994 Incident Reference: 152642 Catchment Area: Not Given Receiving Water: Freshwater Stream/River Cause of Incident: Not Given Incident Severity: Category 3 - Minor Incident Positional Accuracy: Located by supplier to within 100m Order Number: 242475436_1_1 Date: 12-May-2020 rpr_ec_datasheet v53.0 A Landmark Information Group Service Page 14 of 104 Agency & Hydrological Quadrant Estimated Map Reference Details Distance Contact NGR ID (Compass Direction) From Site Pollution Incidents to Controlled Waters 42 Property Type: Other General Premises A7NE 632 2 457200 Location: St Marys Bridge/Jun Canal & Riv Don 17 (SW) 403800 Authority: Environment Agency, North East Region Pollutant: Oils - Unknown Note: Not Supplied Incident Date: 11th November 1991 Incident Reference: 128072 Catchment Area: Not Given Receiving Water: Freshwater Stream/River Cause of Incident: Not Given Incident Severity: Category 2 - Significant Incident Positional Accuracy: Located by supplier to within 100m Pollution Incidents to Controlled Waters 43 Property Type: Industrial Premises A7NE 643 2 457300 Location: Ing Lane End/St Marys Bridge Don 16 (SW) 403700 Authority: Environment Agency, North East Region Pollutant: Oils - Unknown Note: Not Supplied Incident Date: 25th April 1993 Incident Reference: 143456 Catchment Area: Not Given Receiving Water: Freshwater Stream/River Cause of Incident: Not Given Incident Severity: Category 1 - Major Incident Positional Accuracy: Located by supplier to within 100m Pollution Incidents to Controlled Waters 44 Property Type: Industrial: Other A19SW 653 2 458200 Location: Churchill Road, Wheatley, DONCASTER (NE) 404600 Authority: Environment Agency, North East Region Pollutant: Not Given Note: No Pollution Found; No Fish Killed Incident Date: 24th September 1996 Incident Reference: SH960409 Catchment Area: Don Receiving Water: Freshwater Stream/River Cause of Incident: Unknown Incident Severity: Category 3 - Minor Incident Positional Accuracy: Located by supplier to within 100m Pollution Incidents to Controlled Waters 45 Property Type: Industrial Premises A7NE 733 2 457300 Location: Ing Lane End/St Marys Bridge Don 16 (SW) 403595 Authority: Environment Agency, North East Region Pollutant: Oils - Other Fuel Oil Note: Not Supplied Incident Date: 26th September 1992 Incident Reference: 137852 Catchment Area: Not Given Receiving Water: Freshwater Stream/River Cause of Incident: Not Given Incident Severity: Category 2 - Significant Incident Positional Accuracy: Located by supplier to within 100m Pollution Incidents to Controlled Waters 46 Property Type: Industrial: Other A19SW 753 2 458250 Location: Wheatley, DONCASTER (NE) 404700 Authority: Environment Agency, North East Region Pollutant: Unknown Sewage Note: Watercourse :River Don; From River Dun Navigation To Marsh Gate Weir Incident Date: 17th February 1998 Incident Reference: SH980079 Catchment Area: Don Receiving Water: Freshwater Stream/River Cause of Incident: Unknown Incident Severity: Category 3 - Minor Incident Positional Accuracy: Located by supplier to within 100m Pollution Incidents to Controlled Waters 47 Property Type: Industrial Premises A7NE 783 2 457200 Location: Ing Lane End/St Marys Bridge Don 16 (SW) 403600 Authority: Environment Agency, North East Region Pollutant: Oils - Unknown Note: Not Supplied Incident Date: 22nd September 1992 Incident Reference: 136864 Catchment Area: Not Given Receiving Water: Freshwater Stream/River Cause of Incident: Not Given Incident Severity: Category 2 - Significant Incident Positional Accuracy: Located by supplier to within 100m Order Number: 242475436_1_1 Date: 12-May-2020 rpr_ec_datasheet v53.0 A Landmark Information Group Service Page 15 of 104 Agency & Hydrological Quadrant Estimated Map Reference Details Distance Contact NGR ID (Compass Direction) From Site Pollution Incidents to Controlled Waters 48 Property Type: Industrial Premises A7NE 845 2 457100 Location: Ing Lane End/St Marys Bridge Don 16 (SW) 403600 Authority: Environment Agency, North East Region Pollutant: Oils - Unknown Note: Not Supplied Incident Date: 10th June 1992 Incident Reference: 133900 Catchment Area: Not Given Receiving Water: Freshwater Stream/River Cause of Incident: Not Given Incident Severity: Category 2 - Significant Incident Positional Accuracy: Located by supplier to within 100m Pollution Incidents to Controlled Waters 49 Property Type: Other General Premises A12NW 877 2 456800 Location: Ing Lane End/St Marys Bridge Don 16 (W) 404400 Authority: Environment Agency, North East Region Pollutant: Animal Waste/Slurry Note: Not Supplied Incident Date: 17th July 1991 Incident Reference: 124490 Catchment Area: Not Given Receiving Water: No Pollution Cause of Incident: Not Given Incident Severity: Category 3 - Minor Incident Positional Accuracy: Located by supplier to within 100m Pollution Incidents to Controlled Waters 50 Property Type: Domestic/Residential A17SW 890 2 456900 Location: Ind Est/Ing Lane End Arksey Don 15 (NW) 404695 Authority: Environment Agency, North East Region Pollutant: Rubbish Note: Not Supplied Incident Date: 27th July 1990 Incident Reference: 113113 Catchment Area: Not Given Receiving Water: Freshwater Stream/River Cause of Incident: Not Given Incident Severity: Category 2 - Significant Incident Positional Accuracy: Located by supplier to within 100m Pollution Incidents to Controlled Waters 50 Property Type: Domestic/Residential A17SW 893 2 456900 Location: Ind Est/Ing Lane End Arksey Don 15 (NW) 404700 Authority: Environment Agency, North East Region Pollutant: Rubbish Note: Not Supplied Incident Date: 20th July 1990 Incident Reference: 112890 Catchment Area: Not Given Receiving Water: Freshwater Stream/River Cause of Incident: Not Given Incident Severity: Category 2 - Significant Incident Positional Accuracy: Located by supplier to within 100m Pollution Incidents to Controlled Waters 51 Property Type: Industrial Premises A7NE 915 2 457000 Location: Ing Lane End/St Marys Bridge Don 16 (SW) 403600 Authority: Environment Agency, North East Region Pollutant: Not Given Note: Not Supplied Incident Date: 18th October 1990 Incident Reference: 116281 Catchment Area: Not Given Receiving Water: Freshwater Stream/River Cause of Incident: Not Given Incident Severity: Category 2 - Significant Incident Positional Accuracy: Located by supplier to within 100m Pollution Incidents to Controlled Waters 52 Property Type: Miscellaneous Premises: Unknown A17NE 940 2 457300 Location: Ind Est/Ing Lane End Arksey Don 15 (NW) 405100 Authority: Environment Agency, North East Region Pollutant: Unknown Note: Not Supplied Incident Date: 26th April 1991 Incident Reference: 121919 Catchment Area: Not Given Receiving Water: Pond/Lake Cause of Incident: Not Given Incident Severity: Category 2 - Significant Incident Positional Accuracy: Located by supplier to within 100m Order Number: 242475436_1_1 Date: 12-May-2020 rpr_ec_datasheet v53.0 A Landmark Information Group Service Page 16 of 104 Agency & Hydrological Quadrant Estimated Map Reference Details Distance Contact NGR ID (Compass Direction) From Site Pollution Incidents to Controlled Waters 53 Property Type: Industrial Premises A12SW 961 2 456700 Location: Ing Lane End/St Marys Bridge Don 16 (W) 404200 Authority: Environment Agency, North East Region Pollutant: Oils - Waste Oil Note: Not Supplied Incident Date: 25th June 1992 Incident Reference: 134201 Catchment Area: Not Given Receiving Water: Freshwater Stream/River Cause of Incident: Not Given Incident Severity: Category 3 - Minor Incident Positional Accuracy: Located by supplier to within 100m River Quality Name: Sheffield_And_South_Yorks A13NW 5 2 457655 GQA Grade: River Quality D (W) 404234 Reach: Doncaster_Bramwith_Junctio Estimated Distance 10.9 (km): Flow Rate: Flow greater than 80 cumecs Flow Type: Canal Year: 2000 River Quality Name: River_Don A13NW 124 2 457605 GQA Grade: River Quality C (NW) 404343 Reach: Marsh_Gate_Weir_Mill_Dik Estimated Distance 1.3 (km): Flow Rate: Flow less than 10 cumecs Flow Type: Tidal Year: 2000 River Quality Biology Sampling Points 54 Name: Don A13NW 91 2 457600 Reach: Marsh Gate Weir To Mill Dike (NW) 404300 Estimated Distance: 1.30 Positional Accuracy: Manually corrected supplier location Year: 1990 GQA Grade: River Quality Biology GQA Grade F - Bad Year: 1995 GQA Grade: River Quality Biology GQA Grade F - Bad Year: 2000 GQA Grade: River Quality Biology GQA Grade E - Poor Year: 2002 GQA Grade: River Quality Biology GQA Grade E - Poor Year: 2003 GQA Grade: River Quality Biology GQA Grade E - Poor Year: 2004 GQA Grade: River Quality Biology GQA Grade D - Fair Year: 2005 GQA Grade: River Quality Biology GQA Grade D - Fair Year: 2006 GQA Grade: River Quality Biology GQA Grade D - Fair Year: 2007 GQA Grade: River Quality Biology GQA Grade E - Poor Year: 2008 GQA Grade: River Quality Biology GQA Grade E - Poor Year: 2009 GQA Grade: River Quality Biology GQA Grade E - Poor Order Number: 242475436_1_1 Date: 12-May-2020 rpr_ec_datasheet v53.0 A Landmark Information Group Service Page 17 of 104 Agency & Hydrological Quadrant Estimated Map Reference Details Distance Contact NGR ID (Compass Direction) From Site River Quality Biology Sampling Points 55 Name: Bentley Mill Stream A18NW 890 2 457492 Reach: Split To Dry Stream (N) 405106 Estimated Distance: 0.40 Positional Accuracy: Located by supplier to within 10m Year: 1990 GQA Grade: River Quality Biology GQA Grade Not Supplied Year: 1995 GQA Grade: River Quality Biology GQA Grade D - Fair Year: 2000 GQA Grade: River Quality Biology GQA Grade D - Fair Year: 2002 GQA Grade: River Quality Biology GQA Grade D - Fair Year: 2003 GQA Grade: River Quality Biology GQA Grade E - Poor Year: 2004 GQA Grade: River Quality Biology GQA Grade E - Poor Year: 2005 GQA Grade: River Quality Biology GQA Grade E - Poor Year: 2006 GQA Grade: River Quality Biology GQA Grade E - Poor Year: 2007 GQA Grade: River Quality Biology GQA Grade E - Poor Year: 2008 GQA Grade: River Quality Biology GQA Grade E - Poor Year: 2009 GQA Grade: River Quality Biology GQA Grade E - Poor Substantiated Pollution Incident Register 56 Authority: Environment Agency - North East Region, Yorkshire Area A13SW 64 2 457624 Incident Date: 20th June 2005 (SW) 404181 Incident Reference: 322027 Water Impact: Category 3 - Minor Incident Air Impact: Category 2 - Significant Incident Land Impact: Category 4 - No Impact Positional Accuracy: Located by supplier to within 10m Pollutant: Atmospheric Pollutants and Effects: Smoke Pollutant: Atmospheric Pollutants And Effects: Soot/Smuts Pollutant: Contaminated Water: Firefighting Run-Off Substantiated Pollution Incident Register 57 Authority: Environment Agency - North East Region, Yorkshire Area A13NE 414 2 457948 Incident Date: 27th June 2004 (NE) 404529 Incident Reference: 247254 Water Impact: Category 2 - Significant Incident Air Impact: Category 4 - No Impact Land Impact: Category 4 - No Impact Positional Accuracy: Located by supplier to within 10m Pollutant: Oils And Fuel: Mixed/Waste Oils Substantiated Pollution Incident Register 57 Authority: Environment Agency - North East Region, Yorkshire Area A13NE 445 2 457960 Incident Date: 30th November 2004 (NE) 404561 Incident Reference: 280503 Water Impact: Category 4 - No Impact Air Impact: Category 3 - Minor Incident Land Impact: Category 2 - Significant Incident Positional Accuracy: Located by supplier to within 10m Pollutant: General Biodegradable : Other Substantiated Pollution Incident Register 57 Authority: Environment Agency - North East Region, Yorkshire Area A13NE 448 2 457961 Incident Date: 4th November 2006 (NE) 404564 Incident Reference: 448223 Water Impact: Category 4 - No Impact Air Impact: Category 3 - Minor Incident Land Impact: Category 2 - Significant Incident Positional Accuracy: Located by supplier to within 10m Pollutant: Atmospheric Pollutants and Effects: Fumes Pollutant: Oils - Unknown Substantiated Pollution Incident Register 58 Authority: Environment Agency - North East Region, Yorkshire Area A18SE 468 2 457981 Incident Date: 13th August 2002 (NE) 404572 Incident Reference: 99807 Water Impact: Category 4 - No Impact Air Impact: Category 3 - Minor Incident Land Impact: Category 2 - Significant Incident Positional Accuracy: Located by supplier to within 10m Pollutant: Asbestos Waste Pollutant: Specific Waste Materials: Commercial Waste Order Number: 242475436_1_1 Date: 12-May-2020 rpr_ec_datasheet v53.0 A Landmark Information Group Service Page 18 of 104 Agency & Hydrological Quadrant Estimated Map Reference Details Distance Contact NGR ID (Compass Direction) From Site Substantiated Pollution Incident Register 59 Authority: Environment Agency - North East Region, Yorkshire Area A19SW 637 2 458105 Incident Date: 13th January 2004 (NE) 404688 Incident Reference: 210644 Water Impact: Category 3 - Minor Incident Air Impact: Category 4 - No Impact Land Impact: Category 4 - No Impact Positional Accuracy: Located by supplier to within 10m Pollutant: Oils And Fuel: Mixed/Waste Oils Substantiated Pollution Incident Register 60 Authority: Environment Agency - North East Region, Yorkshire Area A12NW 703 2 456981 Incident Date: 18th July 2006 (W) 404414 Incident Reference: 418269 Water Impact: Category 4 - No Impact Air Impact: Category 2 - Significant Incident Land Impact: Category 4 - No Impact Positional Accuracy: Located by supplier to within 10m Pollutant: Other Pollutant Substantiated Pollution Incident Register 61 Authority: Environment Agency - North East Region, Yorkshire Area A19SW 796 2 458151 Incident Date: 23rd August 2007 (NE) 404858 Incident Reference: 525660 Water Impact: Category 3 - Minor Incident Air Impact: Category 2 - Significant Incident Land Impact: Category 4 - No Impact Positional Accuracy: Located by supplier to within 10m Pollutant: Other Pollutant Water Abstractions 62 Operator: Saria Ltd A13NW 341 2 457370 Licence Number: 2/27/09/099 (NW) 404410 Permit Version: 101 Location: Borehole - Magnesian Limestone Authority: Environment Agency, North East Region Abstraction: Food And Drink: General Cooling (Existing Licences Only) (Low Loss) Abstraction Type: Water may be abstracted from a single point Source: Groundwater Daily Rate (m3): Not Supplied Yearly Rate (m3): Not Supplied Details: Company'S Premises At Ings Road, Doncaster Authorised Start: 01 January Authorised End: 31 December Permit Start Date: 22nd October 2018 Permit End Date: Not Supplied Positional Accuracy: Located by supplier to within 10m Water Abstractions 62 Operator: Saria Ltd A13NW 341 2 457370 Licence Number: 2/27/09/099 (NW) 404410 Permit Version: 101 Location: Borehole - Magnesian Limestone Authority: Environment Agency, North East Region Abstraction: Food And Drink: General Use (Medium Loss) Abstraction Type: Water may be abstracted from a single point Source: Groundwater Daily Rate (m3): Not Supplied Yearly Rate (m3): Not Supplied Details: Ings Road, Doncaster Authorised Start: 01 January Authorised End: 31 December Permit Start Date: 22nd October 2018 Permit End Date: Not Supplied Positional Accuracy: Located by supplier to within 10m Water Abstractions 62 Operator: Prosper De Mulder Ltd A13NW 341 2 457370 Licence Number: 2/27/09/099 (NW) 404410 Permit Version: 100 Location: Borehole - Magnesian Limestone Authority: Environment Agency, North East Region Abstraction: Food And Drink: General Cooling (Existing Licences Only) (Low Loss) Abstraction Type: Water may be abstracted from a single point Source: Groundwater Daily Rate (m3): 873 Yearly Rate (m3): 313674 Details: Company'S Premises At Ings Road, Doncaster Authorised Start: 01 January Authorised End: 31 December Permit Start Date: 5th October 1973 Permit End Date: Not Supplied Positional Accuracy: Located by supplier to within 100m Order Number: 242475436_1_1 Date: 12-May-2020 rpr_ec_datasheet v53.0 A Landmark Information Group Service Page 19 of 104 Agency & Hydrological Quadrant Estimated Map Reference Details Distance Contact NGR ID (Compass Direction) From Site Water Abstractions 62 Operator: Prosper De Mulder Ltd A13NW 341 2 457370 Licence Number: 2/27/09/099 (NW) 404410 Permit Version: 100 Location: Borehole - Magnesian Limestone Authority: Environment Agency, North East Region Abstraction: Food And Drink: General Use (Medium Loss) Abstraction Type: Water may be abstracted from a single point Source: Groundwater Daily Rate (m3): Not Supplied Yearly Rate (m3): Not Supplied Details: Ings Road, Doncaster Authorised Start: 01 January Authorised End: 31 December Permit Start Date: 5th October 1973 Permit End Date: Not Supplied Positional Accuracy: Located by supplier to within 10m Water Abstractions 63 Operator: Saria Ltd A12NE 494 2 457200 Licence Number: 2/27/09/031 (W) 404410 Permit Version: 101 Location: Borehole - Sherwood Sandstone Authority: Environment Agency, North East Region Abstraction: Food And Drink: General Cooling (Existing Licences Only) (Low Loss) Abstraction Type: Water may be abstracted from a single point Source: Groundwater Daily Rate (m3): Not Supplied Yearly Rate (m3): Not Supplied Details: Ings Road, Doncaster Authorised Start: 01 January Authorised End: 31 December Permit Start Date: 22nd October 2018 Permit End Date: Not Supplied Positional Accuracy: Located by supplier to within 10m Water Abstractions 63 Operator: Saria Ltd A12NE 494 2 457200 Licence Number: 2/27/09/031 (W) 404410 Permit Version: 101 Location: Borehole - Sherwood Sandstone Authority: Environment Agency, North East Region Abstraction: Food And Drink: General Use (Medium Loss) Abstraction Type: Water may be abstracted from a single point Source: Groundwater Daily Rate (m3): Not Supplied Yearly Rate (m3): Not Supplied Details: Ings Road, Doncaster Authorised Start: 01 January Authorised End: 31 December Permit Start Date: 22nd October 2018 Permit End Date: Not Supplied Positional Accuracy: Located by supplier to within 10m Water Abstractions 63 Operator: Prosper De Mulder Ltd A12NE 494 2 457200 Licence Number: 2/27/09/031 (W) 404410 Permit Version: 100 Location: Borehole - Sherwood Sandstone Authority: Environment Agency, North East Region Abstraction: Food And Drink: General Cooling (Existing Licences Only) (Low Loss) Abstraction Type: Water may be abstracted from a single point Source: Groundwater Daily Rate (m3): 436 Yearly Rate (m3): 154564 Details: Ings Road, Doncaster Authorised Start: 01 January Authorised End: 31 December Permit Start Date: 23rd February 1966 Permit End Date: Not Supplied Positional Accuracy: Located by supplier to within 100m Order Number: 242475436_1_1 Date: 12-May-2020 rpr_ec_datasheet v53.0 A Landmark Information Group Service Page 20 of 104 Agency & Hydrological Quadrant Estimated Map Reference Details Distance Contact NGR ID (Compass Direction) From Site Water Abstractions 63 Operator: Prosper De Mulder Ltd A12NE 494 2 457200 Licence Number: 2/27/09/031 (W) 404410 Permit Version: 100 Location: Borehole - Sherwood Sandstone Authority: Environment Agency, North East Region Abstraction: Food And Drink: General Use (Medium Loss) Abstraction Type: Water may be abstracted from a single point Source: Groundwater Daily Rate (m3): Not Supplied Yearly Rate (m3): Not Supplied Details: Ings Road, Doncaster Authorised Start: 01 January Authorised End: 31 December Permit Start Date: 23rd February 1966 Permit End Date: Not Supplied Positional Accuracy: Located by supplier to within 10m Water Abstractions 64 Operator: D J & M P Murray (Properties) Ltd A8NW 557 2 457500 Licence Number: 2/27/09/012 (S) 403700 Permit Version: Not Supplied Location: Hanley's Mill, Fishergate, DONCASTER Authority: Environment Agency, North East Region Abstraction: General Industrial Abstraction Type: Not Supplied Source: Groundwater Daily Rate (m3): 182 Yearly Rate (m3): 45460 Details: Not Supplied Authorised Start: Not Supplied Authorised End: Not Supplied Permit Start Date: Not Supplied Permit End Date: Not Supplied Positional Accuracy: Located by supplier to within 100m Water Abstractions 65 Operator: Prosper De Mulder Ltd A17SE 767 2 457220 Licence Number: 2/27/09/060 (NW) 404860 Permit Version: 100 Location: Bentley Ings Drain Authority: Environment Agency, North East Region Abstraction: Food And Drink: General Cooling (Existing Licences Only) (Low Loss) Abstraction Type: Water may be abstracted from a single point Source: Surface Daily Rate (m3): 109 Yearly Rate (m3): 38641 Details: Ings Road, Doncaster Authorised Start: 01 January Authorised End: 31 December Permit Start Date: 17th March 1966 Permit End Date: Not Supplied Positional Accuracy: Located by supplier to within 100m Water Abstractions 65 Operator: Prosper De Mulder Ltd A17SE 767 2 457220 Licence Number: 2/27/09/060 (NW) 404860 Permit Version: 100 Location: Bentley Ings Drain Authority: Environment Agency, North East Region Abstraction: Food And Drink: General Use (Medium Loss) Abstraction Type: Water may be abstracted from a single point Source: Surface Daily Rate (m3): Not Supplied Yearly Rate (m3): Not Supplied Details: Ings Road, Doncaster Authorised Start: 01 January Authorised End: 31 December Permit Start Date: 17th March 1966 Permit End Date: Not Supplied Positional Accuracy: Located by supplier to within 10m Order Number: 242475436_1_1 Date: 12-May-2020 rpr_ec_datasheet v53.0 A Landmark Information Group Service Page 21 of 104 Agency & Hydrological Quadrant Estimated Map Reference Details Distance Contact NGR ID (Compass Direction) From Site Water Abstractions 66 Operator: British Waterways A19SW 800 2 458100 Licence Number: 2/27/09/122 (NE) 404900 Permit Version: Not Supplied Location: Location Description Not Available Authority: Environment Agency, North East Region Abstraction: Cooling Abstraction Type: Not Supplied Source: Surface Daily Rate (m3): 9620 Yearly Rate (m3): 3455000 Details: Licence Revoked Authorised Start: Not Supplied Authorised End: Not Supplied Permit Start Date: Not Supplied Permit End Date: Not Supplied Positional Accuracy: Located by supplier to within 100m Water Abstractions 67 Operator: Canal And River Trust A7NE 908 2 457030 Licence Number: 2/27/07/067 (SW) 403580 Permit Version: 1 Location: River Don - Doncaster Lock Authority: Environment Agency, North East Region Abstraction: Production of Energy: Process water Abstraction Type: Water may be abstracted from a single point Source: Surface Daily Rate (m3): Not Supplied Yearly Rate (m3): Not Supplied Details: Powerfuel Power Ltd, Hatfield Colleriey, Waggons Lane, Stainforth, Doncaster Authorised Start: 01 April Authorised End: 31 March Permit Start Date: 4th April 2016 Permit End Date: Not Supplied Positional Accuracy: Located by supplier to within 10m Water Abstractions 68 Operator: Eagle Star Assurance Co Ltd A19SE 997 2 458400 Licence Number: 2/27/09/033 (NE) 404900 Permit Version: 101 Location: Borehole No3 - Sherwood Sandstone - Doncaster Authority: Environment Agency, North East Region Abstraction: Textiles & Leather: Boiler Feed Abstraction Type: Water may be abstracted from a single point Source: Groundwater Daily Rate (m3): Not Supplied Yearly Rate (m3): Not Supplied Details: Wheatley Hall Rd & Exeter Rd, Doncaster Authorised Start: 01 January Authorised End: 31 December Permit Start Date: 30th June 1999 Permit End Date: Not Supplied Positional Accuracy: Located by supplier to within 10m Water Abstractions 68 Operator: Eagle Star Assurance Co Ltd A19SE 997 2 458400 Licence Number: 2/27/09/033 (NE) 404900 Permit Version: 101 Location: Borehole No3 - Sherwood Sandstone - Doncaster Authority: Environment Agency, North East Region Abstraction: Textiles & Leather: General Cooling (Existing Licences Only) (Low Loss) Abstraction Type: Water may be abstracted from a single point Source: Groundwater Daily Rate (m3): Not Supplied Yearly Rate (m3): Not Supplied Details: Wheatley Hall Rd & Exeter Rd, Doncaster Authorised Start: 01 January Authorised End: 31 December Permit Start Date: 30th June 1999 Permit End Date: Not Supplied Positional Accuracy: Located by supplier to within 10m Order Number: 242475436_1_1 Date: 12-May-2020 rpr_ec_datasheet v53.0 A Landmark Information Group Service Page 22 of 104 Agency & Hydrological Quadrant Estimated Map Reference Details Distance Contact NGR ID (Compass Direction) From Site Water Abstractions 68 Operator: Eagle Star Assurance Co Ltd A19SE 997 2 458400 Licence Number: 2/27/09/033 (NE) 404900 Permit Version: 101 Location: Borehole No3 - Sherwood Sandstone - Doncaster Authority: Environment Agency, North East Region Abstraction: Textiles & Leather: General Use (High Loss) Abstraction Type: Water may be abstracted from a single point Source: Groundwater Daily Rate (m3): Not Supplied Yearly Rate (m3): Not Supplied Details: I.C.I. Fibres Ltd., Wheatley Lane, Doncaster Authorised Start: 01 January Authorised End: 31 December Permit Start Date: 30th June 1999 Permit End Date: Not Supplied Positional Accuracy: Located by supplier to within 10m Water Abstractions 68 Operator: Du Pont (Uk) Ltd A19SE 997 2 458400 Licence Number: 2/27/09/033 (NE) 404900 Permit Version: 100 Location: Borehole No3 - Sherwood Sandstone - Doncaster Authority: Environment Agency, North East Region Abstraction: Textiles & Leather: General Cooling (Existing Licences Only) (Low Loss) Abstraction Type: Water may be abstracted from a single point Source: Groundwater Daily Rate (m3): 6819 Yearly Rate (m3): 590980 Details: I.C.I. Fibres Ltd., Wheatley Lane, Doncaster Authorised Start: 01 January Authorised End: 31 December Permit Start Date: 1st July 1993 Permit End Date: Not Supplied Positional Accuracy: Located by supplier to within 100m Water Abstractions 68 Operator: Du Pont (Uk) Ltd A19SE 997 2 458400 Licence Number: 2/27/09/033 (NE) 404900 Permit Version: 100 Location: Borehole No3 - Sherwood Sandstone - Doncaster Authority: Environment Agency, North East Region Abstraction: Textiles & Leather: Boiler Feed Abstraction Type: Water may be abstracted from a single point Source: Groundwater Daily Rate (m3): Not Supplied Yearly Rate (m3): Not Supplied Details: I.C.I. Fibres Ltd., Wheatley Lane, Doncaster Authorised Start: 01 January Authorised End: 31 December Permit Start Date: 1st July 1993 Permit End Date: Not Supplied Positional Accuracy: Located by supplier to within 10m Water Abstractions 68 Operator: Du Pont (Uk) Ltd A19SE 997 2 458400 Licence Number: 2/27/09/033 (NE) 404900 Permit Version: 100 Location: Borehole No3 - Sherwood Sandstone - Doncaster Authority: Environment Agency, North East Region Abstraction: Textiles & Leather: General Use (High Loss) Abstraction Type: Water may be abstracted from a single point Source: Groundwater Daily Rate (m3): Not Supplied Yearly Rate (m3): Not Supplied Details: I.C.I. Fibres Ltd., Wheatley Lane, Doncaster Authorised Start: 01 January Authorised End: 31 December Permit Start Date: 1st July 1993 Permit End Date: Not Supplied Positional Accuracy: Located by supplier to within 10m Order Number: 242475436_1_1 Date: 12-May-2020 rpr_ec_datasheet v53.0 A Landmark Information Group Service Page 23 of 104 Agency & Hydrological Quadrant Estimated Map Reference Details Distance Contact NGR ID (Compass Direction) From Site Water Abstractions Operator: Central Electricity Generating Board A7NW 1068 2 456800 Licence Number: 2/27/07/037 (SW) 403600 Permit Version: Not Supplied Location: Location Description Not Available Authority: Environment Agency, North East Region Abstraction: Cooling/Gen Ind. Abstraction Type: Not Supplied Source: Surface Daily Rate (m3): 619067 Yearly Rate (m3): 48002500 Details: Licence Revoked Authorised Start: Not Supplied Authorised End: Not Supplied Permit Start Date: Not Supplied Permit End Date: Not Supplied Positional Accuracy: Located by supplier to within 100m Water Abstractions Operator: Abbey Glen Ltd A16NE 1492 2 456555 Licence Number: 2/27/09/191/R01 (NW) 405234 Permit Version: 3 Location: Borehole 1 - Sherwood Sandstone - Bentley Authority: Environment Agency, North East Region Abstraction: Industrial; Commercial And Public Services: Laundry Use Abstraction Type: Water may be abstracted from a single point Source: Groundwater Daily Rate (m3): Not Supplied Yearly Rate (m3): Not Supplied Details: Not Supplied Authorised Start: 01 April Authorised End: 31 March Permit Start Date: 1st April 2017 Permit End Date: Not Supplied Positional Accuracy: Located by supplier to within 10m Water Abstractions Operator: Abbey Glen Ltd A16NE 1522 2 456520 Licence Number: 2/27/09/191 (NW) 405240 Permit Version: 2 Location: Borehole 1 - Sherwood Sandstone - Bentley Authority: Environment Agency, North East Region Abstraction: Industrial; Commercial And Public Services: Laundry Use Abstraction Type: Water may be abstracted from a single point Source: Groundwater Daily Rate (m3): Not Supplied Yearly Rate (m3): Not Supplied Details: Not Supplied Authorised Start: 01 January Authorised End: 31 December Permit Start Date: 9th October 2006 Permit End Date: Not Supplied Positional Accuracy: Located by supplier to within 10m Water Abstractions Operator: Bentley Textile Services Ltd A16NE 1522 2 456520 Licence Number: 2/27/09/191 (NW) 405240 Permit Version: 1 Location: Borehole 1-Sherwood Sandstone-Bentley Authority: Environment Agency, North East Region Abstraction: Industrial; Commercial And Public Services: Laundry Use Abstraction Type: Water may be abstracted from a single point Source: Groundwater Daily Rate (m3): Not Supplied Yearly Rate (m3): Not Supplied Details: Bentley Laundry, Bentley Road, Doncaster, South Yorkshire Authorised Start: 01 January Authorised End: 31 December Permit Start Date: 11th March 2004 Permit End Date: Not Supplied Positional Accuracy: Located by supplier to within 10m Order Number: 242475436_1_1 Date: 12-May-2020 rpr_ec_datasheet v53.0 A Landmark Information Group Service Page 24 of 104 Agency & Hydrological Quadrant Estimated Map Reference Details Distance Contact NGR ID (Compass Direction) From Site Water Abstractions Operator: Parklands Sports & Social Club (Doncaster) Ltd A20NW 1545 2 458840 Licence Number: 2/27/09/183 (NE) 405230 Permit Version: 1 Location: Borehole - Sherwood Sandstone - Doncaster Authority: Environment Agency, North East Region Abstraction: Sports Grounds/Facilities: Make-Up Or Top Up Water Abstraction Type: Water may be abstracted from a single point Source: Groundwater Daily Rate (m3): Not Supplied Yearly Rate (m3): Not Supplied Details: Rear Of Bowls Club Sports & Social Club (Doncaster) Limited, Wheatley Hall Road, Doncaster Authorised Start: 01 May Authorised End: 30 September Permit Start Date: 26th September 2001 Permit End Date: Not Supplied Positional Accuracy: Located by supplier to within 10m Water Abstractions Operator: Parklands Sports & Social Club (Doncaster) Ltd A20NW 1545 2 458840 Licence Number: 2/27/09/183 (NE) 405230 Permit Version: 1 Location: Borehole - Sherwood Sandstone - Doncaster Authority: Environment Agency, North East Region Abstraction: Sports Grounds/Facilities: Spray Irrigation - Direct Abstraction Type: Water may be abstracted from a single point Source: Groundwater Daily Rate (m3): Not Supplied Yearly Rate (m3): Not Supplied Details: Rear Of Bowls Club Sports & Social Club (Doncaster) Limited, Wheatley Hall Road, Doncaster Authorised Start: 01 May Authorised End: 30 September Permit Start Date: 26th September 2001 Permit End Date: Not Supplied Positional Accuracy: Located by supplier to within 10m Water Abstractions Operator: Abbey Glen Ltd A21SE 1576 2 456516 Licence Number: 2/27/09/191/R01 (NW) 405316 Permit Version: 3 Location: Borehole 2 - Sherwood Sandstone - Doncaster Authority: Environment Agency, North East Region Abstraction: Industrial; Commercial And Public Services: Laundry Use Abstraction Type: Water may be abstracted from a single point Source: Groundwater Daily Rate (m3): Not Supplied Yearly Rate (m3): Not Supplied Details: Not Supplied Authorised Start: 01 April Authorised End: 31 March Permit Start Date: 1st April 2017 Permit End Date: Not Supplied Positional Accuracy: Located by supplier to within 10m Water Abstractions Operator: Abbey Glen Ltd A21SE 1576 2 456510 Licence Number: 2/27/09/191 (NW) 405310 Permit Version: 2 Location: Borehole 2 - Sherwood Sandstone - Doncaster Authority: Environment Agency, North East Region Abstraction: Industrial; Commercial And Public Services: Laundry Use Abstraction Type: Water may be abstracted from a single point Source: Groundwater Daily Rate (m3): Not Supplied Yearly Rate (m3): Not Supplied Details: Not Supplied Authorised Start: 01 January Authorised End: 31 December Permit Start Date: 9th October 2006 Permit End Date: Not Supplied Positional Accuracy: Located by supplier to within 10m Order Number: 242475436_1_1 Date: 12-May-2020 rpr_ec_datasheet v53.0 A Landmark Information Group Service Page 25 of 104 Agency & Hydrological Quadrant Estimated Map Reference Details Distance Contact NGR ID (Compass Direction) From Site Water Abstractions Operator: Bentley Textile Services Ltd A21SE 1576 2 456510 Licence Number: 2/27/09/191 (NW) 405310 Permit Version: 1 Location: Borehole 2-Sherwood Sandstone-Doncaster Authority: Environment Agency, North East Region Abstraction: Industrial; Commercial And Public Services: Laundry Use Abstraction Type: Water may be abstracted from a single point Source: Groundwater Daily Rate (m3): Not Supplied Yearly Rate (m3): Not Supplied Details: Bentley Laundry, Bentley Road, Doncaster, South Yorkshire Authorised Start: 01 January Authorised End: 31 December Permit Start Date: 11th March 2004 Permit End Date: Not Supplied Positional Accuracy: Located by supplier to within 10m Water Abstractions Operator: Bentley Textile Services Limited A21SE 1577 2 456500 Licence Number: 2/27/09/150 (NW) 405300 Permit Version: 101 Location: Borehole 1 - Sherwood Sandstone - Pickfords Doncaster Authority: Environment Agency, North East Region Abstraction: Industrial; Commercial And Public Services: Laundry Use Abstraction Type: Water may be abstracted from a single point Source: Groundwater Daily Rate (m3): Not Supplied Yearly Rate (m3): Not Supplied Details: Old Pickfords Building, Bentley Road, Doncaster, South Yorkshire Authorised Start: 01 January Authorised End: 31 December Permit Start Date: 29th January 2002 Permit End Date: Not Supplied Positional Accuracy: Located by supplier to within 100m Water Abstractions Operator: Bentley Laundry Limited A21SE 1577 2 456500 Licence Number: 2/27/09/150 (NW) 405300 Permit Version: 100 Location: Borehole Authority: Environment Agency, North East Region Abstraction: Industrial; Commercial And Public Services: Laundry Use Abstraction Type: Water may be abstracted from a single point Source: Groundwater Daily Rate (m3): 184 Yearly Rate (m3): 53000 Details: Old Pickfords Building, Bentley Road, Doncaster, South Yorkshire Authorised Start: 01 January Authorised End: 31 December Permit Start Date: 14th July 1994 Permit End Date: Not Supplied Positional Accuracy: Located by supplier to within 100m Water Abstractions Operator: Bentley Laundry Limited A21SE 1577 2 456500 Licence Number: 2/27/09/150 (NW) 405300 Permit Version: 100 Location: Borehole 1 - Sherwood Sandstone - Pickfords Doncaster Authority: Environment Agency, North East Region Abstraction: Industrial; Commercial And Public Services: Laundry Use Abstraction Type: Water may be abstracted from a single point Source: Groundwater Daily Rate (m3): Not Supplied Yearly Rate (m3): Not Supplied Details: Old Pickfords Building, Bentley Road, Doncaster, South Yorkshire Authorised Start: 01 January Authorised End: 31 December Permit Start Date: 14th July 1994 Permit End Date: Not Supplied Positional Accuracy: Located by supplier to within 10m Order Number: 242475436_1_1 Date: 12-May-2020 rpr_ec_datasheet v53.0 A Landmark Information Group Service Page 26 of 104 Agency & Hydrological Quadrant Estimated Map Reference Details Distance Contact NGR ID (Compass Direction) From Site Water Abstractions Operator: British Coal A22NE 1609 2 457300 Licence Number: 2/27/09/009 (N) 405800 Permit Version: Not Supplied Location: Location Description Not Available Authority: Environment Agency, North East Region Abstraction: Cooling/Gen Ind. Abstraction Type: Not Supplied Source: Surface Daily Rate (m3): 1637 Yearly Rate (m3): 45460 Details: Licence Revoked Authorised Start: Not Supplied Authorised End: Not Supplied Permit Start Date: Not Supplied Permit End Date: Not Supplied Positional Accuracy: Located by supplier to within 100m Water Abstractions Operator: Bentley Textile Services Limited A21SE 1646 2 456500 Licence Number: 2/27/09/150 (NW) 405400 Permit Version: 101 Location: Borehole 2 - Sherwood Sandstone - Doncaster Authority: Environment Agency, North East Region Abstraction: Industrial; Commercial And Public Services: Laundry Use Abstraction Type: Water may be abstracted from a single point Source: Groundwater Daily Rate (m3): Not Supplied Yearly Rate (m3): Not Supplied Details: Old Pickfords Building, Bentley Road, Doncaster, South Yorkshire Authorised Start: 01 January Authorised End: 31 December Permit Start Date: 29th January 2002 Permit End Date: Not Supplied Positional Accuracy: Located by supplier to within 100m Water Abstractions Operator: Bentley Laundry Limited A21SE 1646 2 456500 Licence Number: 2/27/09/150 (NW) 405400 Permit Version: 100 Location: Borehole 2 - Sherwood Sandstone - Doncaster Authority: Environment Agency, North East Region Abstraction: Industrial; Commercial And Public Services: Laundry Use Abstraction Type: Water may be abstracted from a single point Source: Groundwater Daily Rate (m3): Not Supplied Yearly Rate (m3): Not Supplied Details: Old Pickfords Building, Bentley Road, Doncaster, South Yorkshire Authorised Start: 01 January Authorised End: 31 December Permit Start Date: 14th July 1994 Permit End Date: Not Supplied Positional Accuracy: Located by supplier to within 10m Water Abstractions Operator: Doncaster & Bassetlaw Hospitals Nhs Trust A15NE 1660 2 459320 Licence Number: 03/28/83/0248/1 (E) 404240 Permit Version: 2 Location: Doncaster Royal Infirmary - Borehole Authority: Environment Agency, Midlands Region Abstraction: Hospitals: General Use (Medium Loss) Abstraction Type: Water may be abstracted from a single point Source: Groundwater Daily Rate (m3): Not Supplied Yearly Rate (m3): Not Supplied Details: Doncaster Royal Infirmary Authorised Start: 01 April Authorised End: 31 March Permit Start Date: 1st April 2008 Permit End Date: Not Supplied Positional Accuracy: Located by supplier to within 10m Order Number: 242475436_1_1 Date: 12-May-2020 rpr_ec_datasheet v53.0 A Landmark Information Group Service Page 27 of 104 Agency & Hydrological Quadrant Estimated Map Reference Details Distance Contact NGR ID (Compass Direction) From Site Water Abstractions Operator: Doncaster Royal Infirmary & Montague Hospital Nhs Trust A15NE 1660 2 459320 Licence Number: 03/28/83/0248/1 (E) 404240 Permit Version: 1 Location: Doncaster Royal Infirmary - Borehole Authority: Environment Agency, Midlands Region Abstraction: Hospitals: General Use (Medium Loss) Abstraction Type: Water may be abstracted from a single point Source: Groundwater Daily Rate (m3): Not Supplied Yearly Rate (m3): Not Supplied Details: Doncaster Royal Infirmary Authorised Start: 01 April Authorised End: 31 March Permit Start Date: 1st April 2003 Permit End Date: Not Supplied Positional Accuracy: Located by supplier to within 10m Water Abstractions Operator: Doncaster Royal Infirmary & Montague Hospital Nhs Trust A15NE 1660 2 459320 Licence Number: 03/28/83/0248 (E) 404240 Permit Version: 1 Location: Doncaster Royal Infirmary - Borehole Authority: Environment Agency, Midlands Region Abstraction: Hospitals: General Use (Medium Loss) Abstraction Type: Water may be abstracted from a single point Source: Groundwater Daily Rate (m3): Not Supplied Yearly Rate (m3): Not Supplied Details: Doncaster Royal Infirmary Authorised Start: 01 April Authorised End: 31 March Permit Start Date: 1st November 1999 Permit End Date: Not Supplied Positional Accuracy: Located by supplier to within 10m Water Abstractions Operator: Doncaster & Bassetlaw Hospitals Nhs Foundation Trust A15NE 1677 2 459335 Licence Number: 03/28/83/0271/R01 (E) 404314 Permit Version: 1 Location: Doncaster Royal Infirmary - Sherwood Sandtone Borehole Authority: Environment Agency, Midlands Region Abstraction: Hospitals: Drinking; Cooking; Sanitary; Washing; (Small Garden) Abstraction Type: Water may be abstracted from a single point Source: Groundwater Daily Rate (m3): Not Supplied Yearly Rate (m3): Not Supplied Details: Doncaster Royal Infirmary Authorised Start: 01 April Authorised End: 31 March Permit Start Date: 1st April 2014 Permit End Date: Not Supplied Positional Accuracy: Located by supplier to within 10m Water Abstractions Operator: Doncaster & Bassetlaw Hospitals Nhs Foundation Trust A15NE 1677 2 459335 Licence Number: 03/28/83/0271 (E) 404314 Permit Version: 1 Location: Doncaster Royal Infirmary - Sherwood Sandtone Borehole Authority: Environment Agency, Midlands Region Abstraction: Hospitals: Drinking; Cooking; Sanitary; Washing; (Small Garden) Abstraction Type: Water may be abstracted from a single point Source: Groundwater Daily Rate (m3): Not Supplied Yearly Rate (m3): Not Supplied Details: Doncaster Royal Infirmary Authorised Start: 01 April Authorised End: 31 March Permit Start Date: 22nd July 2004 Permit End Date: Not Supplied Positional Accuracy: Located by supplier to within 10m Order Number: 242475436_1_1 Date: 12-May-2020 rpr_ec_datasheet v53.0 A Landmark Information Group Service Page 28 of 104 Agency & Hydrological Quadrant Estimated Map Reference Details Distance Contact NGR ID (Compass Direction) From Site Water Abstractions Operator: Doncaster Royal Infirmary & Montague A15NE 1682 2 459340 Licence Number: 03/28/83/0223 (E) 404315 Permit Version: Not Supplied Location: Doncaster Royal Infirmary Authority: Environment Agency, Midlands Region Abstraction: Industrial Processing ( Miscellaneous) Abstraction Type: Not Supplied Source: Borehole Daily Rate (m3): 650 Yearly Rate (m3): 200000 Details: Not Supplied Authorised Start: Not Supplied Authorised End: Not Supplied Permit Start Date: Not Supplied Permit End Date: Not Supplied Positional Accuracy: Located by supplier to within 100m Water Abstractions Operator: Doncaster Royal Infirmary & Montague A15NE 1683 2 459340 Licence Number: 03/28/83/0222 (E) 404320 Permit Version: Not Supplied Location: Doncaster Royal Infirmary Authority: Environment Agency, Midlands Region Abstraction: Industrial Processing ( Miscellaneous) Abstraction Type: Not Supplied Source: Borehole Daily Rate (m3): 650 Yearly Rate (m3): 50000 Details: Not Supplied Authorised Start: Not Supplied Authorised End: Not Supplied Permit Start Date: Not Supplied Permit End Date: Not Supplied Positional Accuracy: Located by supplier to within 100m Water Abstractions Operator: Doncaster Royal Infirmary & Montague A15NE 1687 2 459345 Licence Number: 03/28/83/0225 /1 (E) 404315 Permit Version: Not Supplied Location: Doncaster Royal Infirmary Authority: Environment Agency, Midlands Region Abstraction: Industrial Processing ( Miscellaneous) Abstraction Type: Not Supplied Source: Groundwater Daily Rate (m3): 650 Yearly Rate (m3): 150000 Details: ]Text]; Status: Revoked; Lapsed Or Cancelled Authorised Start: Not Supplied Authorised End: Not Supplied Permit Start Date: Not Supplied Permit End Date: Not Supplied Positional Accuracy: Located by supplier to within 100m Water Abstractions Operator: Doncaster Royal Infirmary & Montague A15NE 1688 2 459345 Licence Number: 03/28/83/0231 /1 (E) 404320 Permit Version: Not Supplied Location: Doncaster Royal Infirmary Authority: Environment Agency, Midlands Region Abstraction: Industrial Processing ( Miscellaneous) Abstraction Type: Not Supplied Source: Groundwater Daily Rate (m3): 650 Yearly Rate (m3): 100000 Details: ]Text]; Status: Revoked; Lapsed Or Cancelled Authorised Start: Not Supplied Authorised End: Not Supplied Permit Start Date: Not Supplied Permit End Date: Not Supplied Positional Accuracy: Located by supplier to within 100m Order Number: 242475436_1_1 Date: 12-May-2020 rpr_ec_datasheet v53.0 A Landmark Information Group Service Page 29 of 104 Agency & Hydrological Quadrant Estimated Map Reference Details Distance Contact NGR ID (Compass Direction) From Site Water Abstractions Operator: Doncaster Royal Infirmary & Montague A15NE 1688 2 459345 Licence Number: 03/28/83/0238 /1 (E) 404325 Permit Version: Not Supplied Location: Doncaster Royal Infirmary, DONCASTER Authority: Environment Agency, Midlands Region Abstraction: Industrial Processing ( Miscellaneous) Abstraction Type: Not Supplied Source: Groundwater Daily Rate (m3): 650 Yearly Rate (m3): 100000 Details: ]Text]; Status: Revoked; Lapsed Or Cancelled Authorised Start: Not Supplied Authorised End: Not Supplied Permit Start Date: Not Supplied Permit End Date: Not Supplied Positional Accuracy: Unknown Water Abstractions Operator: Co-Operative Retail Services Limited (W) 1762 2 455900 Licence Number: 2/27/09/046 404300 Permit Version: Not Supplied Location: Location Description Not Available Authority: Environment Agency, North East Region Abstraction: General Industrial Abstraction Type: Not Supplied Source: Groundwater Daily Rate (m3): 7 Yearly Rate (m3): 2273 Details: Magnesian Limestones Licence Revoked Authorised Start: Not Supplied Authorised End: Not Supplied Permit Start Date: Not Supplied Permit End Date: Not Supplied Positional Accuracy: Located by supplier to within 100m Water Abstractions Operator: Apple Contractors(Northern)Ltd A5SW 1879 2 458800 Licence Number: 03/28/83/0151 /1 (SE) 402740 Permit Version: Not Supplied Location: DONCASTER Authority: Environment Agency, Midlands Region Abstraction: Private Water Undertaking Abstraction Type: Not Supplied Source: Groundwater Daily Rate (m3): 5 Yearly Rate (m3): 1590 Details: Hatfield Sandstones Authorised Start: Not Supplied Authorised End: Not Supplied Permit Start Date: Not Supplied Permit End Date: Not Supplied Positional Accuracy: Unknown Water Abstractions Operator: Eagle Star Assurance Co Ltd (E) 1958 2 459500 Licence Number: 2/27/09/033 404900 Permit Version: 101 Location: Borehole No1 - Sherwood Sandstone - Doncaster Authority: Environment Agency, North East Region Abstraction: Textiles & Leather: Boiler Feed Abstraction Type: Water may be abstracted from a single point Source: Groundwater Daily Rate (m3): Not Supplied Yearly Rate (m3): Not Supplied Details: Wheatley Hall Rd & Exeter Rd, Doncaster Authorised Start: 01 January Authorised End: 31 December Permit Start Date: 30th June 1999 Permit End Date: Not Supplied Positional Accuracy: Located by supplier to within 10m Order Number: 242475436_1_1 Date: 12-May-2020 rpr_ec_datasheet v53.0 A Landmark Information Group Service Page 30 of 104 Agency & Hydrological Quadrant Estimated Map Reference Details Distance Contact NGR ID (Compass Direction) From Site Water Abstractions Operator: Eagle Star Assurance Co Ltd (E) 1958 2 459500 Licence Number: 2/27/09/033 404900 Permit Version: 101 Location: Borehole No1 - Sherwood Sandstone - Doncaster Authority: Environment Agency, North East Region Abstraction: Textiles & Leather: General Cooling (Existing Licences Only) (Low Loss) Abstraction Type: Water may be abstracted from a single point Source: Groundwater Daily Rate (m3): Not Supplied Yearly Rate (m3): Not Supplied Details: Wheatley Hall Rd & Exeter Rd, Doncaster Authorised Start: 01 January Authorised End: 31 December Permit Start Date: 30th June 1999 Permit End Date: Not Supplied Positional Accuracy: Located by supplier to within 10m Water Abstractions Operator: Eagle Star Assurance Co Ltd (E) 1958 2 459500 Licence Number: 2/27/09/033 404900 Permit Version: 101 Location: Borehole No1 - Sherwood Sandstone - Doncaster Authority: Environment Agency, North East Region Abstraction: Textiles & Leather: General Use (High Loss) Abstraction Type: Water may be abstracted from a single point Source: Groundwater Daily Rate (m3): Not Supplied Yearly Rate (m3): Not Supplied Details: I.C.I. Fibres Ltd., Wheatley Lane, Doncaster Authorised Start: 01 January Authorised End: 31 December Permit Start Date: 30th June 1999 Permit End Date: Not Supplied Positional Accuracy: Located by supplier to within 10m Water Abstractions Operator: Du Pont (Uk) Ltd (E) 1958 2 459500 Licence Number: 2/27/09/033 404900 Permit Version: 100 Location: Borehole No1 - Sherwood Sandstone - Doncaster Authority: Environment Agency, North East Region Abstraction: Textiles & Leather: Boiler Feed Abstraction Type: Water may be abstracted from a single point Source: Groundwater Daily Rate (m3): Not Supplied Yearly Rate (m3): Not Supplied Details: I.C.I. Fibres Ltd., Wheatley Lane, Doncaster Authorised Start: 01 January Authorised End: 31 December Permit Start Date: 1st July 1993 Permit End Date: Not Supplied Positional Accuracy: Located by supplier to within 10m Water Abstractions Operator: Du Pont (Uk) Ltd (E) 1958 2 459500 Licence Number: 2/27/09/033 404900 Permit Version: 100 Location: Borehole No1 - Sherwood Sandstone - Doncaster Authority: Environment Agency, North East Region Abstraction: Textiles & Leather: General Cooling (Existing Licences Only) (Low Loss) Abstraction Type: Water may be abstracted from a single point Source: Groundwater Daily Rate (m3): Not Supplied Yearly Rate (m3): Not Supplied Details: I.C.I. Fibres Ltd., Wheatley Lane, Doncaster Authorised Start: 01 January Authorised End: 31 December Permit Start Date: 1st July 1993 Permit End Date: Not Supplied Positional Accuracy: Located by supplier to within 10m Order Number: 242475436_1_1 Date: 12-May-2020 rpr_ec_datasheet v53.0 A Landmark Information Group Service Page 31 of 104 Agency & Hydrological Quadrant Estimated Map Reference Details Distance Contact NGR ID (Compass Direction) From Site Water Abstractions Operator: Du Pont (Uk) Ltd (E) 1958 2 459500 Licence Number: 2/27/09/033 404900 Permit Version: 100 Location: Borehole No1 - Sherwood Sandstone - Doncaster Authority: Environment Agency, North East Region Abstraction: Textiles & Leather: General Use (High Loss) Abstraction Type: Water may be abstracted from a single point Source: Groundwater Daily Rate (m3): Not Supplied Yearly Rate (m3): Not Supplied Details: I.C.I. Fibres Ltd., Wheatley Lane, Doncaster Authorised Start: 01 January Authorised End: 31 December Permit Start Date: 1st July 1993 Permit End Date: Not Supplied Positional Accuracy: Located by supplier to within 10m Groundwater Vulnerability Map Combined Secondary Superficial Aquifer - High Vulnerability A13NE 0 4 457660 Classification: (NE) 404233 Combined High Vulnerability: Combined Aquifer: Productive Bedrock Aquifer, Productive Superficial Aquifer Pollutant Speed: High Bedrock Flow: Mixed Dilution: <300 mm/year Baseflow Index: >70% Superficial >90% Patchiness: Superficial 3-10m Thickness: Superficial High Recharge: Groundwater Vulnerability - Soluble Rock Risk None Bedrock Aquifer Designations Aquifer Designation: Principal Aquifer A13NE 0 4 457660 (NE) 404233 Superficial Aquifer Designations Aquifer Designation: Secondary Aquifer - A A13NE 0 4 457660 (NE) 404233 Source Protection Zones 69 Name: Not Supplied A13NE 0 2 457660 Source: Environment Agency, Head Office (NE) 404233 Reference: Not Supplied Type: Zone III (Total Catchment): The total area needed to support the discharge from the protected groundwater source. Extreme Flooding from Rivers or Sea without Defences Type: Extent of Extreme Flooding from Rivers or Sea without Defences A13NE 0 2 457660 Flood Plain Type: Fluvial Models (NE) 404233 Boundary Accuracy: As Supplied Extreme Flooding from Rivers or Sea without Defences Type: Extent of Extreme Flooding from Rivers or Sea without Defences A13NW 28 2 457638 Flood Plain Type: Fluvial Models and Fluvial Events (NW) 404249 Boundary Accuracy: As Supplied Extreme Flooding from Rivers or Sea without Defences Type: Extent of Extreme Flooding from Rivers or Sea without Defences A13NW 83 2 457620 Flood Plain Type: Fluvial Models (NW) 404305 Boundary Accuracy: As Supplied Extreme Flooding from Rivers or Sea without Defences Type: Extent of Extreme Flooding from Rivers or Sea without Defences A13NW 94 2 457580 Flood Plain Type: Fluvial Models (NW) 404280 Boundary Accuracy: As Supplied Extreme Flooding from Rivers or Sea without Defences Type: Extent of Extreme Flooding from Rivers or Sea without Defences A13NW 96 2 457581 Flood Plain Type: Fluvial Events (NW) 404285 Boundary Accuracy: As Supplied Extreme Flooding from Rivers or Sea without Defences Type: Extent of Extreme Flooding from Rivers or Sea without Defences A13NW 97 2 457650 Flood Plain Type: Fluvial Events (N) 404329 Boundary Accuracy: As Supplied Order Number: 242475436_1_1 Date: 12-May-2020 rpr_ec_datasheet v53.0 A Landmark Information Group Service Page 32 of 104 Agency & Hydrological Quadrant Estimated Map Reference Details Distance Contact NGR ID (Compass Direction) From Site Extreme Flooding from Rivers or Sea without Defences Type: Extent of Extreme Flooding from Rivers or Sea without Defences A13NW 108 2 457660 Flood Plain Type: Fluvial Models and Fluvial Events (N) 404340 Boundary Accuracy: As Supplied Extreme Flooding from Rivers or Sea without Defences Type: Extent of Extreme Flooding from Rivers or Sea without Defences A13NW 112 2 457588 Flood Plain Type: Fluvial Events (NW) 404317 Boundary Accuracy: As Supplied Extreme Flooding from Rivers or Sea without Defences Type: Extent of Extreme Flooding from Rivers or Sea without Defences A13NE 113 2 457663 Flood Plain Type: Fluvial Models and Fluvial Events (N) 404345 Boundary Accuracy: As Supplied Extreme Flooding from Rivers or Sea without Defences Type: Extent of Extreme Flooding from Rivers or Sea without Defences A13NW 116 2 457548 Flood Plain Type: Fluvial Events (W) 404260 Boundary Accuracy: As Supplied Extreme Flooding from Rivers or Sea without Defences Type: Extent of Extreme Flooding from Rivers or Sea without Defences A13NW 118 2 457545 Flood Plain Type: Fluvial Models (W) 404255 Boundary Accuracy: As Supplied Extreme Flooding from Rivers or Sea without Defences Type: Extent of Extreme Flooding from Rivers or Sea without Defences A13NW 125 2 457537 Flood Plain Type: Fluvial Events (W) 404255 Boundary Accuracy: As Supplied Extreme Flooding from Rivers or Sea without Defences Type: Extent of Extreme Flooding from Rivers or Sea without Defences A13NW 127 2 457535 Flood Plain Type: Fluvial Models (W) 404250 Boundary Accuracy: As Supplied Extreme Flooding from Rivers or Sea without Defences Type: Extent of Extreme Flooding from Rivers or Sea without Defences A13NW 152 2 457509 Flood Plain Type: Fluvial Events (W) 404240 Boundary Accuracy: As Supplied Flooding from Rivers or Sea without Defences Type: Extent of Flooding from Rivers or Sea without Defences A13NE 0 2 457660 Flood Plain Type: Fluvial Models (NE) 404233 Boundary Accuracy: As Supplied Areas Benefiting from Flood Defences Type: Area Benefiting from Flood Defences A13NE 0 2 457660 Boundary Accuracy: As Supplied (NE) 404233 Areas Benefiting from Flood Defences Type: Area Benefiting from Flood Defences A13NW 220 2 457471 Boundary Accuracy: As Supplied (NW) 404344 Flood Water Storage Areas None Flood Defences Type: Flood Defences A13NW 92 2 457604 Reference: Not Supplied (NW) 404305 Flood Defences Type: Flood Defences A13NW 144 2 457567 Reference: Not Supplied (NW) 404342 OS Water Network Lines 70 Watercourse Form: Canal A13NW 44 5 457628 Watercourse Length: 552.9 (NW) 404261 Watercourse Level: On ground surface Permanent: True Watercourse Name: Sheffield and South Yorkshire Navigation Catchment Name: Don and Rother Primacy: 2 OS Water Network Lines 71 Watercourse Form: Inland river A13SE 95 5 457755 Watercourse Length: 241.2 (E) 404230 Watercourse Level: On ground surface Permanent: True Watercourse Name: Not Supplied Catchment Name: Trent Primacy: 2 Order Number: 242475436_1_1 Date: 12-May-2020 rpr_ec_datasheet v53.0 A Landmark Information Group Service Page 33 of 104 Agency & Hydrological Quadrant Estimated Map Reference Details Distance Contact NGR ID (Compass Direction) From Site OS Water Network Lines 72 Watercourse Form: Inland river A13NW 113 5 457589 Watercourse Length: 1346.8 (NW) 404319 Watercourse Level: On ground surface Permanent: True Watercourse Name: River Don Catchment Name: Don and Rother Primacy: 1 OS Water Network Lines 73 Watercourse Form: Inland river A13SE 213 5 457668 Watercourse Length: 89.2 (S) 404021 Watercourse Level: On ground surface Permanent: True Watercourse Name: Not Supplied Catchment Name: Trent Primacy: 2 OS Water Network Lines 74 Watercourse Form: Inland river A13SW 261 5 457555 Watercourse Length: 120.9 (SW) 403994 Watercourse Level: On ground surface Permanent: True Watercourse Name: Not Supplied Catchment Name: Trent Primacy: 2 OS Water Network Lines 75 Watercourse Form: Canal A13SW 263 5 457537 Watercourse Length: 249.6 (SW) 404001 Watercourse Level: On ground surface Permanent: True Watercourse Name: Sheffield and South Yorkshire Navigation Catchment Name: Don and Rother Primacy: 2 OS Water Network Lines 76 Watercourse Form: Canal A13NE 266 5 457790 Watercourse Length: 314.2 (NE) 404464 Watercourse Level: On ground surface Permanent: True Watercourse Name: Sheffield and South Yorkshire Navigation Catchment Name: Don and Rother Primacy: 2 OS Water Network Lines 77 Watercourse Form: Canal A13NE 266 5 457790 Watercourse Length: 216.5 (NE) 404464 Watercourse Level: On ground surface Permanent: True Watercourse Name: Not Supplied Catchment Name: Trent Primacy: 2 OS Water Network Lines 78 Watercourse Form: Inland river A13SW 289 5 457374 Watercourse Length: 17.5 (W) 404197 Watercourse Level: On ground surface Permanent: True Watercourse Name: River Don Catchment Name: Don and Rother Primacy: 1 OS Water Network Lines 79 Watercourse Form: Inland river A13NW 290 5 457632 Watercourse Length: 43.6 (N) 404520 Watercourse Level: On ground surface Permanent: True Watercourse Name: Not Supplied Catchment Name: Don and Rother Primacy: 2 OS Water Network Lines 80 Watercourse Form: Inland river A13SW 294 5 457628 Watercourse Length: 37.4 (S) 403941 Watercourse Level: On ground surface Permanent: True Watercourse Name: Not Supplied Catchment Name: Trent Primacy: 2 Order Number: 242475436_1_1 Date: 12-May-2020 rpr_ec_datasheet v53.0 A Landmark Information Group Service Page 34 of 104 Agency & Hydrological Quadrant Estimated Map Reference Details Distance Contact NGR ID (Compass Direction) From Site OS Water Network Lines 81 Watercourse Form: Inland river A13SW 306 5 457356 Watercourse Length: 770.2 (W) 404198 Watercourse Level: On ground surface Permanent: True Watercourse Name: River Don Catchment Name: Don and Rother Primacy: 1 OS Water Network Lines 82 Watercourse Form: Inland river A13NE 322 5 457944 Watercourse Length: 132.6 (NE) 404384 Watercourse Level: On ground surface Permanent: True Watercourse Name: Not Supplied Catchment Name: Trent Primacy: 2 OS Water Network Lines 83 Watercourse Form: Inland river A18SE 341 5 457666 Watercourse Length: 124.4 (N) 404573 Watercourse Level: On ground surface Permanent: True Watercourse Name: Not Supplied Catchment Name: Don and Rother Primacy: 2 OS Water Network Lines 84 Watercourse Form: Canal A13NE 386 5 457953 Watercourse Length: 273.4 (NE) 404483 Watercourse Level: On ground surface Permanent: True Watercourse Name: Not Supplied Catchment Name: Trent Primacy: 2 OS Water Network Lines 85 Watercourse Form: Inland river A18SE 452 5 457731 Watercourse Length: 12.2 (N) 404678 Watercourse Level: Underground Permanent: True Watercourse Name: Not Supplied Catchment Name: Don and Rother Primacy: 2 OS Water Network Lines 86 Watercourse Form: Inland river A18SE 463 5 457739 Watercourse Length: 255.0 (N) 404688 Watercourse Level: On ground surface Permanent: True Watercourse Name: Not Supplied Catchment Name: Don and Rother Primacy: 2 OS Water Network Lines 87 Watercourse Form: Canal A8NW 498 5 457445 Watercourse Length: 199.7 (SW) 403785 Watercourse Level: On ground surface Permanent: True Watercourse Name: Sheffield and South Yorkshire Navigation Catchment Name: Don and Rother Primacy: 2 OS Water Network Lines 88 Watercourse Form: Inland river A12NE 552 5 457116 Watercourse Length: 373.9 (W) 404322 Watercourse Level: On ground surface Permanent: True Watercourse Name: Not Supplied Catchment Name: Don and Rother Primacy: 2 OS Water Network Lines 89 Watercourse Form: Canal A18SE 579 5 457928 Watercourse Length: 448.0 (NE) 404745 Watercourse Level: On ground surface Permanent: True Watercourse Name: Sheffield and South Yorkshire Navigation Catchment Name: Don and Rother Primacy: 2 Order Number: 242475436_1_1 Date: 12-May-2020 rpr_ec_datasheet v53.0 A Landmark Information Group Service Page 35 of 104 Agency & Hydrological Quadrant Estimated Map Reference Details Distance Contact NGR ID (Compass Direction) From Site OS Water Network Lines 90 Watercourse Form: Canal A7NE 669 5 457296 Watercourse Length: 219.2 (SW) 403672 Watercourse Level: On ground surface Permanent: True Watercourse Name: Sheffield and South Yorkshire Navigation Catchment Name: Don and Rother Primacy: 2 OS Water Network Lines 91 Watercourse Form: Inland river A17SE 686 5 457152 Watercourse Length: 121.1 (NW) 404693 Watercourse Level: On ground surface Permanent: True Watercourse Name: Not Supplied Catchment Name: Don and Rother Primacy: 2 OS Water Network Lines 92 Watercourse Form: Inland river A18SE 705 5 457874 Watercourse Length: 109.0 (N) 404904 Watercourse Level: On ground surface Permanent: True Watercourse Name: Not Supplied Catchment Name: Don and Rother Primacy: 2 OS Water Network Lines 93 Watercourse Form: Inland river A17SE 756 5 457175 Watercourse Length: 18.9 (NW) 404812 Watercourse Level: On ground surface Permanent: True Watercourse Name: Not Supplied Catchment Name: Don and Rother Primacy: 2 OS Water Network Lines 94 Watercourse Form: Inland river A17SE 761 5 457229 Watercourse Length: 105.4 (NW) 404859 Watercourse Level: On ground surface Permanent: True Watercourse Name: Bentley Ings Drain Catchment Name: Don and Rother Primacy: 1 OS Water Network Lines 95 Watercourse Form: Inland river A17SE 765 5 457183 Watercourse Length: 2.5 (NW) 404829 Watercourse Level: On ground surface Permanent: True Watercourse Name: Not Supplied Catchment Name: Don and Rother Primacy: 2 OS Water Network Lines 96 Watercourse Form: Inland river A17SE 766 5 457181 Watercourse Length: 6.8 (NW) 404830 Watercourse Level: On ground surface Permanent: True Watercourse Name: Not Supplied Catchment Name: Don and Rother Primacy: 2 OS Water Network Lines 97 Watercourse Form: Inland river A17SE 772 5 457180 Watercourse Length: 11.0 (NW) 404836 Watercourse Level: On ground surface Permanent: True Watercourse Name: Not Supplied Catchment Name: Don and Rother Primacy: 2 OS Water Network Lines 98 Watercourse Form: Inland river A17SE 779 5 457182 Watercourse Length: 19.0 (NW) 404847 Watercourse Level: On ground surface Permanent: True Watercourse Name: Not Supplied Catchment Name: Don and Rother Primacy: 2 Order Number: 242475436_1_1 Date: 12-May-2020 rpr_ec_datasheet v53.0 A Landmark Information Group Service Page 36 of 104 Agency & Hydrological Quadrant Estimated Map Reference Details Distance Contact NGR ID (Compass Direction) From Site OS Water Network Lines 99 Watercourse Form: Inland river A17SE 792 5 457185 Watercourse Length: 9.6 (NW) 404865 Watercourse Level: On ground surface Permanent: True Watercourse Name: Bentley Ings Drain Catchment Name: Don and Rother Primacy: 1 OS Water Network Lines 100 Watercourse Form: Inland river A17SE 794 5 457176 Watercourse Length: 294.4 (NW) 404862 Watercourse Level: On ground surface Permanent: True Watercourse Name: Bentley Ings Drain Catchment Name: Don and Rother Primacy: 1 OS Water Network Lines 101 Watercourse Form: Inland river A17NE 803 5 457242 Watercourse Length: 290.0 (NW) 404918 Watercourse Level: On ground surface Permanent: True Watercourse Name: Bentley Ings Drain Catchment Name: Don and Rother Primacy: 1 OS Water Network Lines 102 Watercourse Form: Inland river A18NE 806 5 457946 Watercourse Length: 248.2 (N) 404986 Watercourse Level: On ground surface Permanent: True Watercourse Name: Not Supplied Catchment Name: Don and Rother Primacy: 2 OS Water Network Lines 103 Watercourse Form: Inland river A17SW 817 5 456966 Watercourse Length: 23.0 (NW) 404663 Watercourse Level: On ground surface Permanent: True Watercourse Name: Not Supplied Catchment Name: Don and Rother Primacy: 2 OS Water Network Lines 104 Watercourse Form: Inland river A17SE 823 5 457186 Watercourse Length: 148.7 (NW) 404905 Watercourse Level: On ground surface Permanent: True Watercourse Name: Not Supplied Catchment Name: Don and Rother Primacy: 2 OS Water Network Lines 105 Watercourse Form: Inland river A17SW 839 5 456950 Watercourse Length: 6.1 (NW) 404678 Watercourse Level: On ground surface Permanent: True Watercourse Name: Not Supplied Catchment Name: Don and Rother Primacy: 2 OS Water Network Lines 106 Watercourse Form: Lock or flight of locks A7NE 839 5 457090 Watercourse Length: 71.5 (SW) 403618 Watercourse Level: On ground surface Permanent: True Watercourse Name: Sheffield and South Yorkshire Navigation Catchment Name: Don and Rother Primacy: 2 OS Water Network Lines 107 Watercourse Form: Inland river A17SW 844 5 456945 Watercourse Length: 160.6 (NW) 404680 Watercourse Level: On ground surface Permanent: True Watercourse Name: Bentley Ings Drain Catchment Name: Don and Rother Primacy: 1 Order Number: 242475436_1_1 Date: 12-May-2020 rpr_ec_datasheet v53.0 A Landmark Information Group Service Page 37 of 104 Agency & Hydrological Quadrant Estimated Map Reference Details Distance Contact NGR ID (Compass Direction) From Site OS Water Network Lines 108 Watercourse Form: Inland river A17NE 852 5 457198 Watercourse Length: 12.9 (NW) 404948 Watercourse Level: On ground surface Permanent: True Watercourse Name: Not Supplied Catchment Name: Don and Rother Primacy: 2 OS Water Network Lines 109 Watercourse Form: Inland river A17NE 852 5 457248 Watercourse Length: 187.3 (NW) 404977 Watercourse Level: On ground surface Permanent: True Watercourse Name: Not Supplied Catchment Name: Don and Rother Primacy: 2 OS Water Network Lines 110 Watercourse Form: Inland river A17NE 861 5 457201 Watercourse Length: 210.4 (NW) 404961 Watercourse Level: On ground surface Permanent: True Watercourse Name: Not Supplied Catchment Name: Don and Rother Primacy: 2 OS Water Network Lines 111 Watercourse Form: Inland river A12NW 893 5 456799 Watercourse Length: 251.1 (W) 404466 Watercourse Level: On ground surface Permanent: True Watercourse Name: Bentley Ings Drain Catchment Name: Don and Rother Primacy: 1 OS Water Network Lines 112 Watercourse Form: Inland river A18NW 893 5 457465 Watercourse Length: 1.1 (N) 405104 Watercourse Level: On ground surface Permanent: True Watercourse Name: Not Supplied Catchment Name: Don and Rother Primacy: 1 OS Water Network Lines 113 Watercourse Form: Inland river A18NW 893 5 457465 Watercourse Length: 570.2 (N) 405104 Watercourse Level: On ground surface Permanent: True Watercourse Name: Bentley Ings Drain Catchment Name: Don and Rother Primacy: 1 OS Water Network Lines 114 Watercourse Form: Inland river A18NW 894 5 457464 Watercourse Length: 1.7 (N) 405105 Watercourse Level: On ground surface Permanent: True Watercourse Name: Not Supplied Catchment Name: Don and Rother Primacy: 1 OS Water Network Lines 115 Watercourse Form: Canal A7NE 908 5 457030 Watercourse Length: 128.2 (SW) 403580 Watercourse Level: On ground surface Permanent: True Watercourse Name: Sheffield and South Yorkshire Navigation Catchment Name: Don and Rother Primacy: 2 OS Water Network Lines 116 Watercourse Form: Inland river A18NW 916 5 457370 Watercourse Length: 69.4 (N) 405100 Watercourse Level: On ground surface Permanent: True Watercourse Name: Not Supplied Catchment Name: Don and Rother Primacy: 2 Order Number: 242475436_1_1 Date: 12-May-2020 rpr_ec_datasheet v53.0 A Landmark Information Group Service Page 38 of 104 Agency & Hydrological Quadrant Estimated Map Reference Details Distance Contact NGR ID (Compass Direction) From Site OS Water Network Lines 117 Watercourse Form: Inland river A18NW 918 5 457376 Watercourse Length: 65.9 (N) 405106 Watercourse Level: On ground surface Permanent: True Watercourse Name: Not Supplied Catchment Name: Don and Rother Primacy: 2 OS Water Network Lines 118 Watercourse Form: Lake A17NE 938 5 457295 Watercourse Length: 54.3 (NW) 405096 Watercourse Level: On ground surface Permanent: True Watercourse Name: Not Supplied Catchment Name: Don and Rother Primacy: 2 OS Water Network Lines 119 Watercourse Form: Inland river A19NW 950 5 458266 Watercourse Length: 34.1 (NE) 404964 Watercourse Level: On ground surface Permanent: True Watercourse Name: Not Supplied Catchment Name: Trent Primacy: 1 OS Water Network Lines 120 Watercourse Form: Inland river A19NW 950 5 458291 Watercourse Length: 39.7 (NE) 404943 Watercourse Level: On ground surface Permanent: True Watercourse Name: Not Supplied Catchment Name: Trent Primacy: 1 OS Water Network Lines 121 Watercourse Form: Inland river A19NW 951 5 458299 Watercourse Length: 226.6 (NE) 404937 Watercourse Level: Underground Permanent: True Watercourse Name: Not Supplied Catchment Name: Trent Primacy: 1 OS Water Network Lines 122 Watercourse Form: Inland river A12NW 962 5 456699 Watercourse Length: 179.9 (W) 404266 Watercourse Level: On ground surface Permanent: True Watercourse Name: Not Supplied Catchment Name: Don and Rother Primacy: 2 OS Water Network Lines 123 Watercourse Form: Inland river A19NW 969 5 458261 Watercourse Length: 3.9 (NE) 404992 Watercourse Level: Underground Permanent: True Watercourse Name: Not Supplied Catchment Name: Trent Primacy: 1 OS Water Network Lines 124 Watercourse Form: Inland river A19NW 970 5 458258 Watercourse Length: 33.4 (NE) 404995 Watercourse Level: On ground surface Permanent: True Watercourse Name: Not Supplied Catchment Name: Trent Primacy: 1 OS Water Network Lines 125 Watercourse Form: Canal A19NW 975 5 458235 Watercourse Length: 1263.1 (NE) 405019 Watercourse Level: On ground surface Permanent: True Watercourse Name: Sheffield and South Yorkshire Navigation Catchment Name: Don and Rother Primacy: 1 Order Number: 242475436_1_1 Date: 12-May-2020 rpr_ec_datasheet v53.0 A Landmark Information Group Service Page 39 of 104 Agency & Hydrological Quadrant Estimated Map Reference Details Distance Contact NGR ID (Compass Direction) From Site OS Water Network Lines 126 Watercourse Form: Inland river A12NW 976 5 456698 Watercourse Length: 311.8 (W) 404394 Watercourse Level: On ground surface Permanent: True Watercourse Name: Swaithe Dike Catchment Name: Don and Rother Primacy: 1 OS Water Network Lines 127 Watercourse Form: Inland river A12NW 976 5 456698 Watercourse Length: 1.9 (W) 404394 Watercourse Level: On ground surface Permanent: True Watercourse Name: Not Supplied Catchment Name: Don and Rother Primacy: 2 OS Water Network Lines 128 Watercourse Form: Inland river A17NE 977 5 457317 Watercourse Length: 4.0 (N) 405146 Watercourse Level: On ground surface Permanent: True Watercourse Name: Not Supplied Catchment Name: Don and Rother Primacy: 2 OS Water Network Lines 129 Watercourse Form: Inland river A12NW 977 5 456697 Watercourse Length: 23.2 (W) 404393 Watercourse Level: On ground surface Permanent: True Watercourse Name: Not Supplied Catchment Name: Don and Rother Primacy: 2 OS Water Network Lines 130 Watercourse Form: Inland river A17NE 980 5 457317 Watercourse Length: 2.3 (N) 405150 Watercourse Level: On ground surface Permanent: True Watercourse Name: Not Supplied Catchment Name: Don and Rother Primacy: 2 OS Water Network Lines 131 Watercourse Form: Inland river A18NW 980 5 457326 Watercourse Length: 9.0 (N) 405154 Watercourse Level: On ground surface Permanent: True Watercourse Name: Fowler Bridge Drain Catchment Name: Don and Rother Primacy: 2 OS Water Network Lines 132 Watercourse Form: Inland river A18NW 980 5 457334 Watercourse Length: 8.3 (N) 405156 Watercourse Level: On ground surface Permanent: True Watercourse Name: Fowler Bridge Drain Catchment Name: Don and Rother Primacy: 2 OS Water Network Lines 133 Watercourse Form: Inland river A18NW 980 5 457334 Watercourse Length: 549.9 (N) 405156 Watercourse Level: On ground surface Permanent: True Watercourse Name: Fowler Bridge Drain Catchment Name: Don and Rother Primacy: 2 OS Water Network Lines 134 Watercourse Form: Inland river A17NE 982 5 457317 Watercourse Length: 34.4 (N) 405152 Watercourse Level: On ground surface Permanent: True Watercourse Name: Fowler Bridge Drain Catchment Name: Don and Rother Primacy: 2 Order Number: 242475436_1_1 Date: 12-May-2020 rpr_ec_datasheet v53.0 A Landmark Information Group Service Page 40 of 104 Agency & Hydrological Quadrant Estimated Map Reference Details Distance Contact NGR ID (Compass Direction) From Site OS Water Network Lines 135 Watercourse Form: Inland river A19SE 985 5 458467 Watercourse Length: 62.8 (NE) 404797 Watercourse Level: On ground surface Permanent: True Watercourse Name: Not Supplied Catchment Name: Trent Primacy: 1 OS Water Network Lines 136 Watercourse Form: Inland river A12SW 993 5 456715 Watercourse Length: 19.3 (W) 403929 Watercourse Level: On ground surface Permanent: True Watercourse Name: Not Supplied Catchment Name: Don and Rother Primacy: 2 Order Number: 242475436_1_1 Date: 12-May-2020 rpr_ec_datasheet v53.0 A Landmark Information Group Service Page 41 of 104 Waste Quadrant Estimated Map Reference Details Distance Contact NGR ID (Compass Direction) From Site Historical Landfill Sites 137 Licence Holder: Cutts Brothers A13NE 0 2 457660 Location: Wharf Road, Milethorn Lane, Doncaster, South Yorkshire (NE) 404233 Name: Gas House Bight Operator Location: Not Supplied Boundary Accuracy: As Supplied Provider Reference: EAHLD04485 First Input Date: Not Supplied Last Input Date: Not Supplied Specified Waste Deposited Waste included Industrial, Commercial, Household and Special Type: Waste, and Liquid Sludge EA Waste Ref: 0 Regis Ref: Not Supplied WRC Ref: 4400/0382 BGS Ref: Not Supplied Other Ref: 4400/(88)D, WD20 D13, WD20/R664 Historical Landfill Sites 138 Licence Holder: British Railways Board A13NW 47 2 457620 Location: Marshgate Depot, Friargate, Doncaster (NW) 404257 Name: Land to the rear of Railway Engineers Department Operator Location: Not Supplied Boundary Accuracy: As Supplied Provider Reference: EAHLD04484 First Input Date: Not Supplied Last Input Date: Not Supplied Specified Waste Deposited Waste included Industrial and Commercial Waste Type: EA Waste Ref: 0 Regis Ref: Not Supplied WRC Ref: Not Supplied BGS Ref: Not Supplied Other Ref: WD20 D445, 4400/D445, 20D445 Historical Landfill Sites 139 Licence Holder: British Rail Board A7NE 839 2 457097 Location: PO Box 159, Hexthorpe, Doncaster (SW) 403611 Name: National Supply Centre Operator Location: Not Supplied Boundary Accuracy: As Supplied Provider Reference: EAHLD30225 First Input Date: Not Supplied Last Input Date: Not Supplied Specified Waste Deposited Waste included Special Waste Type: EA Waste Ref: 0 Regis Ref: Not Supplied WRC Ref: Not Supplied BGS Ref: Not Supplied Other Ref: WD20 D1038 Licensed Waste Management Facilities (Locations) 140 Licence Number: 100395 A13SE 39 2 457680 Location: Wharf Road Waste Transfer Station, Wharf Road, Wheatley, Doncaster, (SE) 404200 South Yorkshire, DN1 2ST Operator Name: Saica Natur U K Limited Operator Location: Not Supplied Authority: Environment Agency - North East Region, Yorkshire Area Site Category: Household, Commercial And Industrial Transfer Stations Licence Status: Surrendered Issued: 4th September 2008 Last Modified: Not Supplied Expires: Not Supplied Suspended: Not Supplied Revoked: Not Supplied Surrendered: 9th May 2018 IPPC Reference: Not Supplied Positional Accuracy: Located by supplier to within 10m Order Number: 242475436_1_1 Date: 12-May-2020 rpr_ec_datasheet v53.0 A Landmark Information Group Service Page 42 of 104 Waste Quadrant Estimated Map Reference Details Distance Contact NGR ID (Compass Direction) From Site Licensed Waste Management Facilities (Locations) 141 Licence Number: 65377 A13NE 79 2 457700 Location: Land/premises At, Wharf Road, Off Milethorn Lane, Doncaster, South (NE) 404300 Yorkshire, DN1 2ST Operator Name: C F Booth ( Doncaster ) Ltd Operator Location: Not Supplied Authority: Environment Agency - North East Region, Yorkshire Area Site Category: End of Life Vehicles Licence Status: Issued Issued: 14th February 2005 Last Modified: Not Supplied Expires: Not Supplied Suspended: Not Supplied Revoked: Not Supplied Surrendered: Not Supplied IPPC Reference: Not Supplied Positional Accuracy: Located by supplier to within 100m Licensed Waste Management Facilities (Locations) 142 Licence Number: 60816 A13SE 161 2 457750 Location: Holmes Depot, Whittington Street, Doncaster, South Yorkshire, DN1 2SG (SE) 404100 Operator Name: Doncaster Metropolitan Borough Council Operator Location: Not Supplied Authority: Environment Agency - North East Region, Yorkshire Area Site Category: Household, Commercial And Industrial Transfer Stations Licence Status: Issued Issued: 2nd September 1994 Last Modified: Not Supplied Expires: Not Supplied Suspended: Not Supplied Revoked: Not Supplied Surrendered: Not Supplied IPPC Reference: Not Supplied Positional Accuracy: Located by supplier to within 10m Licensed Waste Management Facilities (Locations) 143 Licence Number: 60810 A13SE 250 2 457750 Location: Church Way, Doncaster, South Yorkshire (S) 404000 Operator Name: British Gas Transco Ltd Operator Location: Not Supplied Authority: Environment Agency - North East Region, Yorkshire Area Site Category: Household, Commercial And Industrial Transfer Stations Licence Status: Surrendered Issued: 15th July 1993 Last Modified: Not Supplied Expires: Not Supplied Suspended: Not Supplied Revoked: Not Supplied Surrendered: 6th September 2000 IPPC Reference: Not Supplied Positional Accuracy: Located by supplier to within 10m Local Authority Landfill Coverage Name: Doncaster Metropolitan Borough Council 0 3 457660 - Has supplied landfill data 404233 Local Authority Recorded Landfill Sites 144 Location: Gas House Bight, Milethorne Lane A13NE 0 3 457660 Reference: 88 (NE) 404233 Authority: Doncaster Metropolitan Borough Council, Environmental Services Last Reported Unknown Status: Types of Waste: Not Supplied Date of Closure: Not Supplied Positional Accuracy: Positioned by the supplier Boundary Quality: Good Local Authority Recorded Landfill Sites 145 Location: Not Supplied A13NW 48 3 457620 Reference: 0 (NW) 404257 Authority: Doncaster Metropolitan Borough Council, Environmental Services Last Reported Not Supplied Status: Types of Waste: Not Supplied Date of Closure: Not Supplied Positional Accuracy: Positioned by the supplier Boundary Quality: Good Potentially Infilled Land (Non-Water) 146 Bearing Ref: SE A9NW 621 - 458181 Use: Unknown Filled Ground (Pit, quarry etc) (SE) 403895 Date of Mapping: 1992 Order Number: 242475436_1_1 Date: 12-May-2020 rpr_ec_datasheet v53.0 A Landmark Information Group Service Page 43 of 104 Waste Quadrant Estimated Map Reference Details Distance Contact NGR ID (Compass Direction) From Site Potentially Infilled Land (Non-Water) 147 Bearing Ref: S A8SE 918 - 457869 Use: Unknown Filled Ground (Pit, quarry etc) (S) 403339 Date of Mapping: 1992 Potentially Infilled Land (Water) 148 Use: Unknown Filled Ground (Pond, marsh, river, stream, dock etc) A13SW 15 - 457652 Date of Mapping: 1854 (SW) 404221 Potentially Infilled Land (Water) 149 Use: Unknown Filled Ground (Pond, marsh, river, stream, dock etc) A13SW 50 - 457633 Date of Mapping: 1956 (SW) 404191 Potentially Infilled Land (Water) 150 Use: Unknown Filled Ground (Pond, marsh, river, stream, dock etc) A13SE 205 - 457853 Date of Mapping: 1854 (E) 404163 Potentially Infilled Land (Water) 151 Use: Unknown Filled Ground (Pond, marsh, river, stream, dock etc) A13SW 238 - 457464 Date of Mapping: 1854 (SW) 404099 Potentially Infilled Land (Water) 152 Use: Unknown Filled Ground (Pond, marsh, river, stream, dock etc) A13SW 255 - 457443 Date of Mapping: 1907 (SW) 404100 Potentially Infilled Land (Water) 153 Use: Unknown Filled Ground (Pond, marsh, river, stream, dock etc) A13NE 256 - 457860 Date of Mapping: 1956 (NE) 404392 Potentially Infilled Land (Water) 154 Use: Unknown Filled Ground (Pond, marsh, river, stream, dock etc) A13NE 261 - 457804 Date of Mapping: 1956 (NE) 404450 Potentially Infilled Land (Water) 155 Use: Unknown Filled Ground (Pond, marsh, river, stream, dock etc) A13SE 283 - 457759 Date of Mapping: 1938 (S) 403968 Potentially Infilled Land (Water) 156 Use: Unknown Filled Ground (Pond, marsh, river, stream, dock etc) A13NE 291 - 457815 Date of Mapping: 1894 (NE) 404479 Potentially Infilled Land (Water) 157 Use: Unknown Filled Ground (Pond, marsh, river, stream, dock etc) A13SE 316 - 457892 Date of Mapping: 1854 (SE) 404019 Potentially Infilled Land (Water) 158 Use: Unknown Filled Ground (Pond, marsh, river, stream, dock etc) A13NE 331 - 457814 Date of Mapping: 1907 (NE) 404525 Potentially Infilled Land (Water) 159 Use: Unknown Filled Ground (Pond, marsh, river, stream, dock etc) A8NE 402 - 457752 Date of Mapping: 1956 (S) 403842 Potentially Infilled Land (Water) 160 Use: Unknown Filled Ground (Pond, marsh, river, stream, dock etc) A8NW 411 - 457529 Date of Mapping: 1907 (S) 403844 Potentially Infilled Land (Water) 161 Use: Unknown Filled Ground (Pond, marsh, river, stream, dock etc) A13SE 416 - 457909 Date of Mapping: 1854 (SE) 403899 Potentially Infilled Land (Water) 162 Use: Unknown Filled Ground (Pond, marsh, river, stream, dock etc) A18SE 418 - 457867 Date of Mapping: 1854 (NE) 404595 Potentially Infilled Land (Water) 163 Use: Unknown Filled Ground (Pond, marsh, river, stream, dock etc) A18SE 420 - 457852 Date of Mapping: 1894 (NE) 404605 Potentially Infilled Land (Water) 164 Use: Unknown Filled Ground (Pond, marsh, river, stream, dock etc) A12SE 455 - 457304 Date of Mapping: 1894 (SW) 403950 Potentially Infilled Land (Water) 165 Use: Unknown Filled Ground (Pond, marsh, river, stream, dock etc) A12SE 469 - 457210 Date of Mapping: 1956 (W) 404101 Potentially Infilled Land (Water) 166 Use: Unknown Filled Ground (Pond, marsh, river, stream, dock etc) A12SE 476 - 457313 Date of Mapping: 1956 (SW) 403908 Order Number: 242475436_1_1 Date: 12-May-2020 rpr_ec_datasheet v53.0 A Landmark Information Group Service Page 44 of 104 Waste Quadrant Estimated Map Reference Details Distance Contact NGR ID (Compass Direction) From Site Potentially Infilled Land (Water) 167 Use: Unknown Filled Ground (Pond, marsh, river, stream, dock etc) A12NE 499 - 457219 Date of Mapping: 1894 (NW) 404465 Potentially Infilled Land (Water) 168 Use: Unknown Filled Ground (Pond, marsh, river, stream, dock etc) A14NW 515 - 458174 Date of Mapping: 1854 (E) 404263 Potentially Infilled Land (Water) 169 Use: Unknown Filled Ground (Pond, marsh, river, stream, dock etc) A12SE 527 - 457213 Date of Mapping: 1938 (SW) 403956 Potentially Infilled Land (Water) 170 Use: Unknown Filled Ground (Pond, marsh, river, stream, dock etc) A14NW 555 - 458167 Date of Mapping: 1907 (NE) 404459 Potentially Infilled Land (Water) 171 Use: Unknown Filled Ground (Pond, marsh, river, stream, dock etc) A12NE 566 - 457102 Date of Mapping: 1956 (W) 404320 Potentially Infilled Land (Water) 172 Use: Unknown Filled Ground (Pond, marsh, river, stream, dock etc) A12SE 570 - 457145 Date of Mapping: 1956 (SW) 403989 Potentially Infilled Land (Water) 173 Use: Unknown Filled Ground (Pond, marsh, river, stream, dock etc) A8NW 596 - 457425 Date of Mapping: 1894 (SW) 403685 Potentially Infilled Land (Water) 174 Use: Unknown Filled Ground (Pond, marsh, river, stream, dock etc) A12SE 600 - 457092 Date of Mapping: 1956 (W) 404041 Potentially Infilled Land (Water) 175 Use: Unknown Filled Ground (Pond, marsh, river, stream, dock etc) A12SE 601 - 457069 Date of Mapping: 1956 (W) 404124 Potentially Infilled Land (Water) 176 Use: Unknown Filled Ground (Pond, marsh, river, stream, dock etc) A14SW 607 - 458199 Date of Mapping: 1854 (SE) 403955 Potentially Infilled Land (Water) 177 Use: Unknown Filled Ground (Pond, marsh, river, stream, dock etc) A12SE 608 - 457136 Date of Mapping: 1907 (SW) 403926 Potentially Infilled Land (Water) 178 Use: Unknown Filled Ground (Pond, marsh, river, stream, dock etc) A12NE 628 - 457100 Date of Mapping: 1894 (NW) 404515 Potentially Infilled Land (Water) 179 Use: Unknown Filled Ground (Pond, marsh, river, stream, dock etc) A12SE 656 - 457090 Date of Mapping: 1956 (SW) 403909 Potentially Infilled Land (Water) 180 Use: Unknown Filled Ground (Pond, marsh, river, stream, dock etc) A12NE 661 - 457075 Date of Mapping: 1907 (NW) 404539 Potentially Infilled Land (Water) 181 Use: Unknown Filled Ground (Pond, marsh, river, stream, dock etc) A19SW 669 - 458203 Date of Mapping: 1894 (NE) 404623 Potentially Infilled Land (Water) 182 Use: Unknown Filled Ground (Pond, marsh, river, stream, dock etc) A14SW 702 - 458289 Date of Mapping: 1854 (SE) 403921 Potentially Infilled Land (Water) 183 Use: Unknown Filled Ground (Pond, marsh, river, stream, dock etc) A17SE 706 - 457043 Date of Mapping: 1956 (NW) 404575 Potentially Infilled Land (Water) 184 Use: Unknown Filled Ground (Pond, marsh, river, stream, dock etc) A19SW 721 - 458274 Date of Mapping: 1907 (NE) 404610 Potentially Infilled Land (Water) 185 Use: Unknown Filled Ground (Pond, marsh, river, stream, dock etc) A14NW 736 - 458330 Date of Mapping: 1907 (NE) 404538 Potentially Infilled Land (Water) 186 Use: Unknown Filled Ground (Pond, marsh, river, stream, dock etc) A14NE 748 - 458388 Date of Mapping: 1854 (E) 404403 Potentially Infilled Land (Water) 187 Use: Unknown Filled Ground (Pond, marsh, river, stream, dock etc) A14SE 771 - 458431 Date of Mapping: 1907 (E) 404221 Order Number: 242475436_1_1 Date: 12-May-2020 rpr_ec_datasheet v53.0 A Landmark Information Group Service Page 45 of 104 Waste Quadrant Estimated Map Reference Details Distance Contact NGR ID (Compass Direction) From Site Potentially Infilled Land (Water) 188 Use: Unknown Filled Ground (Pond, marsh, river, stream, dock etc) A14NE 776 - 458425 Date of Mapping: 1907 (E) 404362 Potentially Infilled Land (Water) 189 Use: Unknown Filled Ground (Pond, marsh, river, stream, dock etc) A19SW 783 - 458291 Date of Mapping: 1854 (NE) 404697 Potentially Infilled Land (Water) 190 Use: Unknown Filled Ground (Pond, marsh, river, stream, dock etc) A19SW 800 - 458202 Date of Mapping: 1854 (NE) 404820 Potentially Infilled Land (Water) 191 Use: Unknown Filled Ground (Pond, marsh, river, stream, dock etc) A8SE 805 - 457760 Date of Mapping: 1854 (S) 403435 Potentially Infilled Land (Water) 192 Use: Unknown Filled Ground (Pond, marsh, river, stream, dock etc) A9NW 813 - 458142 Date of Mapping: 1907 (SE) 403578 Potentially Infilled Land (Water) 193 Use: Unknown Filled Ground (Pond, marsh, river, stream, dock etc) A19SW 826 - 458220 Date of Mapping: 1854 (NE) 404838 Potentially Infilled Land (Water) 194 Use: Unknown Filled Ground (Pond, marsh, river, stream, dock etc) A17SW 835 - 456952 Date of Mapping: 1956 (NW) 404674 Potentially Infilled Land (Water) 195 Use: Unknown Filled Ground (Pond, marsh, river, stream, dock etc) A12NW 835 - 456830 Date of Mapping: 1854 (W) 404313 Potentially Infilled Land (Water) 196 Use: Unknown Filled Ground (Pond, marsh, river, stream, dock etc) A7NE 839 - 457028 Date of Mapping: 1956 (SW) 403681 Potentially Infilled Land (Water) 197 Use: Unknown Filled Ground (Pond, marsh, river, stream, dock etc) A19SE 845 - 458406 Date of Mapping: 1894 (NE) 404628 Potentially Infilled Land (Water) 198 Use: Unknown Filled Ground (Pond, marsh, river, stream, dock etc) A14NE 848 - 458507 Date of Mapping: 1907 (E) 404270 Potentially Infilled Land (Water) 199 Use: Unknown Filled Ground (Pond, marsh, river, stream, dock etc) A12SW 853 - 456843 Date of Mapping: 1907 (W) 403988 Potentially Infilled Land (Water) 200 Use: Unknown Filled Ground (Pond, marsh, river, stream, dock etc) A12SW 873 - 456796 Date of Mapping: 1907 (W) 404112 Potentially Infilled Land (Water) 201 Use: Unknown Filled Ground (Pond, marsh, river, stream, dock etc) A14NE 874 - 458529 Date of Mapping: 1907 (E) 404327 Potentially Infilled Land (Water) 202 Use: Unknown Filled Ground (Pond, marsh, river, stream, dock etc) A7SE 886 - 457168 Date of Mapping: 1956 (SW) 403497 Potentially Infilled Land (Water) 203 Use: Unknown Filled Ground (Pond, marsh, river, stream, dock etc) A12SW 898 - 456780 Date of Mapping: 1907 (W) 404054 Potentially Infilled Land (Water) 204 Use: Unknown Filled Ground (Pond, marsh, river, stream, dock etc) A12NW 903 - 456778 Date of Mapping: 1938 (W) 404421 Potentially Infilled Land (Water) 205 Use: Unknown Filled Ground (Pond, marsh, river, stream, dock etc) A17SW 925 - 456811 Date of Mapping: 1956 (NW) 404597 Potentially Infilled Land (Water) 206 Use: Unknown Filled Ground (Pond, marsh, river, stream, dock etc) A19SE 926 - 458336 Date of Mapping: 1854 (NE) 404865 Potentially Infilled Land (Water) 207 Use: Unknown Filled Ground (Pond, marsh, river, stream, dock etc) A14NE 927 - 458576 Date of Mapping: 1907 (E) 404371 Potentially Infilled Land (Water) 208 Use: Unknown Filled Ground (Pond, marsh, river, stream, dock etc) A7NW 928 - 456810 Date of Mapping: 1938 (SW) 403862 Order Number: 242475436_1_1 Date: 12-May-2020 rpr_ec_datasheet v53.0 A Landmark Information Group Service Page 46 of 104 Waste Quadrant Estimated Map Reference Details Distance Contact NGR ID (Compass Direction) From Site Potentially Infilled Land (Water) 209 Use: Unknown Filled Ground (Pond, marsh, river, stream, dock etc) A9SW 931 - 458065 Date of Mapping: 1907 (SE) 403395 Potentially Infilled Land (Water) 210 Use: Unknown Filled Ground (Pond, marsh, river, stream, dock etc) A19NW 936 - 458307 Date of Mapping: 1854 (NE) 404909 Potentially Infilled Land (Water) 211 Use: Unknown Filled Ground (Pond, marsh, river, stream, dock etc) A9SW 939 - 458055 Date of Mapping: 1907 (SE) 403381 Potentially Infilled Land (Water) 212 Use: Unknown Filled Ground (Pond, marsh, river, stream, dock etc) A19SE 962 - 458428 Date of Mapping: 1907 (NE) 404811 Potentially Infilled Land (Water) 213 Use: Unknown Filled Ground (Pond, marsh, river, stream, dock etc) A17SW 966 - 456876 Date of Mapping: 1956 (NW) 404797 Potentially Infilled Land (Water) 214 Use: Unknown Filled Ground (Pond, marsh, river, stream, dock etc) A12SW 972 - 456732 Date of Mapping: 1938 (W) 403946 Potentially Infilled Land (Water) 215 Use: Unknown Filled Ground (Pond, marsh, river, stream, dock etc) A19SE 990 - 458505 Date of Mapping: 1854 (NE) 404749 Potentially Infilled Land (Water) 216 Use: Unknown Filled Ground (Pond, marsh, river, stream, dock etc) A9SE 999 - 458391 Date of Mapping: 1854 (SE) 403552 Registered Landfill Sites 217 Licence Holder: British Railways Board A13SW 164 2 457500 Licence Reference: WD20 D 445 MOD 2 (W) 404200 Site Location: Marshgate Depot, Friargate, Doncaster, South Yorkshire Licence Easting: 457500 Licence Northing: 404200 Operator Location: As Site Address Authority: Environment Agency - North East Region, Ridings Area Site Category: Landfill Max Input Rate: Very Small (Less than 10,000 tonnes per year) Waste Source No known restriction on source of waste Restrictions: Status: Licence lapsed/cancelled/defunct/not applicable/surrenderedCancelled Dated: 1st April 1987 Preceded By Not Given Licence: Superseded By Not Given Licence: Positional Accuracy: Manually positioned to the address or location Boundary Accuracy: Not Applicable Authorised Waste Non-Haz. Waste Ex Metal/Timber Fabric. Non-Haz.Excavation Waste Non-Haz.Waste From Constr'N/Demol. Prohibited Waste Cement Asbestos Products Liq/Slurry In Drum/Cont'Rs > 4l Cap Registered Landfill Sites 218 Licence Holder: British Rail Board A7SE 954 2 457050 Licence Reference: WD20 D1038 (SW) 403500 Site Location: National Supply Centre, Hexthorpe, DONCASTER, South Yorkshire, DN4 0DB Licence Easting: 457050 Licence Northing: 403500 Operator Location: As Site Address Authority: Environment Agency - North East Region, Ridings Area Site Category: Landfill Max Input Rate: Undefined Waste Source No known restriction on source of waste Restrictions: Status: Site exempt from licenceExempt Dated: 1st January 1994 Preceded By Not Given Licence: Superseded By Not Given Licence: Positional Accuracy: Manually positioned to the address or location Boundary Accuracy: Not Applicable Authorised Waste Controlled Wastes Order Number: 242475436_1_1 Date: 12-May-2020 rpr_ec_datasheet v53.0 A Landmark Information Group Service Page 47 of 104 Waste Quadrant Estimated Map Reference Details Distance Contact NGR ID (Compass Direction) From Site Registered Waste Transfer Sites 219 Licence Holder: Cutts Bros (Doncaster) Ltd A13NW 18 2 457660 Licence Reference: WD20 D 664 (N) 404250 Site Location: Milethorn Lane, Wheatley, Doncaster, South Yorkshire Operator Location: York Road, DONCASTER, South Yorkshire, DN5 8BG Authority: Environment Agency - North East Region, Ridings Area Site Category: Transfer Max Input Rate: Very Small (Less than 10,000 tonnes per year) Waste Source No known restriction on source of waste Restrictions: Licence Status: Site exempt from licenceExempt Dated: 1st February 1990 Preceded By Not Given Licence: Superseded By Not Given Licence: Positional Accuracy: Manually positioned to the address or location Boundary Quality: Not Supplied Authorised Waste Uncontam.Polythene Sheeting Prohibited Waste Liquid Wastes Registered Waste Transfer Sites 220 Licence Holder: Doncaster M.B.C. A13SE 161 2 457750 Licence Reference: WD20 D1037 MOD 1 (SE) 404100 Site Location: Holmes Depot, Whittington Street, DONCASTER, South Yorkshire, DN1 2SG Operator Location: PO Box 257, The Council House, College Road, DONCASTER, South Yorkshire, DN1 1RN Authority: Environment Agency - North East Region, Ridings Area Site Category: Transfer Max Input Rate: Very Small (Less than 10,000 tonnes per year) Waste Source No known restriction on source of waste Restrictions: Licence Status: Operational as far as is knownOperational Dated: 1st September 1994 Preceded By Not Given Licence: Superseded By Not Given Licence: Positional Accuracy: Located by supplier to within 100m Boundary Quality: Not Supplied Authorised Waste General Commercial Waste General Domestic Refuse Max.Waste Permitted By Licence Street Sweepings/Litter Prohibited Waste Liquid Wastes Sludge Wastes Registered Waste Transfer Sites 221 Licence Holder: British Gas (Transco) Plc A13SE 278 2 457750 Licence Reference: WD20 D1014 MOD 1 (S) 403970 Site Location: Doncaster Depot, Church Way, Doncaster, South Yorkshire Operator Location: Greasborough Road, ROTHERHAM, South Yorkshire, S61 4QQ Authority: Environment Agency - North East Region, Ridings Area Site Category: Transfer Max Input Rate: Very Small (Less than 10,000 tonnes per year) Waste Source No known restriction on source of waste Restrictions: Licence Status: Licence has completion certificateSurrendered Dated: 15th July 1993 Preceded By Not Given Licence: Superseded By Not Given Licence: Positional Accuracy: Manually positioned to the address or location Boundary Quality: Not Supplied Authorised Waste Excavation Spoil Ferrous Metal Scrap Max.Waste Permitted By Licence Paper/Pack'G/Sim'R Combustible Waste Polyethylene Pipe Order Number: 242475436_1_1 Date: 12-May-2020 rpr_ec_datasheet v53.0 A Landmark Information Group Service Page 48 of 104 Waste Quadrant Estimated Map Reference Details Distance Contact NGR ID (Compass Direction) From Site Registered Waste Transfer Sites 222 Licence Holder: R & J Trout A19SW 715 2 458200 Licence Reference: WD20 D 706 (NE) 404700 Site Location: Chapel Auto Factors Ltd, Radiance Road, Doncaster, South Yorkshire Operator Location: Savile Road, Savile Town, DEWSBURY, West Yorkshire, WF12 9PJ Authority: Environment Agency - North East Region, Ridings Area Site Category: Transfer Max Input Rate: Very Small (Less than 10,000 tonnes per year) Waste Source No known restriction on source of waste Restrictions: Licence Status: Site exempt from licenceExempt Dated: 1st June 1992 Preceded By Not Given Licence: Superseded By Not Given Licence: Positional Accuracy: Approximate location provided by supplier Boundary Quality: Not Supplied Authorised Waste Contam.With Paint Max.Storage Paint Thinners Registered Waste Treatment or Disposal Sites 223 Licence Holder: C F Booth Doncaster Ltd A13NE 92 2 457750 Licence Reference: WD20 D1090 (E) 404250 Site Location: Wharf Road, Doncaster, South Yorkshire Operator Location: Centurion Way, DONCASTER, South Yorkshire, DN5 9TP Authority: Environment Agency - North East Region, Ridings Area Site Category: Scrapyard Max Input Rate: Medium (Equal to or greater than 25,000 and less than 75,000 tonnes per year) Waste Source No known restriction on source of waste Restrictions: Licence Status: Licence lapsed/cancelled/defunct/not applicable/surrenderedCancelled Dated: 1st September 1994 Preceded By Not Given Licence: Superseded By Not Given Licence: Positional Accuracy: Manually positioned to the road within the address or location Boundary Quality: Not Supplied Authorised Waste Ferrous Metal Scrap Max.Waste Permitted By Licence Non-Ferrous Metal Scrap Scrap Domestic Goods Scrap Metal Containers Scrap Motor Vehicles Scrap Trailers & Chassis Scrap Tyres Prohibited Waste Liquid Wastes Putrescible Waste Registered Waste Treatment or Disposal Sites 224 Licence Holder: R.M.S. Industries A14NW 471 2 458100 Licence Reference: WD20 D 965 (E) 404400 Site Location: Unit 29 Radiance Road, DONCASTER, South Yorkshire, DN1 2TE Operator Location: As Site Address Authority: Environment Agency - North East Region, Ridings Area Site Category: Scrapyard Max Input Rate: Very Small (Less than 10,000 tonnes per year) Waste Source No known restriction on source of waste Restrictions: Licence Status: Licence lapsed/cancelled/defunct/not applicable/surrenderedCancelled Dated: 1st July 1993 Preceded By Not Given Licence: Superseded By Not Given Licence: Positional Accuracy: Manually positioned to the road within the address or location Boundary Quality: Not Supplied Authorised Waste Ferrous Metal Scrap Max.Stor Non-Ferrous Metal Scrap Max.Stor Prohibited Waste Liquid Wastes Order Number: 242475436_1_1 Date: 12-May-2020 rpr_ec_datasheet v53.0 A Landmark Information Group Service Page 49 of 104 Waste Quadrant Estimated Map Reference Details Distance Contact NGR ID (Compass Direction) From Site Registered Waste Treatment or Disposal Sites 225 Licence Holder: Croda Application Chemicals Ltd A19SW 653 2 458200 Licence Reference: WD20 D 233 (NE) 404600 Site Location: Churchill Road, DONCASTER, South Yorkshire, DN1 2TH Operator Location: As Site Address Authority: Environment Agency - North East Region, Ridings Area Site Category: Storage Max Input Rate: Undefined Waste Source No known restriction on source of waste Restrictions: Licence Status: Site exempt from licenceExempt Dated: 1st June 1978 Preceded By Not Given Licence: Superseded By Not Given Licence: Positional Accuracy: Manually positioned to the road within the address or location Boundary Quality: Not Supplied Authorised Waste Calcium Oxide Bags Residues Of Pvc Underseal Manuf. Tri-Basic Lead Sulphate Paste Registered Waste Treatment or Disposal Sites 226 Licence Holder: Doncaster M.B.C. A12SE 740 2 457000 Licence Reference: WD20 D 188 (SW) 403900 Site Location: North Bridge Depot, Doncaster, South Yorkshire Operator Location: Waste Disposal Section, North Bridge Depot, Doncaster, South Yorkshire Authority: Environment Agency - North East Region, Ridings Area Site Category: Storage Max Input Rate: Very Small (Less than 10,000 tonnes per year) Waste Source No known restriction on source of waste Restrictions: Licence Status: Licence has completion certificateSurrendered Dated: 28th November 1977 Preceded By Not Given Licence: Superseded By Not Given Licence: Positional Accuracy: Manually positioned to the address or location Boundary Quality: Not Supplied Authorised Waste Asbestos Order Number: 242475436_1_1 Date: 12-May-2020 rpr_ec_datasheet v53.0 A Landmark Information Group Service Page 50 of 104 Hazardous Substances Quadrant Estimated Map Reference Details Distance Contact NGR ID (Compass Direction) From Site Control of Major Accident Hazards Sites (COMAH) 227 Name: Transco Plc A13SE 273 6 457799 Location: 121 Church Way, DONCASTER, South Yorkshire, DN1 2RB (SE) 403998 Reference: Not Supplied Type: Lower Tier Status: Record Ceased To Be Supplied Under COMAH Regulations Positional Accuracy: Manually positioned to the address or location Notification of Installations Handling Hazardous Substances (NIHHS) 228 Name: Transco. A13SE 277 6 457799 Location: Church Way, DONCASTER, South Yorkshire, DN1 2RB (SE) 403993 Status: Not Active Positional Accuracy: Manually positioned to the address or location Planning Hazardous Substance Consents 229 Name: British Gas Plc A13SE 286 7 457806 Location: Church Way, DONCASTER, South Yorkshire, DN1 2BB (SE) 403987 Authority: Doncaster Metropolitan Borough Council Application Ref: 92/3350/P Hazardous Liquefied extremely flammable gas (including LPG) and natural gas (whether Substance: liquefied or not) Maximum Quantity: 318 Application date: 12th November 1992 Decision: Deemed Consent GrantedGranted Positional Accuracy: Manually positioned to the address or location Planning Hazardous Substance Consents 230 Name: Bg Transco Plc A13SE 326 7 457791 Location: Gas Compressor Compund, Church Way, Doncaster (SE) 403934 Authority: Doncaster Metropolitan Borough Council Application Ref: 00/1608/P Hazardous Liquefied extremely flammable gas (including LPG) and natural gas (whether Substance: liquefied or not) Maximum Quantity: 0 Application date: 26th April 2000 Decision: Withdrawn Positional Accuracy: Manually positioned to the address or location Planning Hazardous Substance Consents 230 Name: Bg Transco Plc A13SE 326 7 457791 Location: Gas Compressor Compund, Church Way, Doncaster (SE) 403934 Authority: Doncaster Metropolitan Borough Council Application Ref: 00/2021/P Hazardous Liquefied extremely flammable gas (including LPG) and natural gas (whether Substance: liquefied or not) Maximum Quantity: 0 Application date: 26th April 2000 Decision: Withdrawn Positional Accuracy: Manually positioned to the address or location Planning Hazardous Substance Consents 231 Name: Gas & Hire Ltd A13SE 344 7 457995 Location: 195 Church Way, DONCASTER, South Yorkshire, DN1 2SD (E) 404159 Authority: Doncaster Metropolitan Borough Council Application Ref: 94/3576/P Hazardous Liquefied extremely flammable gas (including LPG) and natural gas (whether Substance: liquefied or not) Maximum Quantity: 35 Application date: 6th December 1994 Decision: New application refusedRefused Positional Accuracy: Automatically positioned to the address Planning Hazardous Substance Consents 232 Name: Gas & Hire Ltd A7NE 867 7 457004 Location: Marshgate Industrial Estate, DONCASTER, South Yorkshire, DN5 8AX (SW) 403666 Authority: Doncaster Metropolitan Borough Council Application Ref: 92/2808/P Hazardous Liquefied extremely flammable gas (including LPG) and natural gas (whether Substance: liquefied or not) Maximum Quantity: 100 Application date: 23rd September 1992 Decision: Deemed Consent GrantedGranted Positional Accuracy: Manually positioned within the geographical locality Order Number: 242475436_1_1 Date: 12-May-2020 rpr_ec_datasheet v53.0 A Landmark Information Group Service Page 51 of 104 Geological Quadrant Estimated Map Reference Details Distance Contact NGR ID (Compass Direction) From Site BGS 1:625,000 Solid Geology Description: Triassic Rocks (Undifferentiated) A13NE 0 1 457660 (NE) 404233 BGS Estimated Soil Chemistry Source: British Geological Survey, National Geoscience Information Service A13NE 0 1 457660 Soil Sample Type: Rural Soil (NE) 404233 Arsenic <15 mg/kg Concentration: Cadmium <1.8 mg/kg Concentration: Chromium 60 - 90 mg/kg Concentration: Lead Concentration: 200 - 300 mg/kg Nickel 30 - 45 mg/kg Concentration: BGS Estimated Soil Chemistry Source: British Geological Survey, National Geoscience Information Service A13NW 161 1 457500 Soil Sample Type: Rural Soil (W) 404233 Arsenic <15 mg/kg Concentration: Cadmium <1.8 mg/kg Concentration: Chromium 60 - 90 mg/kg Concentration: Lead Concentration: 100 - 200 mg/kg Nickel 30 - 45 mg/kg Concentration: BGS Estimated Soil Chemistry Source: British Geological Survey, National Geoscience Information Service A13SE 227 1 457871 Soil Sample Type: Rural Soil (E) 404150 Arsenic <15 mg/kg Concentration: Cadmium <1.8 mg/kg Concentration: Chromium 20 - 40 mg/kg Concentration: Lead Concentration: 200 - 300 mg/kg Nickel <15 mg/kg Concentration: BGS Estimated Soil Chemistry Source: British Geological Survey, National Geoscience Information Service A13SE 233 1 457660 Soil Sample Type: Rural Soil (S) 404000 Arsenic <15 mg/kg Concentration: Cadmium <1.8 mg/kg Concentration: Chromium 40 - 60 mg/kg Concentration: Lead Concentration: 100 - 200 mg/kg Nickel 15 - 30 mg/kg Concentration: BGS Estimated Soil Chemistry Source: British Geological Survey, National Geoscience Information Service A14NW 340 1 458000 Soil Sample Type: Rural Soil (E) 404233 Arsenic <15 mg/kg Concentration: Cadmium <1.8 mg/kg Concentration: Chromium 20 - 40 mg/kg Concentration: Lead Concentration: 100 - 200 mg/kg Nickel <15 mg/kg Concentration: BGS Estimated Soil Chemistry Source: British Geological Survey, National Geoscience Information Service A14SW 431 1 458026 Soil Sample Type: Rural Soil (SE) 404005 Arsenic <15 mg/kg Concentration: Cadmium <1.8 mg/kg Concentration: Chromium 40 - 60 mg/kg Concentration: Lead Concentration: 100 - 200 mg/kg Nickel <15 mg/kg Concentration: Order Number: 242475436_1_1 Date: 12-May-2020 rpr_ec_datasheet v53.0 A Landmark Information Group Service Page 52 of 104 Geological Quadrant Estimated Map Reference Details Distance Contact NGR ID (Compass Direction) From Site BGS Estimated Soil Chemistry Source: British Geological Survey, National Geoscience Information Service A12NE 661 1 457000 Soil Sample Type: Rural Soil (W) 404233 Arsenic <15 mg/kg Concentration: Cadmium <1.8 mg/kg Concentration: Chromium 90 - 120 mg/kg Concentration: Lead Concentration: 100 - 200 mg/kg Nickel 30 - 45 mg/kg Concentration: BGS Estimated Soil Chemistry Source: British Geological Survey, National Geoscience Information Service A19SW 683 1 458000 Soil Sample Type: Rural Soil (NE) 404824 Arsenic <15 mg/kg Concentration: Cadmium <1.8 mg/kg Concentration: Chromium 60 - 90 mg/kg Concentration: Lead Concentration: 100 - 200 mg/kg Nickel 30 - 45 mg/kg Concentration: BGS Estimated Soil Chemistry Source: British Geological Survey, National Geoscience Information Service A12SE 700 1 457000 Soil Sample Type: Rural Soil (W) 404000 Arsenic <15 mg/kg Concentration: Cadmium <1.8 mg/kg Concentration: Chromium 40 - 60 mg/kg Concentration: Lead Concentration: <100 mg/kg Nickel 15 - 30 mg/kg Concentration: BGS Estimated Soil Chemistry Source: British Geological Survey, National Geoscience Information Service A8SE 733 1 457660 Soil Sample Type: Rural Soil (S) 403500 Arsenic <15 mg/kg Concentration: Cadmium <1.8 mg/kg Concentration: Chromium 40 - 60 mg/kg Concentration: Lead Concentration: <100 mg/kg Nickel <15 mg/kg Concentration: BGS Estimated Soil Chemistry Source: British Geological Survey, National Geoscience Information Service A12NW 947 1 456739 Soil Sample Type: Rural Soil (W) 404449 Arsenic <15 mg/kg Concentration: Cadmium <1.8 mg/kg Concentration: Chromium 40 - 60 mg/kg Concentration: Lead Concentration: 100 - 200 mg/kg Nickel <15 mg/kg Concentration: BGS Recorded Mineral Sites 233 Site Name: Baxter Avenue Sand Pit A9NW 609 1 458165 Location: Wheatley, Doncaster, South Yorkshire (SE) 403893 Source: British Geological Survey, National Geoscience Information Service Reference: 106746 Type: Opencast Status: Ceased Operator: Unknown Operator Operator Location: Not Supplied Periodic Type: Quaternary Geology: Glaciofluvial Deposits, Mid Pleistocene Commodity: Sand Positional Accuracy: Located by supplier to within 10m Order Number: 242475436_1_1 Date: 12-May-2020 rpr_ec_datasheet v53.0 A Landmark Information Group Service Page 53 of 104 Geological Quadrant Estimated Map Reference Details Distance Contact NGR ID (Compass Direction) From Site BGS Recorded Mineral Sites 234 Site Name: East Lathe Gate Gravel Pit A8SE 921 1 457852 Location: Wheatley, Doncaster, South Yorkshire (S) 403332 Source: British Geological Survey, National Geoscience Information Service Reference: 106747 Type: Opencast Status: Ceased Operator: Unknown Operator Operator Location: Not Supplied Periodic Type: Quaternary Geology: Glaciofluvial Deposits, Mid Pleistocene Commodity: Sand and Gravel Positional Accuracy: Located by supplier to within 10m BGS Measured Urban Soil Chemistry Source: British Geological Survey, National Geoscience Information Service A13SE 120 1 457780 Grid: 457780, 404230 (E) 404230 Soil Sample Type: Topsoil Sample Area: Doncaster Arsenic Measured 12.30 mg/kg Concentration: Cadmium Measured 0.80 mg/kg Concentration: Chromium Measured 60.20 mg/kg Concentration: Lead Measured 215.50 mg/kg Concentration: Nickel Measured 39.90 mg/kg Concentration: BGS Measured Urban Soil Chemistry Source: British Geological Survey, National Geoscience Information Service A12NE 411 1 457250 Grid: 457250, 404250 (W) 404250 Soil Sample Type: Topsoil Sample Area: Doncaster Arsenic Measured 20.10 mg/kg Concentration: Cadmium Measured 0.50 mg/kg Concentration: Chromium Measured 80.30 mg/kg Concentration: Lead Measured 202.40 mg/kg Concentration: Nickel Measured 39.10 mg/kg Concentration: BGS Measured Urban Soil Chemistry Source: British Geological Survey, National Geoscience Information Service A8NE 478 1 457730 Grid: 457730, 403760 (S) 403760 Soil Sample Type: Topsoil Sample Area: Doncaster Arsenic Measured 16.90 mg/kg Concentration: Cadmium Measured 1.20 mg/kg Concentration: Chromium Measured 87.20 mg/kg Concentration: Lead Measured 249.80 mg/kg Concentration: Nickel Measured 31.30 mg/kg Concentration: BGS Measured Urban Soil Chemistry Source: British Geological Survey, National Geoscience Information Service A18SE 541 1 457720 Grid: 457720, 404770 (N) 404770 Soil Sample Type: Topsoil Sample Area: Doncaster Arsenic Measured 12.30 mg/kg Concentration: Cadmium Measured 0.50 mg/kg Concentration: Chromium Measured 97.00 mg/kg Concentration: Lead Measured 373.30 mg/kg Concentration: Nickel Measured 55.90 mg/kg Concentration: Order Number: 242475436_1_1 Date: 12-May-2020 rpr_ec_datasheet v53.0 A Landmark Information Group Service Page 54 of 104 Geological Quadrant Estimated Map Reference Details Distance Contact NGR ID (Compass Direction) From Site BGS Measured Urban Soil Chemistry Source: British Geological Survey, National Geoscience Information Service A14SW 572 1 458230 Grid: 458230, 404190 (E) 404190 Soil Sample Type: Topsoil Sample Area: Doncaster Arsenic Measured 21.70 mg/kg Concentration: Cadmium Measured 1.30 mg/kg Concentration: Chromium Measured 72.90 mg/kg Concentration: Lead Measured 427.20 mg/kg Concentration: Nickel Measured 33.50 mg/kg Concentration: BGS Measured Urban Soil Chemistry Source: British Geological Survey, National Geoscience Information Service A17SE 650 1 457190 Grid: 457190, 404680 (NW) 404680 Soil Sample Type: Topsoil Sample Area: Doncaster Arsenic Measured 10.50 mg/kg Concentration: Cadmium Measured 1.00 mg/kg Concentration: Chromium Measured 86.90 mg/kg Concentration: Lead Measured 99.50 mg/kg Concentration: Nickel Measured 51.00 mg/kg Concentration: BGS Measured Urban Soil Chemistry Source: British Geological Survey, National Geoscience Information Service A7NE 697 1 457250 Grid: 457250, 403670 (SW) 403670 Soil Sample Type: Topsoil Sample Area: Doncaster Arsenic Measured 21.50 mg/kg Concentration: Cadmium Measured 0.90 mg/kg Concentration: Chromium Measured 81.20 mg/kg Concentration: Lead Measured 269.00 mg/kg Concentration: Nickel Measured 47.30 mg/kg Concentration: BGS Measured Urban Soil Chemistry Source: British Geological Survey, National Geoscience Information Service A19SW 755 1 458210 Grid: 458210, 404750 (NE) 404750 Soil Sample Type: Topsoil Sample Area: Doncaster Arsenic Measured 11.90 mg/kg Concentration: Cadmium Measured 0.10 mg/kg Concentration: Chromium Measured 43.00 mg/kg Concentration: Lead Measured 102.30 mg/kg Concentration: Nickel Measured 22.10 mg/kg Concentration: BGS Measured Urban Soil Chemistry Source: British Geological Survey, National Geoscience Information Service A9NW 772 1 458270 Grid: 458270, 403760 (SE) 403760 Soil Sample Type: Topsoil Sample Area: Doncaster Arsenic Measured 26.50 mg/kg Concentration: Cadmium Measured 1.10 mg/kg Concentration: Chromium Measured 81.20 mg/kg Concentration: Lead Measured 392.80 mg/kg Concentration: Nickel Measured 31.50 mg/kg Concentration: Order Number: 242475436_1_1 Date: 12-May-2020 rpr_ec_datasheet v53.0 A Landmark Information Group Service Page 55 of 104 Geological Quadrant Estimated Map Reference Details Distance Contact NGR ID (Compass Direction) From Site BGS Measured Urban Soil Chemistry Source: British Geological Survey, National Geoscience Information Service A12NW 961 1 456700 Grid: 456700, 404250 (W) 404250 Soil Sample Type: Topsoil Sample Area: Doncaster Arsenic Measured 14.70 mg/kg Concentration: Cadmium Measured 0.90 mg/kg Concentration: Chromium Measured 57.20 mg/kg Concentration: Lead Measured 117.90 mg/kg Concentration: Nickel Measured 29.80 mg/kg Concentration: BGS Measured Urban Soil Chemistry Source: British Geological Survey, National Geoscience Information Service A8SE 991 1 457930 Grid: 457930, 403280 (S) 403280 Soil Sample Type: Topsoil Sample Area: Doncaster Arsenic Measured 24.20 mg/kg Concentration: Cadmium Measured 0.80 mg/kg Concentration: Chromium Measured 56.60 mg/kg Concentration: Lead Measured 312.00 mg/kg Concentration: Nickel Measured 23.90 mg/kg Concentration: BGS Urban Soil Chemistry Averages Source: British Geological Survey, National Geoscience Information Service A13NE 0 1 457660 Sample Area: Doncaster (NE) 404233 Count Id: 279 Arsenic Minimum 2.00 mg/kg Concentration: Arsenic Average 15.00 mg/kg Concentration: Arsenic Maximum 73.00 mg/kg Concentration: Cadmium Minimum 0.10 mg/kg Concentration: Cadmium Average 0.60 mg/kg Concentration: Cadmium Maximum 6.70 mg/kg Concentration: Chromium Minimum 16.00 mg/kg Concentration: Chromium Average 64.00 mg/kg Concentration: Chromium Maximum 354.00 mg/kg Concentration: Lead Minimum 19.00 mg/kg Concentration: Lead Average 127.00 mg/kg Concentration: Lead Maximum 1115.00 mg/kg Concentration: Nickel Minimum 6.00 mg/kg Concentration: Nickel Average 26.00 mg/kg Concentration: Nickel Maximum 181.00 mg/kg Concentration: Coal Mining Affected Areas Description: In an area which may be affected by coal mining activity. It is recommended A13NE 0 8 457660 that a coal mining report is obtained from the Coal Authority. Contact details (NE) 404233 are included in the Useful Contacts section of this report. Mining Instability Mining Evidence: Inconclusive Coal Mining A13NE 0 - 457660 Source: Ove Arup & Partners (NE) 404233 Boundary Quality: As Supplied Non Coal Mining Areas of Great Britain No Hazard Potential for Collapsible Ground Stability Hazards Hazard Potential: No Hazard A13NE 0 1 457660 Source: British Geological Survey, National Geoscience Information Service (NE) 404233 Order Number: 242475436_1_1 Date: 12-May-2020 rpr_ec_datasheet v53.0 A Landmark Information Group Service Page 56 of 104 Geological Quadrant Estimated Map Reference Details Distance Contact NGR ID (Compass Direction) From Site Potential for Collapsible Ground Stability Hazards Hazard Potential: Very Low A13SE 227 1 457871 Source: British Geological Survey, National Geoscience Information Service (E) 404150 Potential for Compressible Ground Stability Hazards Hazard Potential: Moderate A13NE 0 1 457660 Source: British Geological Survey, National Geoscience Information Service (NE) 404233 Potential for Compressible Ground Stability Hazards Hazard Potential: No Hazard A13SE 227 1 457871 Source: British Geological Survey, National Geoscience Information Service (E) 404150 Potential for Ground Dissolution Stability Hazards Hazard Potential: No Hazard A13NE 0 1 457660 Source: British Geological Survey, National Geoscience Information Service (NE) 404233 Potential for Landslide Ground Stability Hazards Hazard Potential: Very Low A13NE 0 1 457660 Source: British Geological Survey, National Geoscience Information Service (NE) 404233 Potential for Running Sand Ground Stability Hazards Hazard Potential: Low A13NE 0 1 457660 Source: British Geological Survey, National Geoscience Information Service (NE) 404233 Potential for Shrinking or Swelling Clay Ground Stability Hazards Hazard Potential: Very Low A13NE 0 1 457660 Source: British Geological Survey, National Geoscience Information Service (NE) 404233 Potential for Shrinking or Swelling Clay Ground Stability Hazards Hazard Potential: No Hazard A13SE 227 1 457871 Source: British Geological Survey, National Geoscience Information Service (E) 404150 Radon Potential - Radon Affected Areas Affected Area: The property is in a Lower probability radon area (less than 1% of homes are A13NE 0 1 457660 estimated to be at or above the Action Level). (NE) 404233 Source: British Geological Survey, National Geoscience Information Service Radon Potential - Radon Protection Measures Protection Measure: No radon protective measures are necessary in the construction of new A13NE 0 1 457660 dwellings or extensions (NE) 404233 Source: British Geological Survey, National Geoscience Information Service Order Number: 242475436_1_1 Date: 12-May-2020 rpr_ec_datasheet v53.0 A Landmark Information Group Service Page 57 of 104 Industrial Land Use Quadrant Estimated Map Reference Details Distance Contact NGR ID (Compass Direction) From Site Contemporary Trade Directory Entries 235 Name: Cutts Recycling Ltd A13SE 29 - 457669 Location: Wharf Road, Doncaster, South Yorkshire, DN1 2ST (S) 404205 Classification: Reclaiming - Waste Products Status: Inactive Positional Accuracy: Automatically positioned to the address Contemporary Trade Directory Entries 236 Name: C F Booth Doncaster A13NE 72 - 457730 Location: Wharf Road, Doncaster, South Yorkshire, DN1 2ST (E) 404250 Classification: Scrap Metal Merchants Status: Active Positional Accuracy: Automatically positioned to the address Contemporary Trade Directory Entries 237 Name: D & H Autos A13NE 147 - 457796 Location: 4 Victoria Mill Business Park, Wharf Road, Doncaster, DN1 2ST (E) 404287 Classification: Garage Services Status: Active Positional Accuracy: Automatically positioned to the address Contemporary Trade Directory Entries 237 Name: Don Valley Engineering Co Ltd A13NE 165 - 457814 Location: Wharf Road, Doncaster, South Yorkshire, DN1 2SE (E) 404291 Classification: Mechanical Handling Engineers Status: Inactive Positional Accuracy: Automatically positioned to the address Contemporary Trade Directory Entries 238 Name: Sita Ltd A13SE 154 - 457787 Location: Holmes Depot, Whittington Street, Doncaster, DN1 2SG (SE) 404146 Classification: Waste Disposal Services Status: Inactive Positional Accuracy: Automatically positioned to the address Contemporary Trade Directory Entries 239 Name: Green Birch Environmental Ltd A13NE 217 - 457813 Location: Wheatley Mills,Milethorn Lane, Doncaster, South Yorkshire, DN1 2SX (NE) 404386 Classification: Waste Disposal Services Status: Active Positional Accuracy: Manually positioned within the geographical locality Contemporary Trade Directory Entries 239 Name: Say Yes Tyres A13NE 220 - 457832 Location: Victoria Mill Business Park, Wharf Road, Doncaster, South Yorkshire, DN1 (NE) 404369 2SX Classification: Tyre Dealers Status: Inactive Positional Accuracy: Automatically positioned to the address Contemporary Trade Directory Entries 240 Name: T H Motson & Sons Ltd A13SW 222 - 457505 Location: Chappell Drive, DONCASTER, South Yorkshire, DN1 2RF (SW) 404074 Classification: Meat - Wholesale Status: Active Positional Accuracy: Automatically positioned to the address Contemporary Trade Directory Entries 241 Name: Doncaster M B C Waste Management A13SE 232 - 457843 Location: Whittington St, Doncaster, South Yorkshire, DN1 2SG (SE) 404090 Classification: Waste Disposal Services Status: Inactive Positional Accuracy: Manually positioned to the road within the address or location Contemporary Trade Directory Entries 242 Name: Doncaster Community Transport A13SE 278 - 457923 Location: Leger House, Brooke Street, Doncaster, South Yorkshire, DN1 2SW (E) 404143 Classification: Bus & Coach Operators & Stations Status: Inactive Positional Accuracy: Automatically positioned to the address Contemporary Trade Directory Entries 242 Name: Leger Bus A13SE 278 - 457923 Location: Leger House, Brooke Street, Doncaster, South Yorkshire, DN1 2SW (E) 404143 Classification: Bus & Coach Operators & Stations Status: Inactive Positional Accuracy: Automatically positioned to the address Order Number: 242475436_1_1 Date: 12-May-2020 rpr_ec_datasheet v53.0 A Landmark Information Group Service Page 58 of 104 Industrial Land Use Quadrant Estimated Map Reference Details Distance Contact NGR ID (Compass Direction) From Site Contemporary Trade Directory Entries 243 Name: J S Hibberd & Sons Ltd A13SW 311 - 457393 Location: The Abattoir, Chappell Drive, Doncaster, South Yorkshire, DN1 2RF (SW) 404076 Classification: Meat - Wholesale Status: Inactive Positional Accuracy: Automatically positioned to the address Contemporary Trade Directory Entries 244 Name: Premier Paint Supplies A13NE 322 - 457948 Location: 3-5, Milethorn Lane, Doncaster, South Yorkshire, DN1 2SU (NE) 404378 Classification: Painting & Decorating Supplies Status: Active Positional Accuracy: Automatically positioned to the address Contemporary Trade Directory Entries 244 Name: A S Sheetmetal A13NE 341 - 457963 Location: Milethorn Lane, Doncaster, South Yorkshire, DN1 2SU (NE) 404388 Classification: Sheet Metal Work Status: Active Positional Accuracy: Automatically positioned to the address Contemporary Trade Directory Entries 244 Name: Fivestar Garage Doncaster Ltd A13NE 347 - 457984 Location: Milethorn Lane, Doncaster, South Yorkshire, DN1 2SU (E) 404356 Classification: Garage Services Status: Active Positional Accuracy: Manually positioned within the geographical locality Contemporary Trade Directory Entries 245 Name: Benest Sprayers Ltd A13NE 323 - 457968 Location: Milethorn La, Doncaster, South Yorkshire, DN1 2SU (E) 404328 Classification: Agricultural Engineers Status: Inactive Positional Accuracy: Manually positioned to the road within the address or location Contemporary Trade Directory Entries 245 Name: Ds Automotive A14NW 358 - 458016 Location: 1, Milethorn Lane, Doncaster, South Yorkshire, DN1 2SU (E) 404269 Classification: Garage Services Status: Inactive Positional Accuracy: Automatically positioned to the address Contemporary Trade Directory Entries 245 Name: Heatherbank Print A14NW 359 - 458010 Location: 4, Milethorn Lane, Doncaster, South Yorkshire, DN1 2SU (E) 404310 Classification: Printers Status: Active Positional Accuracy: Automatically positioned to the address Contemporary Trade Directory Entries 245 Name: Printing.Com A14NW 369 - 458022 Location: 2-4, Milethorn Lane, Doncaster, DN1 2SU (E) 404303 Classification: Printers Status: Active Positional Accuracy: Automatically positioned to the address Contemporary Trade Directory Entries 246 Name: St George'S Car Centre A13SE 350 - 457988 Location: Church Way, Doncaster, South Yorkshire, DN1 2RE (E) 404110 Classification: Car Dealers - Used Status: Inactive Positional Accuracy: Manually positioned to the road within the address or location Contemporary Trade Directory Entries 247 Name: Abattoir & Meat Market A8NW 362 - 457628 Location: Unit 2, Chappell Drive, Doncaster, South Yorkshire, DN1 2RF (S) 403872 Classification: Abattoirs Status: Inactive Positional Accuracy: Automatically positioned in the proximity of the address Contemporary Trade Directory Entries 248 Name: Maus Mould Services A14NW 389 - 457998 Location: Milethorn Lane, Doncaster, South Yorkshire, DN1 2SU (NE) 404424 Classification: Coating Specialists Status: Active Positional Accuracy: Automatically positioned to the address Contemporary Trade Directory Entries 249 Name: C & B Company A13SW 399 - 457353 Location: Chappell Drive, Doncaster, South Yorkshire, DN1 2RF (SW) 403979 Classification: Packaging Materials Manufacturers & Suppliers Status: Inactive Positional Accuracy: Automatically positioned to the address Order Number: 242475436_1_1 Date: 12-May-2020 rpr_ec_datasheet v53.0 A Landmark Information Group Service Page 59 of 104 Industrial Land Use Quadrant Estimated Map Reference Details Distance Contact NGR ID (Compass Direction) From Site Contemporary Trade Directory Entries 250 Name: Fleet Cars Direct A14NW 421 - 458066 Location: Unit 2, Milethorn Lane, Doncaster, DN1 2SU (E) 404343 Classification: Car Dealers - Used Status: Active Positional Accuracy: Automatically positioned to the address Contemporary Trade Directory Entries 250 Name: Gns Engineering A14NW 421 - 458066 Location: Unit 2, Milethorn Lane, Doncaster, DN1 2SU (E) 404343 Classification: Sheet Metal Work Status: Inactive Positional Accuracy: Automatically positioned to the address Contemporary Trade Directory Entries 251 Name: National Tyre And Autocare A13SE 427 - 457990 Location: Holmes Garage, Holmes Market, Doncaster, South Yorkshire, DN1 2ND (SE) 403963 Classification: Tyre Dealers Status: Inactive Positional Accuracy: Automatically positioned to the address Contemporary Trade Directory Entries 251 Name: National Tyres And Autocare A13SE 427 - 457990 Location: Holmes Garage, Holmes Market, Doncaster, South Yorkshire, DN1 2ND (SE) 403963 Classification: Tyre Dealers Status: Inactive Positional Accuracy: Automatically positioned to the address Contemporary Trade Directory Entries 251 Name: National Tyres & Autocare A14SW 440 - 458001 Location: Holmes Garage, Holmes Market, Doncaster, DN1 2ND (SE) 403955 Classification: Tyre Dealers Status: Active Positional Accuracy: Automatically positioned to the address Contemporary Trade Directory Entries 252 Name: Northern Counties Meat Group Ltd A12SE 437 - 457293 Location: The Abattoir, Chappell Drive, Doncaster, South Yorkshire, DN1 2RF (SW) 403996 Classification: Meat - Wholesale Status: Inactive Positional Accuracy: Automatically positioned to the address Contemporary Trade Directory Entries 252 Name: Doncaster Slaughtering Co Ltd A12SE 437 - 457293 Location: The Abattoir, Chappell Drive, Doncaster, South Yorkshire, DN1 2RF (SW) 403996 Classification: Abattoirs Status: Inactive Positional Accuracy: Manually positioned to the address or location Contemporary Trade Directory Entries 253 Name: Glenfast International Freight Ltd A8NE 445 - 457714 Location: Bay 10-11 Wholesale Fruit Market,Chappell Dr, Doncaster, South Yorkshire, (S) 403791 DN1 2RJ Classification: Road Haulage Services Status: Inactive Positional Accuracy: Manually positioned to the road within the address or location Contemporary Trade Directory Entries 253 Name: Bapp Industrial Doncaster A8NE 448 - 457720 Location: Chappell Drive, Doncaster, South Yorkshire, DN1 2RW (S) 403789 Classification: Nuts, Bolts & Fixings Status: Active Positional Accuracy: Automatically positioned in the proximity of the address Contemporary Trade Directory Entries 253 Name: St Georges Car Centre Plc A8NE 456 - 457698 Location: Church Way, Doncaster, South Yorkshire, DN1 2RE (S) 403779 Classification: Car Dealers Status: Inactive Positional Accuracy: Automatically positioned to the address Contemporary Trade Directory Entries 253 Name: St Georges Filling Station A8NE 456 - 457698 Location: Church Way, Doncaster, South Yorkshire, DN1 2RE (S) 403779 Classification: Petrol Filling Stations Status: Active Positional Accuracy: Automatically positioned to the address Order Number: 242475436_1_1 Date: 12-May-2020 rpr_ec_datasheet v53.0 A Landmark Information Group Service Page 60 of 104 Industrial Land Use Quadrant Estimated Map Reference Details Distance Contact NGR ID (Compass Direction) From Site Contemporary Trade Directory Entries 254 Name: Repchoice A13SW 455 - 457325 Location: Chappell Drive, Doncaster, South Yorkshire, DN1 2RF (SW) 403926 Classification: Food Products - Manufacturers Status: Inactive Positional Accuracy: Automatically positioned to the address Contemporary Trade Directory Entries 255 Name: Polydon Industries Ltd A14NW 470 - 458067 Location: Polydon Park, Radiance Road, Doncaster, South Yorkshire, DN1 2TE (NE) 404467 Classification: Gate Manufacturers Status: Inactive Positional Accuracy: Automatically positioned to the address Contemporary Trade Directory Entries 256 Name: Saria A12NE 485 - 457234 Location: Ings Road, Doncaster, DN5 9TL (NW) 404462 Classification: Pet Foods & Animal Feeds Status: Inactive Positional Accuracy: Automatically positioned to the address Contemporary Trade Directory Entries 257 Name: D & B Mechanics A8NE 489 - 457953 Location: Unit 8, Athron Industrial Estate, Holmes Market, Doncaster, South Yorkshire, (SE) 403841 DN1 2NU Classification: Garage Services Status: Inactive Positional Accuracy: Automatically positioned to the address Contemporary Trade Directory Entries 258 Name: German Car Clinic A14NW 493 - 458029 Location: Unit 21 Leger Business Park,Churchill Road, Doncaster, South Yorkshire, (NE) 404558 DN1 2TF Classification: Garage Services Status: Active Positional Accuracy: Automatically positioned to the address Contemporary Trade Directory Entries 258 Name: Robs Autos A19SW 505 - 458034 Location: Unit 1, Doncaster, South Yorkshire, DN1 2TF (NE) 404571 Classification: Garage Services Status: Active Positional Accuracy: Manually positioned within the geographical locality Contemporary Trade Directory Entries 258 Name: Howarth Timber Group A19SW 505 - 458034 Location: Churchill Business Park,Churchill Road, Doncaster, South Yorkshire, DN1 (NE) 404571 2TF Classification: Builders' Merchants Status: Active Positional Accuracy: Manually positioned within the geographical locality Contemporary Trade Directory Entries 258 Name: Archway Motors A14NW 516 - 458081 Location: Unit 4, Leger Business Park, Churchill Road, Doncaster, DN1 2TF (NE) 404530 Classification: Garage Services Status: Active Positional Accuracy: Automatically positioned to the address Contemporary Trade Directory Entries 258 Name: Doncaster Radiators A14NW 523 - 458066 Location: Unit 5,Churchill Building,Churchill Road, Doncaster, South Yorkshire, DN1 (NE) 404562 2TF Classification: Car Radiator Servicing & Repairs Status: Inactive Positional Accuracy: Manually positioned to the address or location Contemporary Trade Directory Entries 258 Name: Designa Chassis A14NW 523 - 458066 Location: Unit 1A,Churchill Building,Churchill Rd, Doncaster, South Yorkshire, DN1 2TF (NE) 404562 Classification: Garage Services Status: Inactive Positional Accuracy: Manually positioned to the address or location Contemporary Trade Directory Entries 258 Name: Sticky Baits A14NW 523 - 458066 Location: Unit 18,Churchill Rd, Doncaster, South Yorkshire, DN1 2TF (NE) 404562 Classification: Fishing & Angling Equipment - Manufacturers & Distributors Status: Inactive Positional Accuracy: Manually positioned to the address or location Order Number: 242475436_1_1 Date: 12-May-2020 rpr_ec_datasheet v53.0 A Landmark Information Group Service Page 61 of 104 Industrial Land Use Quadrant Estimated Map Reference Details Distance Contact NGR ID (Compass Direction) From Site Contemporary Trade Directory Entries 258 Name: Harvest Fields Distribution Ltd A14NW 524 - 458067 Location: Unit 17, Churchill Road, Doncaster, South Yorkshire, DN1 2TF (NE) 404563 Classification: Distribution Services Status: Active Positional Accuracy: Automatically positioned to the address Contemporary Trade Directory Entries 258 Name: L P D Doncaster Ltd A14NW 524 - 458067 Location: Unit 2, Churchill Business Park, Churchill Road, Doncaster, South Yorkshire, (NE) 404563 DN1 2TF Classification: Printers Status: Inactive Positional Accuracy: Automatically positioned to the address Contemporary Trade Directory Entries 258 Name: Churchill Smithy Blacksmith A14NW 524 - 458067 Location: Unit 17, Churchill Business Park, Churchill Road, Doncaster, South Yorkshire, (NE) 404563 DN1 2TF Classification: Blacksmiths & Forgemasters Status: Inactive Positional Accuracy: Automatically positioned to the address Contemporary Trade Directory Entries 258 Name: C C F Supplies Ltd A14NW 524 - 458067 Location: Riverside House, Churchill Road, Doncaster, South Yorkshire, DN1 2TF (NE) 404563 Classification: Cleaning Materials & Equipment Status: Active Positional Accuracy: Automatically positioned in the proximity of the address Contemporary Trade Directory Entries 259 Name: S & D Motors A8NE 494 - 457893 Location: 80, Dockin Hill Road, DONCASTER, South Yorkshire, DN1 2QX (SE) 403797 Classification: Car Body Repairs Status: Active Positional Accuracy: Automatically positioned to the address Contemporary Trade Directory Entries 260 Name: Body Shop (Uk) A9NW 498 - 458004 Location: Unit 14A, Athron Industrial Estate, Holmes Market, Doncaster, South (SE) 403873 Yorkshire, DN1 2NU Classification: Car Body Repairs Status: Inactive Positional Accuracy: Automatically positioned to the address Contemporary Trade Directory Entries 260 Name: Holmes Cars A9NW 498 - 458004 Location: Unit 1C, Athron Industrial Estate, Holmes Market, Doncaster, South Yorkshire, (SE) 403873 DN1 2NU Classification: Car Dealers - Used Status: Inactive Positional Accuracy: Automatically positioned to the address Contemporary Trade Directory Entries 260 Name: L & M Car Sales A9NW 518 - 458021 Location: Unit 6,Athron Ind Est,Holmes Market, Doncaster, South Yorkshire, DN1 2NU (SE) 403862 Classification: Car Dealers - Used Status: Inactive Positional Accuracy: Manually positioned within the geographical locality Contemporary Trade Directory Entries 261 Name: Jewson A14NW 499 - 458122 Location: 1, Radiance Road, Doncaster, DN1 2TE (E) 404420 Classification: Builders' Merchants Status: Active Positional Accuracy: Automatically positioned to the address Contemporary Trade Directory Entries 261 Name: Build Centre A14NW 499 - 458122 Location: 1, Radiance Road, Doncaster, South Yorkshire, DN1 2TE (E) 404420 Classification: Builders' Merchants Status: Inactive Positional Accuracy: Automatically positioned to the address Contemporary Trade Directory Entries 262 Name: Doncaster A14SW 537 - 458163 Location: 31, Beckett Road, Doncaster, South Yorkshire, DN2 4AD (E) 404046 Classification: Laundries & Launderettes Status: Inactive Positional Accuracy: Automatically positioned to the address Order Number: 242475436_1_1 Date: 12-May-2020 rpr_ec_datasheet v53.0 A Landmark Information Group Service Page 62 of 104 Industrial Land Use Quadrant Estimated Map Reference Details Distance Contact NGR ID (Compass Direction) From Site Contemporary Trade Directory Entries 263 Name: Coldpack.Co.Uk Ltd A14SW 544 - 458203 Location: The Courtyard, Lockwood Road, Doncaster, South Yorkshire, DN1 2TX (E) 404214 Classification: Medical Equipment Manufacturers Status: Inactive Positional Accuracy: Automatically positioned to the address Contemporary Trade Directory Entries 264 Name: Doncaster Chem Dry A19SW 555 - 458052 Location: Unit 2, Churchill Business Park, Churchill Road, Doncaster, South Yorkshire, (NE) 404625 DN1 2TF Classification: Carpet, Curtain & Upholstery Cleaners Status: Inactive Positional Accuracy: Automatically positioned to the address Contemporary Trade Directory Entries 264 Name: Chemdry A19SW 555 - 458052 Location: Unit 12-14, Churchill Business Park, Churchill Road, Doncaster, South (NE) 404625 Yorkshire, DN1 2TF Classification: Carpet, Curtain & Upholstery Cleaners Status: Inactive Positional Accuracy: Automatically positioned to the address Contemporary Trade Directory Entries 264 Name: Deutsch Technique A19SW 555 - 458052 Location: Unit 12, Churchill Road, Doncaster, South Yorkshire, DN1 2TF (NE) 404625 Classification: Car Dealers Status: Inactive Positional Accuracy: Automatically positioned to the address Contemporary Trade Directory Entries 264 Name: Bulldog Motors A19SW 555 - 458052 Location: Unit 6, Churchill Road, Doncaster, South Yorkshire, DN1 2TF (NE) 404625 Classification: Garage Services Status: Inactive Positional Accuracy: Automatically positioned to the address Contemporary Trade Directory Entries 264 Name: Doncaster Chem-Dry A19SW 555 - 458052 Location: Unit 2, Churchill Business Park, Churchill Road, Doncaster, South Yorkshire, (NE) 404625 DN1 2TF Classification: Carpet, Curtain & Upholstery Cleaners Status: Inactive Positional Accuracy: Automatically positioned to the address Contemporary Trade Directory Entries 264 Name: Hughes Joinery A19SW 597 - 458063 Location: Unit 4, Churchill Business Park, Churchill Road, Doncaster, DN1 2TF (NE) 404673 Classification: Joinery Manufacturers Status: Inactive Positional Accuracy: Automatically positioned to the address Contemporary Trade Directory Entries 265 Name: Mettis Group Ltd A14NW 559 - 458216 Location: Lowther Rd, Sheffield, South Yorkshire, S6 2DR (E) 404285 Classification: Precision Engineers Status: Inactive Positional Accuracy: Manually positioned to the road within the address or location Contemporary Trade Directory Entries 266 Name: G P Services Uk Ltd A18SE 560 - 457978 Location: Riverside House, Churchill Road, Doncaster, South Yorkshire, DN1 2TF (NE) 404693 Classification: Chemical Manufacturers Status: Active Positional Accuracy: Automatically positioned to the address Contemporary Trade Directory Entries 266 Name: Expertprint Ltd A19SW 574 - 458024 Location: Unit 1a, Churchill Building, Churchill Road, Doncaster, DN1 2TF (NE) 404676 Classification: Printers Status: Inactive Positional Accuracy: Automatically positioned to the address Contemporary Trade Directory Entries 267 Name: Nortech Foods Ltd A17SE 565 - 457297 Location: Ings Road, Doncaster, South Yorkshire, DN5 9TL (NW) 404665 Classification: Oils - Edible Status: Active Positional Accuracy: Manually positioned to the road within the address or location Order Number: 242475436_1_1 Date: 12-May-2020 rpr_ec_datasheet v53.0 A Landmark Information Group Service Page 63 of 104 Industrial Land Use Quadrant Estimated Map Reference Details Distance Contact NGR ID (Compass Direction) From Site Contemporary Trade Directory Entries 268 Name: G T Heating A8NE 572 - 457813 Location: 69, Christ Church Road, Doncaster, South Yorkshire, DN1 2QS (S) 403682 Classification: Boilers - Servicing, Replacements & Repairs Status: Inactive Positional Accuracy: Automatically positioned to the address Contemporary Trade Directory Entries 268 Name: B Bostwick A8NE 596 - 457838 Location: 57, Christ Church Road, Doncaster, South Yorkshire, DN1 2QS (S) 403665 Classification: Electrolysis Status: Inactive Positional Accuracy: Automatically positioned to the address Contemporary Trade Directory Entries 269 Name: Deutsch Technique A14NW 574 - 458139 Location: Churchill Rd, Doncaster, S Yorkshire, DN1 2TF (NE) 404548 Classification: Garage Services Status: Inactive Positional Accuracy: Manually positioned to the road within the address or location Contemporary Trade Directory Entries 269 Name: Don Valley Car Repairs A19SW 602 - 458155 Location: 28,Churchill Rd, Doncaster, South Yorkshire, DN1 2TF (NE) 404574 Classification: Car Body Repairs Status: Inactive Positional Accuracy: Manually positioned to the road within the address or location Contemporary Trade Directory Entries 270 Name: Nouveau Fabrics A9NW 579 - 458105 Location: 54-58, Queens Road, Doncaster, South Yorkshire, DN1 2NH (SE) 403863 Classification: Soft Furnishings - Manufacturers Status: Inactive Positional Accuracy: Automatically positioned to the address Contemporary Trade Directory Entries 271 Name: Roman Firework A19SW 580 - 458034 Location: Unit 2,Churchill Building,Churchill Rd, Doncaster, South Yorkshire, DN1 2TF (NE) 404676 Classification: Firework Technicians, Manufacturers & Distribution Status: Inactive Positional Accuracy: Automatically positioned to the address Contemporary Trade Directory Entries 271 Name: Clean & Dry Doncaster A19SW 582 - 458037 Location: Unit 2, Churchill Business Park, Churchill Road, Doncaster, DN1 2TF (NE) 404676 Classification: Carpet, Curtain & Upholstery Cleaners Status: Inactive Positional Accuracy: Automatically positioned to the address Contemporary Trade Directory Entries 271 Name: Air Brake Components Ltd A19SW 604 - 458073 Location: Unit 5, Churchill Building, Churchill Road, Doncaster, DN1 2TF (NE) 404673 Classification: Commercial Vehicle Servicing, Repairs, Parts & Accessories Status: Inactive Positional Accuracy: Automatically positioned to the address Contemporary Trade Directory Entries 271 Name: Venue Merchandise A19SW 607 - 458057 Location: Unit 4, Churchill Business Park, Churchill Road, DONCASTER, South (NE) 404691 Yorkshire, DN1 2TF Classification: Distribution Services Status: Active Positional Accuracy: Automatically positioned to the address Contemporary Trade Directory Entries 271 Name: Expert Print A19SW 625 - 458105 Location: Unit 1/A, Churchill Building, Churchill Road, Doncaster, South Yorkshire, DN1 (NE) 404671 2TF Classification: Printers Status: Inactive Positional Accuracy: Automatically positioned to the address Contemporary Trade Directory Entries 272 Name: Doncaster Accident & Repair Centre A14NW 592 - 458188 Location: 7, Wheatley Hall Road, Doncaster, South Yorkshire, DN2 4LP (NE) 404499 Classification: Car Body Repairs Status: Inactive Positional Accuracy: Automatically positioned in the proximity of the address Order Number: 242475436_1_1 Date: 12-May-2020 rpr_ec_datasheet v53.0 A Landmark Information Group Service Page 64 of 104 Industrial Land Use Quadrant Estimated Map Reference Details Distance Contact NGR ID (Compass Direction) From Site Contemporary Trade Directory Entries 272 Name: Chem-Dry A14NW 592 - 458188 Location: Wheatley Hall Business Centre, Wheatley Hall Road, Doncaster, South (NE) 404499 Yorkshire, DN2 4LP Classification: Carpet, Curtain & Upholstery Cleaners Status: Inactive Positional Accuracy: Automatically positioned in the proximity of the address Contemporary Trade Directory Entries 272 Name: Direct Linen Ltd A14NW 619 - 458221 Location: Wheatley Hall Rd, Doncaster, South Yorkshire, DN2 4LP (NE) 404494 Classification: Laundries & Launderettes Status: Inactive Positional Accuracy: Manually positioned to the road within the address or location Contemporary Trade Directory Entries 273 Name: Danum Blinds A8NE 601 - 457707 Location: 1, Harrington Street, Doncaster, South Yorkshire, DN1 1LX (S) 403634 Classification: Blinds, Awnings & Canopies Status: Active Positional Accuracy: Automatically positioned to the address Contemporary Trade Directory Entries 274 Name: Dulux Decorator Centre A14SW 605 - 458250 Location: 63, Beckett Road, Doncaster, South Yorkshire, DN2 4AD (E) 404104 Classification: Painting & Decorating Supplies Status: Inactive Positional Accuracy: Automatically positioned to the address Contemporary Trade Directory Entries 274 Name: Jones & Newsham A14SW 615 - 458263 Location: 69, Beckett Road, Doncaster, South Yorkshire, DN2 4AD (E) 404114 Classification: Medical & Dental Laboratories Status: Inactive Positional Accuracy: Automatically positioned to the address Contemporary Trade Directory Entries 274 Name: Sugden Gary Recovery A14SW 631 - 458271 Location: 44, Beckett Road, Doncaster, South Yorkshire, DN2 4AD (E) 404076 Classification: Car Breakdown & Recovery Services Status: Inactive Positional Accuracy: Automatically positioned to the address Contemporary Trade Directory Entries 275 Name: A N Electrical A8NE 612 - 457957 Location: 3, Rex Corner, Broxholme Lane, Doncaster, South Yorkshire, DN1 2LP (SE) 403698 Classification: Electrical Engineers Status: Inactive Positional Accuracy: Automatically positioned to the address Contemporary Trade Directory Entries 276 Name: Charlie Browns Autocentres A14NW 623 - 458192 Location: Wheatley Hall Road, Doncaster, South Yorkshire, DN2 4LP (NE) 404556 Classification: Tyre Dealers Status: Inactive Positional Accuracy: Automatically positioned to the address Contemporary Trade Directory Entries 276 Name: Allsports Nutrition A14NW 638 - 458204 Location: Unit 21, Wheatley Hall Business Centre, Wheatley Hall Road, Doncaster, DN2 (NE) 404565 4LP Classification: Food Products - Manufacturers Status: Active Positional Accuracy: Automatically positioned to the address Contemporary Trade Directory Entries 276 Name: Tyre City A14NW 638 - 458205 Location: Wheatley Hall Road, Doncaster, South Yorkshire, DN2 4LP (NE) 404564 Classification: Tyre Dealers Status: Inactive Positional Accuracy: Manually positioned within the geographical locality Contemporary Trade Directory Entries 276 Name: Inpress A14NW 639 - 458205 Location: Unit 26, Wheatley Hall Business Centre, Wheatley Hall Road, Doncaster, DN2 (NE) 404566 4LP Classification: Printers Status: Active Positional Accuracy: Automatically positioned to the address Order Number: 242475436_1_1 Date: 12-May-2020 rpr_ec_datasheet v53.0 A Landmark Information Group Service Page 65 of 104 Industrial Land Use Quadrant Estimated Map Reference Details Distance Contact NGR ID (Compass Direction) From Site Contemporary Trade Directory Entries 276 Name: Professional Wash Room Services Ltd A14NW 639 - 458205 Location: Wheatley Hall Business Centre,Wheatley Hall Rd, Doncaster, South (NE) 404565 Yorkshire, DN2 4LP Classification: Hygiene & Cleansing Services Status: Inactive Positional Accuracy: Automatically positioned to the address Contemporary Trade Directory Entries 276 Name: Powertec Electrical Contractors Ltd A14NW 639 - 458205 Location: Unit 24, Wheatley Hall Business Centre, Wheatley Hall Road, Doncaster, DN2 (NE) 404565 4LP Classification: Electrical Engineers Status: Inactive Positional Accuracy: Automatically positioned to the address Contemporary Trade Directory Entries 277 Name: Mr Print A9NW 627 - 458030 Location: 27, Highfield Road, Doncaster, South Yorkshire, DN1 2LA (SE) 403727 Classification: Printers Status: Inactive Positional Accuracy: Manually positioned to the address or location Contemporary Trade Directory Entries 278 Name: Acacia Foods A12NE 630 - 457080 Location: Ings Rd, Doncaster, South Yorkshire, DN5 9SW (NW) 404478 Classification: Animal By-Products Status: Inactive Positional Accuracy: Manually positioned to the road within the address or location Contemporary Trade Directory Entries 279 Name: Acc Ltd A14NW 637 - 458260 Location: 5-7 Wentworth Rd, Doncaster, South Yorkshire, DN2 4BS (E) 404446 Classification: Car Dealers - Used Status: Inactive Positional Accuracy: Manually positioned to the road within the address or location Contemporary Trade Directory Entries 280 Name: Dekadance A8NE 639 - 457743 Location: 13, Copley Road, Doncaster, South Yorkshire, DN1 2PE (S) 403599 Classification: Record, Tape & CD Manufacturers & Wholesalers Status: Inactive Positional Accuracy: Automatically positioned to the address Contemporary Trade Directory Entries 280 Name: Grice & Wray A8NE 660 - 457762 Location: 24, Copley Road, Doncaster, South Yorkshire, DN1 2PF (S) 403581 Classification: Domestic Appliances - Servicing, Repairs & Parts Status: Inactive Positional Accuracy: Automatically positioned to the address Contemporary Trade Directory Entries 280 Name: Bluemoon Fireworks A8NE 667 - 457749 Location: 18, Copley Road, Doncaster, South Yorkshire, DN1 2PF (S) 403572 Classification: Firework Stockists Status: Inactive Positional Accuracy: Automatically positioned to the address Contemporary Trade Directory Entries 280 Name: Trent'S Shooters Supplies A8NE 674 - 457736 Location: 12, Copley Road, Doncaster, South Yorkshire, DN1 2PF (S) 403564 Classification: Gunsmiths Status: Inactive Positional Accuracy: Automatically positioned to the address Contemporary Trade Directory Entries 280 Name: The Beauty Rooms A8SE 708 - 457769 Location: 23, Nether Hall Road, Doncaster, South Yorkshire, DN1 2PH (S) 403534 Classification: Electrolysis Status: Inactive Positional Accuracy: Automatically positioned to the address Contemporary Trade Directory Entries 281 Name: Active Copier Systems A8NE 644 - 457909 Location: 79, Nether Hall Road, Doncaster, South Yorkshire, DN1 2QA (SE) 403639 Classification: Office Furniture & Equipment Status: Inactive Positional Accuracy: Automatically positioned to the address Order Number: 242475436_1_1 Date: 12-May-2020 rpr_ec_datasheet v53.0 A Landmark Information Group Service Page 66 of 104 Industrial Land Use Quadrant Estimated Map Reference Details Distance Contact NGR ID (Compass Direction) From Site Contemporary Trade Directory Entries 281 Name: Netherhall Plumbing & Heating A8NE 660 - 457874 Location: 61-63, Nether Hall Road, Doncaster, South Yorkshire, DN1 2QA (S) 403608 Classification: Fireplaces & Mantelpieces Status: Inactive Positional Accuracy: Automatically positioned to the address Contemporary Trade Directory Entries 282 Name: A & E Auto A19SW 650 - 458184 Location: Unit 18,Churchill industrial estate,Churchill Rd, Doncaster, South Yorkshire, (NE) 404616 DN1 2TF Classification: Car Body Repairs Status: Inactive Positional Accuracy: Manually positioned to the road within the address or location Contemporary Trade Directory Entries 283 Name: Kian Halal Meat Shop A8NE 656 - 457711 Location: 1, Copley Road, Doncaster, South Yorkshire, DN1 2PE (S) 403579 Classification: Meat - Wholesale Status: Inactive Positional Accuracy: Automatically positioned to the address Contemporary Trade Directory Entries 283 Name: Ackroyds Discount Feeds A8NE 658 - 457696 Location: 18 Market Rd, Doncaster, South Yorkshire, DN1 1LP (S) 403576 Classification: Pet Foods & Animal Feeds Status: Inactive Positional Accuracy: Manually positioned to the road within the address or location Contemporary Trade Directory Entries 284 Name: Lady Buyer A9NW 665 - 458128 Location: 54, Highfield Road, Doncaster, South Yorkshire, DN1 2LF (SE) 403761 Classification: Ironing & Home Laundry Services Status: Inactive Positional Accuracy: Automatically positioned to the address Contemporary Trade Directory Entries 285 Name: Pmr A8NE 666 - 457960 Location: 4, Concorde Mews, Broxholme Lane, Doncaster, South Yorkshire, DN1 2LG (SE) 403638 Classification: Cleaning Services - Domestic Status: Inactive Positional Accuracy: Automatically positioned to the address Contemporary Trade Directory Entries 286 Name: M A D Angling Products A9NW 682 - 458246 Location: 27, St. Marys Road, Doncaster, South Yorkshire, DN1 2NR (SE) 403885 Classification: Fishing & Angling Equipment - Manufacturers & Distributors Status: Inactive Positional Accuracy: Automatically positioned to the address Contemporary Trade Directory Entries 287 Name: Parkway Transport A8SW 683 - 457605 Location: 2, High Fishergate, Doncaster, South Yorkshire, DN1 1QZ (S) 403552 Classification: Road Haulage Services Status: Inactive Positional Accuracy: Automatically positioned to the address Contemporary Trade Directory Entries 287 Name: Wonder Walls A8SW 696 - 457557 Location: 3a, High Fishergate, Doncaster, South Yorkshire, DN1 1QZ (S) 403545 Classification: Painting & Decorating Supplies Status: Inactive Positional Accuracy: Automatically positioned to the address Contemporary Trade Directory Entries 288 Name: C & B A8SW 694 - 457622 Location: Market Pl, Doncaster, South Yorkshire, DN1 1NG (S) 403540 Classification: Packaging & Wrapping Equipment & Supplies Status: Inactive Positional Accuracy: Manually positioned to the road within the address or location Contemporary Trade Directory Entries 288 Name: C & B Co A8SE 714 - 457664 Location: Market Place, Doncaster, South Yorkshire, DN1 1NG (S) 403519 Classification: Packaging & Wrapping Equipment & Supplies Status: Inactive Positional Accuracy: Automatically positioned to the address Order Number: 242475436_1_1 Date: 12-May-2020 rpr_ec_datasheet v53.0 A Landmark Information Group Service Page 67 of 104 Industrial Land Use Quadrant Estimated Map Reference Details Distance Contact NGR ID (Compass Direction) From Site Contemporary Trade Directory Entries 288 Name: Its A Gift A8SE 714 - 457664 Location: Market Place, Doncaster, South Yorkshire, DN1 1NG (S) 403519 Classification: Mirrors & Decorative Glass Status: Inactive Positional Accuracy: Automatically positioned to the address Contemporary Trade Directory Entries 288 Name: Net & Lace Co Ltd A8SE 714 - 457664 Location: Market Place, Doncaster, South Yorkshire, DN1 1NG (S) 403519 Classification: Blinds, Awnings & Canopies Status: Inactive Positional Accuracy: Automatically positioned to the address Contemporary Trade Directory Entries 288 Name: The Foam Centre A8SW 748 - 457656 Location: 22, Market Place, Doncaster, South Yorkshire, DN1 1ND (S) 403485 Classification: Foam Products - Rubber & Plastics Status: Inactive Positional Accuracy: Automatically positioned to the address Contemporary Trade Directory Entries 288 Name: Pas Power A8SW 748 - 457656 Location: 22, Market Place, Doncaster, South Yorkshire, DN1 1ND (S) 403485 Classification: Engineering Services Status: Inactive Positional Accuracy: Manually positioned to the address or location Contemporary Trade Directory Entries 289 Name: Billys Joint Motorcycle Services A8SE 694 - 457811 Location: 39, Nether Hall Road, Doncaster, DN1 2PG (S) 403555 Classification: Motor Cycle Repairs Status: Inactive Positional Accuracy: Automatically positioned to the address Contemporary Trade Directory Entries 290 Name: Toolstation A19SW 702 - 458247 Location: Unit 3, Wheatley Hall Business Centre, Wheatley Hall Road, Doncaster, South (NE) 404617 Yorkshire, DN2 4LP Classification: Builders' Merchants Status: Inactive Positional Accuracy: Automatically positioned to the address Contemporary Trade Directory Entries 290 Name: Kwik Fit A19SW 725 - 458257 Location: Wheatley Hall Road, Doncaster, DN2 4LP (NE) 404643 Classification: Tyre Dealers Status: Active Positional Accuracy: Automatically positioned to the address Contemporary Trade Directory Entries 290 Name: Tyrecity A19SW 739 - 458259 Location: Wheatley Hall Road, Doncaster, DN2 4LP (NE) 404665 Classification: Tyre Dealers Status: Active Positional Accuracy: Automatically positioned to the address Contemporary Trade Directory Entries 291 Name: Blenkinsop Blast Cleaning A7NE 704 - 457287 Location: Greyfriars Road, Doncaster, South Yorkshire, DN1 1QN (SW) 403637 Classification: Blast Cleaning Status: Active Positional Accuracy: Automatically positioned to the address Contemporary Trade Directory Entries 291 Name: Motoworks A7NE 704 - 457287 Location: Greyfriars Road, Doncaster, South Yorkshire, DN1 1QN (SW) 403637 Classification: Garage Services Status: Inactive Positional Accuracy: Automatically positioned to the address Contemporary Trade Directory Entries 291 Name: Disinctive Gates A7NE 720 - 457252 Location: Greyfriars House, Greyfriars Road, Doncaster, South Yorkshire, DN1 1QN (SW) 403640 Classification: Wrought Ironwork Status: Inactive Positional Accuracy: Automatically positioned to the address Order Number: 242475436_1_1 Date: 12-May-2020 rpr_ec_datasheet v53.0 A Landmark Information Group Service Page 68 of 104 Industrial Land Use Quadrant Estimated Map Reference Details Distance Contact NGR ID (Compass Direction) From Site Contemporary Trade Directory Entries 291 Name: Designa Chassis A7NE 722 - 457288 Location: Greyfriars Rd, Doncaster, South Yorkshire, DN1 1QN (SW) 403614 Classification: Garage Services Status: Inactive Positional Accuracy: Manually positioned to the road within the address or location Contemporary Trade Directory Entries 291 Name: J J Mobile Tyre Fitting Service A7NE 733 - 457275 Location: Greyfriars Rd, Doncaster, South Yorkshire, DN1 1QN (SW) 403610 Classification: Tyre Dealers Status: Inactive Positional Accuracy: Manually positioned to the road within the address or location Contemporary Trade Directory Entries 292 Name: M T Motorcycles Ltd A12NW 706 - 456971 Location: Unit 2,Ings Road, Doncaster, South Yorkshire, DN5 9SN (W) 404384 Classification: Motor Cycle Breakers & Dismantlers Status: Inactive Positional Accuracy: Manually positioned to the road within the address or location Contemporary Trade Directory Entries 292 Name: Esco Hydra Uk Ltd A12NW 706 - 456977 Location: Ings Road, Doncaster, South Yorkshire, DN5 9SN (W) 404410 Classification: Cutting Tools & Machinery Status: Active Positional Accuracy: Manually positioned within the geographical locality Contemporary Trade Directory Entries 292 Name: P Taylor A12NW 710 - 456966 Location: Ings Rd, Doncaster, South Yorkshire, DN5 9SN (W) 404380 Classification: French Polishing Status: Inactive Positional Accuracy: Manually positioned to the road within the address or location Contemporary Trade Directory Entries 292 Name: P D M Group A12NW 717 - 456958 Location: Ings rd, Doncaster, South Yorkshire, DN5 9TL (W) 404377 Classification: Animal By-Products Status: Inactive Positional Accuracy: Manually positioned to the road within the address or location Contemporary Trade Directory Entries 292 Name: Ilcamano A12NW 736 - 456939 Location: Flat 1, 1, Ings Road, Doncaster, DN5 9SN (W) 404378 Classification: Fireplaces & Mantelpieces Status: Active Positional Accuracy: Automatically positioned to the address Contemporary Trade Directory Entries 292 Name: A Ashley A12NW 736 - 456939 Location: Unit 2, Ings Road, Doncaster, South Yorkshire, DN5 9SN (W) 404378 Classification: French Polishing Status: Inactive Positional Accuracy: Automatically positioned to the address Contemporary Trade Directory Entries 292 Name: Paul Taylor A12NW 736 - 456939 Location: Unit 1, Ings Road, Doncaster, South Yorkshire, DN5 9SN (W) 404378 Classification: French Polishing Status: Inactive Positional Accuracy: Automatically positioned to the address Contemporary Trade Directory Entries 293 Name: South Yorkshire Tyre Centre Ltd A14SE 706 - 458362 Location: 52, Beckett Road, Doncaster, South Yorkshire, DN2 4AJ (E) 404161 Classification: Tyre Dealers Status: Active Positional Accuracy: Automatically positioned to the address Contemporary Trade Directory Entries 294 Name: Willow Bridge Caravan Site A12SW 721 - 456962 Location: 61, Willow Bridge Caravan Site, Doncaster, South Yorkshire, DN5 9AF (W) 404054 Classification: Mechanical Engineers Status: Inactive Positional Accuracy: Automatically positioned to the address Contemporary Trade Directory Entries 295 Name: T & S Pet Foods A8SW 743 - 457611 Location: 11 goosehill market, corn exchange, Doncaster, South Yorkshire, DN1 1LP (S) 403492 Classification: Pet Foods & Animal Feeds Status: Inactive Positional Accuracy: Manually positioned within the geographical locality Order Number: 242475436_1_1 Date: 12-May-2020 rpr_ec_datasheet v53.0 A Landmark Information Group Service Page 69 of 104 Industrial Land Use Quadrant Estimated Map Reference Details Distance Contact NGR ID (Compass Direction) From Site Contemporary Trade Directory Entries 295 Name: Sayer A8SW 781 - 457606 Location: Exchange Buildings,unit 3,4 Market Pl, Doncaster, South Yorkshire, DN1 1NF (S) 403454 Classification: Carpets & Rugs - Manufacturers Status: Inactive Positional Accuracy: Manually positioned to the address or location Contemporary Trade Directory Entries 296 Name: Alan Moston Stained Glass A8SE 747 - 457771 Location: 10 Nether Hall Rd, Doncaster, South Yorkshire, DN1 2PW (S) 403494 Classification: Stained Glass Designers & Producers Status: Inactive Positional Accuracy: Manually positioned to the address or location Contemporary Trade Directory Entries 296 Name: Doncaster Blast Cleaning & Polishing A8SE 747 - 457770 Location: 10-12 Nether Hall Rd, Centre, Doncaster, South Yorkshire, DN1 2PW (S) 403494 Classification: Blast Cleaning Status: Inactive Positional Accuracy: Manually positioned to the address or location Contemporary Trade Directory Entries 297 Name: Aa Service Centre A7NE 758 - 457029 Location: North Bridge Road, Doncaster, South Yorkshire, DN5 9AN (SW) 403815 Classification: Garage Services Status: Inactive Positional Accuracy: Automatically positioned to the address Contemporary Trade Directory Entries 297 Name: Leisure Time Sunbeds Ltd A7NE 795 - 456991 Location: 32, North Bridge Road, Doncaster, South Yorkshire, DN5 9AN (SW) 403804 Classification: Manufacturers Status: Inactive Positional Accuracy: Automatically positioned in the proximity of the address Contemporary Trade Directory Entries 298 Name: Croda Application Chemicals Ltd A19SW 766 - 458197 Location: Churchill Road, Doncaster, South Yorkshire, DN1 2TH (NE) 404779 Classification: Chemical Manufacturers Status: Inactive Positional Accuracy: Automatically positioned to the address Contemporary Trade Directory Entries 299 Name: Centurion A12SW 779 - 456882 Location: Hunt Lane, Doncaster, South Yorkshire, DN5 9SH (W) 404229 Classification: Hardware Status: Active Positional Accuracy: Manually positioned within the geographical locality Contemporary Trade Directory Entries 299 Name: Spectrum Signs Ltd A12SW 781 - 456880 Location: Hunt Lane, Doncaster, South Yorkshire, DN5 9SH (W) 404223 Classification: Printers Status: Inactive Positional Accuracy: Manually positioned within the geographical locality Contemporary Trade Directory Entries 299 Name: James Lewis Hardware Ltd A12SW 811 - 456851 Location: Hunt La, Doncaster, South Yorkshire, DN5 9SH (W) 404192 Classification: Hardware Status: Inactive Positional Accuracy: Manually positioned to the road within the address or location Contemporary Trade Directory Entries 300 Name: Fosters Damp Control A9NW 783 - 458184 Location: 4, Kings Road, Doncaster, South Yorkshire, DN1 2LX (SE) 403651 Classification: Damp & Dry Rot Control Status: Inactive Positional Accuracy: Automatically positioned to the address Contemporary Trade Directory Entries 301 Name: Northside Car & Commercial Ltd A19SW 793 - 458298 Location: Northside Car and Commercial, Wheatley Hall Road, Doncaster, DN2 4LP (NE) 404703 Classification: Car Dealers Status: Active Positional Accuracy: Automatically positioned to the address Contemporary Trade Directory Entries 301 Name: Dupont Nylon Uk Ltd A19SE 841 - 458340 Location: Doncaster Works,Wheatley Hall Rd, Doncaster, South Yorkshire, DN2 4LT (NE) 404727 Classification: Chemicals & Allied Products Status: Inactive Positional Accuracy: Manually positioned to the road within the address or location Order Number: 242475436_1_1 Date: 12-May-2020 rpr_ec_datasheet v53.0 A Landmark Information Group Service Page 70 of 104 Industrial Land Use Quadrant Estimated Map Reference Details Distance Contact NGR ID (Compass Direction) From Site Contemporary Trade Directory Entries 302 Name: Prontaprint A8SE 798 - 457708 Location: Britannia Buildings, 72, Silver Street, Doncaster, South Yorkshire, DN1 1HT (S) 403437 Classification: Printers Status: Inactive Positional Accuracy: Automatically positioned to the address Contemporary Trade Directory Entries 302 Name: Doncaster Chair Centre A8SE 798 - 457748 Location: 1a-1b, East Laith Gate, Doncaster, South Yorkshire, DN1 1JG (S) 403440 Classification: Stairlifts - Manufacturers & Installers Status: Inactive Positional Accuracy: Automatically positioned to the address Contemporary Trade Directory Entries 302 Name: Printing.Com A8SE 804 - 457711 Location: 70, Silver Street, Doncaster, South Yorkshire, DN1 1HT (S) 403431 Classification: Printers Status: Inactive Positional Accuracy: Automatically positioned to the address Contemporary Trade Directory Entries 303 Name: Able Mobility Ltd A8SE 805 - 457759 Location: 1c, East Laith Gate, Doncaster, South Yorkshire, DN1 1JG (S) 403434 Classification: Disability Equipment - Manufacturers & Suppliers Status: Inactive Positional Accuracy: Automatically positioned to the address Contemporary Trade Directory Entries 304 Name: Jet Power A8SE 820 - 457907 Location: 50, Park Road, Doncaster, South Yorkshire, DN1 2QH (S) 403451 Classification: Cleaning Services - Commercial Status: Inactive Positional Accuracy: Automatically positioned to the address Contemporary Trade Directory Entries 305 Name: Best Buy Today A8SE 836 - 457808 Location: 19, East Laith Gate, Doncaster, South Yorkshire, DN1 1JG (S) 403410 Classification: Electrical Goods Sales, Manufacturers & Wholesalers Status: Inactive Positional Accuracy: Automatically positioned to the address Contemporary Trade Directory Entries 305 Name: The Print Room A8SE 839 - 457790 Location: 17, East Laith Gate, Doncaster, South Yorkshire, DN1 1JG (S) 403404 Classification: Printers Status: Inactive Positional Accuracy: Manually positioned to the address or location Contemporary Trade Directory Entries 306 Name: Magi-Clean A9SW 838 - 458106 Location: 66, Broxholme Lane, Doncaster, South Yorkshire, DN1 2LW (SE) 403524 Classification: Carpet, Curtain & Upholstery Cleaners Status: Inactive Positional Accuracy: Automatically positioned to the address Contemporary Trade Directory Entries 307 Name: Halfords Autocentre A7NW 844 - 456899 Location: Doncaster, DN5 9AN (SW) 403870 Classification: Garage Services Status: Active Positional Accuracy: Automatically positioned to the address Contemporary Trade Directory Entries 308 Name: Lynx Black Belt Leadership Academy A8SE 856 - 457666 Location: 33a, Market Place, Doncaster, South Yorkshire, DN1 1NE (S) 403377 Classification: Sports Equipment Manufacturers & Distributors Status: Inactive Positional Accuracy: Automatically positioned to the address Contemporary Trade Directory Entries 309 Name: Burrow'S Motor Company A19SW 859 - 458293 Location: Quest Park, Wheatley Hall Road, Doncaster, DN2 4LT (NE) 404812 Classification: Car Dealers Status: Active Positional Accuracy: Automatically positioned to the address Contemporary Trade Directory Entries 310 Name: Iron Craft A8SE 860 - 457742 Location: 31, Frances Street, Doncaster, DN1 1JB (S) 403377 Classification: Tungsten Tool Manufacturers & Distributors Status: Active Positional Accuracy: Automatically positioned to the address Order Number: 242475436_1_1 Date: 12-May-2020 rpr_ec_datasheet v53.0 A Landmark Information Group Service Page 71 of 104 Industrial Land Use Quadrant Estimated Map Reference Details Distance Contact NGR ID (Compass Direction) From Site Contemporary Trade Directory Entries 310 Name: Ironcraft A8SE 860 - 457742 Location: 31, Frances Street, Doncaster, South Yorkshire, DN1 1JB (S) 403377 Classification: Wrought Ironwork Status: Inactive Positional Accuracy: Automatically positioned to the address Contemporary Trade Directory Entries 310 Name: Ironcraft A8SE 860 - 457742 Location: 31, Frances Street, Doncaster, South Yorkshire, DN1 1JB (S) 403377 Classification: Wrought Ironwork Status: Inactive Positional Accuracy: Automatically positioned to the address Contemporary Trade Directory Entries 311 Name: Barton Blinds A19NW 863 - 458171 Location: Unit 3a, Marrtree Business Park, Silk Road, Doncaster, DN2 4BQ (NE) 404927 Classification: Blinds, Awnings & Canopies Status: Active Positional Accuracy: Automatically positioned to the address Contemporary Trade Directory Entries 311 Name: The Chefs Kitchen A19NW 905 - 458210 Location: Unit 3d,Silk Road, Doncaster, South Yorkshire, DN2 4BQ (NE) 404951 Classification: Food Products - Manufacturers Status: Active Positional Accuracy: Manually positioned to the address or location Contemporary Trade Directory Entries 312 Name: Elite Coach Conversions A7NE 867 - 456986 Location: Marshgate, Doncaster, South Yorkshire, DN5 8AF (SW) 403688 Classification: Car Customisation & Conversion Specialists Status: Inactive Positional Accuracy: Manually positioned to the road within the address or location Contemporary Trade Directory Entries 312 Name: Serck Intertruck A7NW 869 - 456982 Location: Marshgate, Doncaster, South Yorkshire, DN5 8AF (SW) 403690 Classification: Car Radiator Servicing & Repairs Status: Inactive Positional Accuracy: Manually positioned to the road within the address or location Contemporary Trade Directory Entries 312 Name: High Green Fencing A7NW 869 - 456982 Location: Unit 15,Marshgate, Doncaster, South Yorkshire, DN5 8AF (SW) 403690 Classification: Fencing Manufacturers Status: Inactive Positional Accuracy: Manually positioned to the road within the address or location Contemporary Trade Directory Entries 312 Name: Spray-Tec A7NW 873 - 456968 Location: Unit 1-3 Rope Walk,Marshgate, Doncaster, South Yorkshire, DN5 8AF (SW) 403702 Classification: Car Painters & Sprayers Status: Inactive Positional Accuracy: Manually positioned to the road within the address or location Contemporary Trade Directory Entries 312 Name: Autobodies A7NW 874 - 456962 Location: Marshgate Indust Est,Marshgate, Doncaster, South Yorkshire, DN5 8AF (SW) 403708 Classification: Car Body Repairs Status: Inactive Positional Accuracy: Manually positioned to the road within the address or location Contemporary Trade Directory Entries 312 Name: Ashcroft J & J A7NW 881 - 456943 Location: Unit 3 Rope Walk, Marshgate, Doncaster, South Yorkshire, DN5 8AF (SW) 403722 Classification: Screen Process Printers Status: Inactive Positional Accuracy: Manually positioned to the road within the address or location Contemporary Trade Directory Entries 312 Name: J & S Accessories A7NW 912 - 456948 Location: Marshgate, Doncaster, South Yorkshire, DN5 8AF (SW) 403663 Classification: Cycle Accessories, Manufacturers & Wholesalers Status: Inactive Positional Accuracy: Automatically positioned to the address Contemporary Trade Directory Entries 313 Name: Age Concern A9NE 880 - 458448 Location: 109, Thorne Road, Doncaster, South Yorkshire, DN2 5BE (SE) 403843 Classification: Cleaning Services - Domestic Status: Inactive Positional Accuracy: Automatically positioned to the address Order Number: 242475436_1_1 Date: 12-May-2020 rpr_ec_datasheet v53.0 A Landmark Information Group Service Page 72 of 104 Industrial Land Use Quadrant Estimated Map Reference Details Distance Contact NGR ID (Compass Direction) From Site Contemporary Trade Directory Entries 314 Name: Copyworld Ltd A8SW 884 - 457645 Location: 29-31, Bowers Fold, Doncaster, South Yorkshire, DN1 1HF (S) 403350 Classification: T-Shirts Status: Inactive Positional Accuracy: Automatically positioned to the address Contemporary Trade Directory Entries 314 Name: Soul Foods A8SW 894 - 457581 Location: 28, Scot Lane, Doncaster, South Yorkshire, DN1 1ES (S) 403343 Classification: Heat Treatment - Metals Status: Inactive Positional Accuracy: Automatically positioned to the address Contemporary Trade Directory Entries 314 Name: P & J Textiles A8SW 904 - 457626 Location: 11, Bowers Fold, Doncaster, South Yorkshire, DN1 1HF (S) 403329 Classification: Textile Manufacturing Status: Inactive Positional Accuracy: Automatically positioned to the address Contemporary Trade Directory Entries 314 Name: The Yorkshire Pie House A8SW 939 - 457642 Location: 17, Silver Street, Doncaster, DN1 1HG (S) 403294 Classification: Food Products - Manufacturers Status: Inactive Positional Accuracy: Automatically positioned to the address Contemporary Trade Directory Entries 315 Name: Eurolec A14SE 884 - 458532 Location: 11, Axholme Road, Doncaster, South Yorkshire, DN2 4AN (E) 404088 Classification: Domestic Appliances - Servicing, Repairs & Parts Status: Inactive Positional Accuracy: Automatically positioned to the address Contemporary Trade Directory Entries 316 Name: Klick A8SW 885 - 457443 Location: 36, Baxter Gate, Doncaster, South Yorkshire, DN1 1LD (S) 403376 Classification: Photographic Processors Status: Inactive Positional Accuracy: Automatically positioned to the address Contemporary Trade Directory Entries 316 Name: Dixons A8SW 908 - 457473 Location: 8, High Street, DONCASTER, South Yorkshire, DN1 1ED (S) 403344 Classification: Electrical Goods Sales, Manufacturers & Wholesalers Status: Inactive Positional Accuracy: Automatically positioned to the address Contemporary Trade Directory Entries 317 Name: Currys.Digital A8SW 885 - 457493 Location: 8, High Street, Doncaster, South Yorkshire, DN1 1ED (S) 403364 Classification: Electrical Goods Sales, Manufacturers & Wholesalers Status: Inactive Positional Accuracy: Automatically positioned to the address Contemporary Trade Directory Entries 317 Name: Currys.Digital A8SW 922 - 457476 Location: 8, High Street, Doncaster, DN1 1ED (S) 403330 Classification: Electrical Goods Sales, Manufacturers & Wholesalers Status: Inactive Positional Accuracy: Automatically positioned to the address Contemporary Trade Directory Entries 317 Name: Max Spielmann A8SW 922 - 457495 Location: 11, High Street, Doncaster, South Yorkshire, DN1 1ED (S) 403326 Classification: Photographic Processors Status: Inactive Positional Accuracy: Automatically positioned to the address Contemporary Trade Directory Entries 318 Name: D & L Bubble Packaging Ltd A19NW 900 - 458241 Location: Unit 4a, Marrtree Business Park, Silk Road, Doncaster, DN2 4BQ (NE) 404919 Classification: Packaging Materials Manufacturers & Suppliers Status: Active Positional Accuracy: Automatically positioned to the address Contemporary Trade Directory Entries 319 Name: Bentley Service Station A12NW 909 - 456753 Location: Bentley Road, Doncaster, South Yorkshire, DN5 9SA (W) 404281 Classification: Petrol Filling Stations Status: Inactive Positional Accuracy: Automatically positioned to the address Order Number: 242475436_1_1 Date: 12-May-2020 rpr_ec_datasheet v53.0 A Landmark Information Group Service Page 73 of 104 Industrial Land Use Quadrant Estimated Map Reference Details Distance Contact NGR ID (Compass Direction) From Site Contemporary Trade Directory Entries 319 Name: Shell Service Station A12NW 910 - 456752 Location: Bentley Road, Doncaster, DN5 9SA (W) 404272 Classification: Petrol Filling Stations Status: Active Positional Accuracy: Automatically positioned to the address Contemporary Trade Directory Entries 320 Name: Akorn Dinghy Repair & Chandlery A19SE 911 - 458461 Location: 18, Hardy Road, Doncaster, South Yorkshire, DN2 4DW (NE) 404667 Classification: Boatbuilders & Repairers Status: Inactive Positional Accuracy: Automatically positioned to the address Contemporary Trade Directory Entries 321 Name: Flip Out Doncaster A8SW 914 - 457367 Location: St. Sepulchre Gate, Doncaster, DN1 1SW (S) 403368 Classification: Sports Equipment Manufacturers & Distributors Status: Active Positional Accuracy: Automatically positioned to the address Contemporary Trade Directory Entries 321 Name: Brighthouse A8SW 934 - 457377 Location: 6, St. Sepulchre Gate, Doncaster, DN1 1QG (S) 403343 Classification: Electrical Goods Sales, Manufacturers & Wholesalers Status: Active Positional Accuracy: Automatically positioned to the address Contemporary Trade Directory Entries 322 Name: Dixon Corporate Direct A7NW 915 - 456851 Location: Marshgate, Doncaster, South Yorkshire, DN5 8AF (SW) 403807 Classification: Car Dealers Status: Inactive Positional Accuracy: Automatically positioned to the address Contemporary Trade Directory Entries 323 Name: Jewson A7NW 920 - 456982 Location: Former Sjs Joinery, Marshgate, Doncaster, DN5 8AF (SW) 403612 Classification: Builders' Merchants Status: Active Positional Accuracy: Automatically positioned to the address Contemporary Trade Directory Entries 324 Name: Doncaster Audi A19SE 923 - 458336 Location: Wheatley Hall Road, Doncaster, South Yorkshire, DN2 4LT (NE) 404861 Classification: Car Dealers Status: Active Positional Accuracy: Automatically positioned to the address Contemporary Trade Directory Entries 325 Name: Print Busters A12NW 928 - 456766 Location: 145, Bentley Road, Doncaster, South Yorkshire, DN5 9TB (W) 404479 Classification: Printers Status: Inactive Positional Accuracy: Automatically positioned to the address Contemporary Trade Directory Entries 326 Name: Exclusive Mirrors A8SE 929 - 457910 Location: 7-9 Thorne Rd, Doncaster, South Yorkshire, DN1 2HJ (S) 403338 Classification: Mirrors & Decorative Glass Status: Inactive Positional Accuracy: Manually positioned to the address or location Contemporary Trade Directory Entries 327 Name: Elite Coach Conversions Ltd A7NW 949 - 456847 Location: Danum College, Marshgate, Doncaster, DN5 8AF (SW) 403745 Classification: Car Body Repairs Status: Inactive Positional Accuracy: Automatically positioned to the address Contemporary Trade Directory Entries 328 Name: Maplin Electronics Ltd A12SW 949 - 456715 Location: Centurion Way, Doncaster, DN5 9TP (W) 404161 Classification: Electrical Goods Sales, Manufacturers & Wholesalers Status: Inactive Positional Accuracy: Automatically positioned to the address Order Number: 242475436_1_1 Date: 12-May-2020 rpr_ec_datasheet v53.0 A Landmark Information Group Service Page 74 of 104 Industrial Land Use Quadrant Estimated Map Reference Details Distance Contact NGR ID (Compass Direction) From Site Contemporary Trade Directory Entries 329 Name: The Fragrance Shop A7SE 960 - 457205 Location: 29, Upper North Mall, Frenchgate Centre, Doncaster, South Yorkshire, DN1 (SW) 403388 1LJ Classification: Perfume Suppliers Status: Inactive Positional Accuracy: Automatically positioned to the address Contemporary Trade Directory Entries 330 Name: Shopmobility A7SE 965 - 457316 Location: 04 Northmile Gallery, Doncaster, South Yorkshire, DN1 1SW (S) 403332 Classification: Disability Equipment - Manufacturers & Suppliers Status: Inactive Positional Accuracy: Manually positioned within the geographical locality Contemporary Trade Directory Entries 330 Name: Domo A8SW 988 - 457349 Location: Unit 4 Frenchgate Interchange, Doncaster, South Yorkshire, DN1 1SW (S) 403295 Classification: Bags, Belts & Accessories - Manufacturers & Suppliers Status: Active Positional Accuracy: Manually positioned to the address or location Contemporary Trade Directory Entries 331 Name: Phone World A8SW 965 - 457626 Location: 5, Silver Street, Doncaster, DN1 1HG (S) 403269 Classification: Mobile Phone Accessories and Car Kits Status: Active Positional Accuracy: Automatically positioned to the address Contemporary Trade Directory Entries 332 Name: Hayselden Skoda A7NW 970 - 456756 Location: York Road, Doncaster, South Yorkshire, DN5 8AN (W) 403883 Classification: Car Dealers Status: Inactive Positional Accuracy: Automatically positioned to the address Contemporary Trade Directory Entries 332 Name: Hayselden Skoda A7NW 970 - 456756 Location: York Road, Doncaster, South Yorkshire, DN5 8AN (W) 403883 Classification: Car Customisation & Conversion Specialists Status: Active Positional Accuracy: Automatically positioned to the address Contemporary Trade Directory Entries 332 Name: T Hayselden (Doncaster) Ltd A7NW 980 - 456747 Location: York Road, Doncaster, DN5 8AN (W) 403879 Classification: Car Dealers Status: Inactive Positional Accuracy: Automatically positioned to the address Contemporary Trade Directory Entries 333 Name: M G Fabrication A19SE 976 - 458495 Location: Unit 18 Churchill Industrial Estate, Doncaster, South Yorkshire, DN2 4ER (NE) 404738 Classification: Wrought Ironwork Status: Inactive Positional Accuracy: Manually positioned to the road within the address or location Contemporary Trade Directory Entries 334 Name: Airtech (Mining Systems) Ltd A8SW 977 - 457396 Location: 17, St. Sepulchre Gate, Doncaster, South Yorkshire, DN1 1TD (S) 403292 Classification: Coal Mining Status: Inactive Positional Accuracy: Automatically positioned to the address Contemporary Trade Directory Entries 334 Name: Precision Jewellery Ltd A8SW 977 - 457391 Location: Manfield Chambers, 17, St. Sepulchre Gate, Doncaster, DN1 1TD (S) 403294 Classification: Jewellery Manufacturers & Repairers Status: Inactive Positional Accuracy: Automatically positioned to the address Contemporary Trade Directory Entries 334 Name: G French Jewellery A8SW 978 - 457401 Location: 17 St Sepulchre Gate, Doncaster, South Yorkshire, DN1 1TD (S) 403290 Classification: Jewellery Manufacturers & Repairers Status: Active Positional Accuracy: Automatically positioned to the address Order Number: 242475436_1_1 Date: 12-May-2020 rpr_ec_datasheet v53.0 A Landmark Information Group Service Page 75 of 104 Industrial Land Use Quadrant Estimated Map Reference Details Distance Contact NGR ID (Compass Direction) From Site Contemporary Trade Directory Entries 335 Name: Chris Oakley A14NE 979 - 458609 Location: 56, Woodhouse Road, Doncaster, South Yorkshire, DN2 4DF (E) 404471 Classification: Bath Resurfacing Status: Inactive Positional Accuracy: Automatically positioned to the address Contemporary Trade Directory Entries 335 Name: One Stop Gas Shop A14NE 985 - 458616 Location: 54, Woodhouse Road, Doncaster, South Yorkshire, DN2 4DF (E) 404468 Classification: Central Heating Supplies & Equipment Status: Inactive Positional Accuracy: Automatically positioned to the address Contemporary Trade Directory Entries 336 Name: Riverside Racing & Restoration A7NW 985 - 456856 Location: Unit 14, Marshgate, Doncaster, DN5 8AF (SW) 403665 Classification: Classic Car Specialists Status: Inactive Positional Accuracy: Automatically positioned to the address Contemporary Trade Directory Entries 337 Name: Kwikprint A8SE 988 - 457705 Location: 9, Hall Gate, Doncaster, South Yorkshire, DN1 3LU (S) 403246 Classification: Copying & Duplicating Services Status: Inactive Positional Accuracy: Automatically positioned to the address Contemporary Trade Directory Entries 337 Name: J F Monks (Doncaster) Ltd A8SE 988 - 457705 Location: 9, Hall Gate, Doncaster, South Yorkshire, DN1 3LU (S) 403246 Classification: Printers Status: Inactive Positional Accuracy: Automatically positioned to the address Contemporary Trade Directory Entries 338 Name: Johnson Cleaners Ltd A8SW 988 - 457543 Location: 41, High Street, Doncaster, South Yorkshire, DN1 1DE (S) 403252 Classification: Dry Cleaners Status: Inactive Positional Accuracy: Automatically positioned to the address Contemporary Trade Directory Entries 339 Name: Roshels Ceramic Restoration A14SE 993 - 458622 Location: Thorne Rd, Doncaster, South Yorkshire, DN2 5BQ (E) 403988 Classification: Antiques - Repairing & Restoring Status: Inactive Positional Accuracy: Manually positioned to the road within the address or location Fuel Station Entries 340 Name: Doncaster St Georges Service Station A8NE 456 - 457698 Location: Church Way , , Doncaster, South Yorkshire, DN1 2RE (S) 403779 Brand: Low Prices Always Premises Type: Petrol Station Status: Open Positional Accuracy: Automatically positioned to the address Fuel Station Entries 341 Name: Bentley Service Station A12NW 909 - 456753 Location: Bentley Road , , Doncaster, South Yorkshire, DN5 9SA (W) 404281 Brand: SHELL Premises Type: Petrol Station Status: Open Positional Accuracy: Manually positioned to the address or location Points of Interest - Commercial Services 342 Name: C F Booth Doncaster Ltd A13NE 71 9 457729 Location: Wharf Road, Doncaster, DN1 2ST (E) 404249 Category: Recycling Services Class Code: Scrap Metal Merchants Positional Accuracy: Positioned to address or location Points of Interest - Commercial Services 342 Name: C F Booth (Doncaster) Ltd A13NE 72 9 457730 Location: Wharf Road, Doncaster, DN1 2ST (E) 404250 Category: Recycling Services Class Code: Scrap Metal Merchants Positional Accuracy: Positioned to address or location Order Number: 242475436_1_1 Date: 12-May-2020 rpr_ec_datasheet v53.0 A Landmark Information Group Service Page 76 of 104 Industrial Land Use Quadrant Estimated Map Reference Details Distance Contact NGR ID (Compass Direction) From Site Points of Interest - Commercial Services 342 Name: Scrap Yard A13NE 90 9 457728 Location: DN1 (NE) 404291 Category: Recycling Services Class Code: Scrap Metal Merchants Positional Accuracy: Positioned to address or location Points of Interest - Commercial Services 342 Name: D & H Autos A13NE 147 9 457796 Location: 4 Victoria Mill Business Park, Wharf Road, Doncaster, DN1 2ST (E) 404287 Category: Repair and Servicing Class Code: Vehicle Repair, Testing and Servicing Positional Accuracy: Positioned to address or location Points of Interest - Commercial Services 343 Name: M & G Autos Ltd A13NE 165 9 457814 Location: 1 Victoria Mill Business Park, Wharf Road, Doncaster, DN1 2ST (E) 404290 Category: Repair and Servicing Class Code: Vehicle Repair, Testing and Servicing Positional Accuracy: Positioned to address or location Points of Interest - Commercial Services 343 Name: M & G Ltd A13NE 165 9 457814 Location: 1 Victoria Mill Business Park, Wharf Road, Doncaster, DN1 2ST (E) 404291 Category: Repair and Servicing Class Code: Vehicle Repair, Testing and Servicing Positional Accuracy: Positioned to address or location Points of Interest - Commercial Services 343 Name: M & G Auto Electrics A13NE 165 9 457814 Location: 1 Victoria Mill Business Park, Wharf Road, Doncaster, DN1 2ST (E) 404291 Category: Repair and Servicing Class Code: Vehicle Repair, Testing and Servicing Positional Accuracy: Positioned to address or location Points of Interest - Commercial Services 343 Name: M & G Auto Electrics Doncaster Ltd A13NE 165 9 457814 Location: 1 Victoria Mill Business Park, Wharf Road, Doncaster, DN1 2ST (E) 404291 Category: Repair and Servicing Class Code: Vehicle Repair, Testing and Servicing Positional Accuracy: Positioned to address or location Points of Interest - Commercial Services 344 Name: Fivestar Garage Doncaster Ltd A13NE 243 9 457809 Location: Milethorn Lane, Doncaster, DN1 2SU (NE) 404424 Category: Repair and Servicing Class Code: Vehicle Repair, Testing and Servicing Positional Accuracy: Positioned to address or location Points of Interest - Commercial Services 345 Name: A S Sheetmetal A13NE 341 9 457964 Location: Unit 6-8 Polydon Park, Milethorn Lane, Doncaster, DN1 2SU (NE) 404386 Category: Construction Services Class Code: Metalworkers Including Blacksmiths Positional Accuracy: Positioned to address or location Points of Interest - Commercial Services 346 Name: D S Automotive A14NW 358 9 458016 Location: 1 Milethorn Lane, Doncaster, DN1 2SU (E) 404269 Category: Repair and Servicing Class Code: Vehicle Repair, Testing and Servicing Positional Accuracy: Positioned to address or location Points of Interest - Commercial Services 347 Name: Donny Hand Car Wash A14SW 421 9 458007 Location: 2 Charles Street, Doncaster, DN1 2RZ (SE) 403995 Category: Personal, Consumer and other Services Class Code: Vehicle Cleaning Services Positional Accuracy: Positioned to address or location Points of Interest - Commercial Services 347 Name: National Tyres and Autocare A13SE 427 9 457990 Location: Holmes Garage, Holmes Market, Doncaster, DN1 2ND (SE) 403963 Category: Repair and Servicing Class Code: Vehicle Repair, Testing and Servicing Positional Accuracy: Positioned to address or location Points of Interest - Commercial Services 347 Name: National Tyres and Autocare A13SE 427 9 457990 Location: Holmes Garage, Holmes Market, Doncaster, DN1 2ND (SE) 403963 Category: Repair and Servicing Class Code: Vehicle Repair, Testing and Servicing Positional Accuracy: Positioned to address or location Order Number: 242475436_1_1 Date: 12-May-2020 rpr_ec_datasheet v53.0 A Landmark Information Group Service Page 77 of 104 Industrial Land Use Quadrant Estimated Map Reference Details Distance Contact NGR ID (Compass Direction) From Site Points of Interest - Commercial Services 348 Name: National Tyres and Autocare A14SW 440 9 458001 Location: Holmes Garage, Charles Street, Doncaster, DN1 2ND (SE) 403955 Category: Repair and Servicing Class Code: Vehicle Repair, Testing and Servicing Positional Accuracy: Positioned to address or location Points of Interest - Commercial Services 348 Name: D & B Mechanics A8NE 489 9 457953 Location: Unit 8 Athron Industrial Estate, Holmes Market, Doncaster, DN1 2NU (SE) 403841 Category: Repair and Servicing Class Code: Vehicle Repair, Testing and Servicing Positional Accuracy: Positioned to address or location Points of Interest - Commercial Services 348 Name: Body Shop (UK) A9NW 498 9 458004 Location: Unit 14A Athron Industrial Estate, Holmes Market, Doncaster, DN1 2NU (SE) 403873 Category: Repair and Servicing Class Code: Vehicle Repair, Testing and Servicing Positional Accuracy: Positioned to address or location Points of Interest - Commercial Services 348 Name: Say Yes Tyres A9NW 498 9 458004 Location: Unit 7 Athron Industrial Estate, Holmes Market, Doncaster, DN1 2NU (SE) 403873 Category: Repair and Servicing Class Code: Vehicle Repair, Testing and Servicing Positional Accuracy: Positioned to address or location Points of Interest - Commercial Services 348 Name: Say Yes Tyres A9NW 498 9 458004 Location: Unit 7 Athron Industrial Estate, Holmes Market, Doncaster, DN1 2NU (SE) 403873 Category: Repair and Servicing Class Code: Vehicle Repair, Testing and Servicing Positional Accuracy: Positioned to address or location Points of Interest - Commercial Services 349 Name: Archway Motors A14NW 516 9 458081 Location: Unit 4 Leger Business Park, Churchill Road, Doncaster, DN1 2TF (NE) 404530 Category: Repair and Servicing Class Code: Vehicle Repair, Testing and Servicing Positional Accuracy: Positioned to address or location Points of Interest - Commercial Services 350 Name: German Car Clinic A14NW 528 9 458075 Location: Unit 28 Leger Business Park, Churchill Road, Doncaster, DN1 2TF (NE) 404558 Category: Repair and Servicing Class Code: Vehicle Repair, Testing and Servicing Positional Accuracy: Positioned to address or location Points of Interest - Commercial Services 350 Name: D & H Auto's A19SW 555 9 458052 Location: Unit 6/9, Churchill Road, Doncaster, DN1 2TF (NE) 404625 Category: Repair and Servicing Class Code: Vehicle Repair, Testing and Servicing Positional Accuracy: Positioned to address or location Points of Interest - Commercial Services 350 Name: Doncaster Towbars A19SW 574 9 458024 Location: Unit 1a Churchill Building, Churchill Road, Doncaster, DN1 2TF (NE) 404676 Category: Repair and Servicing Class Code: Vehicle Repair, Testing and Servicing Positional Accuracy: Positioned to address or location Points of Interest - Commercial Services 350 Name: Venue Merchandise A19SW 607 9 458057 Location: Unit 4 Churchill Business Park, Churchill Road, Doncaster, DN1 2TF (NE) 404691 Category: Transport, Storage and Delivery Class Code: Distribution and Haulage Positional Accuracy: Positioned to address or location Points of Interest - Commercial Services 351 Name: Autoglass A14NW 571 9 458180 Location: 1 Wheatley Hall Road, Doncaster, DN2 4LP (NE) 404468 Category: Repair and Servicing Class Code: Vehicle Repair, Testing and Servicing Positional Accuracy: Positioned to address or location Points of Interest - Commercial Services 352 Name: B J S Pallet Solutions A14NW 576 9 458184 Location: 3 Wheatley Hall Road, Doncaster, DN2 4LP (NE) 404470 Category: Transport, Storage and Delivery Class Code: Distribution and Haulage Positional Accuracy: Positioned to address or location Order Number: 242475436_1_1 Date: 12-May-2020 rpr_ec_datasheet v53.0 A Landmark Information Group Service Page 78 of 104 Industrial Land Use Quadrant Estimated Map Reference Details Distance Contact NGR ID (Compass Direction) From Site Points of Interest - Commercial Services 352 Name: Wheatley Hall M O T Station A14NW 576 9 458185 Location: 3 Wheatley Hall Road, Doncaster, DN2 4LP (NE) 404470 Category: Repair and Servicing Class Code: Vehicle Repair, Testing and Servicing Positional Accuracy: Positioned to address or location Points of Interest - Commercial Services 352 Name: Automart Direct A14NW 577 9 458185 Location: 3 Wheatley Hall Road, Doncaster, DN2 4PF (NE) 404470 Category: Repair and Servicing Class Code: Vehicle Repair, Testing and Servicing Positional Accuracy: Positioned to address or location Points of Interest - Commercial Services 352 Name: Splash Super Hand Car Wash A14NW 623 9 458192 Location: 5-7 Wheatley Hall Road, Doncaster, DN2 4LP (NE) 404556 Category: Personal, Consumer and other Services Class Code: Vehicle Cleaning Services Positional Accuracy: Positioned to address or location Points of Interest - Commercial Services 353 Name: Crucible Trading Company Ltd A8NE 612 9 457886 Location: 66 Copley Road, Doncaster, DN1 2QW (S) 403664 Category: Recycling Services Class Code: Scrap Metal Merchants Positional Accuracy: Positioned to address or location Points of Interest - Commercial Services 354 Name: Billys Joint Motorcycle Services A8SE 693 9 457810 Location: 39 Nether Hall Road, Doncaster, DN1 2PG (S) 403556 Category: Repair and Servicing Class Code: Vehicle Repair, Testing and Servicing Positional Accuracy: Positioned to address or location Points of Interest - Commercial Services 355 Name: Moto Technik A14SE 706 9 458362 Location: 54-56 Beckett Road, Doncaster, DN2 4AJ (E) 404161 Category: Repair and Servicing Class Code: Vehicle Repair, Testing and Servicing Positional Accuracy: Positioned to address or location Points of Interest - Commercial Services 355 Name: Moto Technik A14SE 706 9 458362 Location: 54 Beckett Road, Doncaster, DN2 4AJ (E) 404161 Category: Repair and Servicing Class Code: Vehicle Repair, Testing and Servicing Positional Accuracy: Positioned to address or location Points of Interest - Commercial Services 356 Name: Kwik-Fit (GB) Limited A19SW 723 9 458256 Location: Wheatley Hall Road, Doncaster, DN2 4LP (NE) 404642 Category: Repair and Servicing Class Code: Vehicle Repair, Testing and Servicing Positional Accuracy: Positioned to address or location Points of Interest - Commercial Services 356 Name: Kwik-Fit (GB) Limited A19SW 724 9 458257 Location: Wheatley Hall Road, Doncaster, DN2 4LP (NE) 404643 Category: Repair and Servicing Class Code: Vehicle Repair, Testing and Servicing Positional Accuracy: Positioned to address or location Points of Interest - Commercial Services 356 Name: Kwik-Fit (GB) Limited A19SW 739 9 458259 Location: Wheatley Hall Road, Doncaster, DN2 4LP (NE) 404665 Category: Repair and Servicing Class Code: Vehicle Repair, Testing and Servicing Positional Accuracy: Positioned to address or location Points of Interest - Commercial Services 356 Name: Charlie Browns Autocentres A19SW 739 9 458259 Location: Wheatley Hall Road, Doncaster, DN2 4LP (NE) 404665 Category: Repair and Servicing Class Code: Vehicle Repair, Testing and Servicing Positional Accuracy: Positioned to address or location Points of Interest - Commercial Services 357 Name: M T Motorcycles Ltd A12NW 736 9 456939 Location: 2 Ings Road, Doncaster, DN5 9SN (W) 404378 Category: Recycling Services Class Code: Scrap Metal Merchants Positional Accuracy: Positioned to address or location Order Number: 242475436_1_1 Date: 12-May-2020 rpr_ec_datasheet v53.0 A Landmark Information Group Service Page 79 of 104 Industrial Land Use Quadrant Estimated Map Reference Details Distance Contact NGR ID (Compass Direction) From Site Points of Interest - Commercial Services 358 Name: Halfords Autocentre A7NE 758 9 457029 Location: North Bridge Road, Doncaster, DN5 9AN (SW) 403815 Category: Repair and Servicing Class Code: Vehicle Repair, Testing and Servicing Positional Accuracy: Positioned to address or location Points of Interest - Commercial Services 358 Name: Nationwide Autocentre A7NE 758 9 457029 Location: North Bridge Road, Doncaster, DN5 9AN (SW) 403815 Category: Repair and Servicing Class Code: Vehicle Repair, Testing and Servicing Positional Accuracy: Positioned to address or location Points of Interest - Commercial Services 358 Name: Halfords Autocentre A7NE 759 9 457028 Location: North Bridge Road, Doncaster, DN5 9AN (SW) 403814 Category: Repair and Servicing Class Code: Vehicle Repair, Testing and Servicing Positional Accuracy: Positioned to address or location Points of Interest - Commercial Services 359 Name: Perfect Logistics Ltd A19SW 766 9 458197 Location: Churchill Road, Doncaster, DN1 2TH (NE) 404779 Category: Transport, Storage and Delivery Class Code: Distribution and Haulage Positional Accuracy: Positioned to address or location Points of Interest - Commercial Services 359 Name: Perfect Logistics Ltd A19SW 766 9 458197 Location: Churchill Road, Doncaster, DN1 2TH (NE) 404779 Category: Transport, Storage and Delivery Class Code: Distribution and Haulage Positional Accuracy: Positioned to address or location Points of Interest - Commercial Services 360 Name: Nationwide Autocentre A7NW 842 9 456901 Location: North Bridge Road, Doncaster, DN5 9AN (SW) 403870 Category: Repair and Servicing Class Code: Vehicle Repair, Testing and Servicing Positional Accuracy: Positioned to address or location Points of Interest - Commercial Services 361 Name: Hird Transport Ltd A14SE 845 9 458467 Location: 29 Avenue Road, Doncaster, DN2 4AQ (E) 403983 Category: Transport, Storage and Delivery Class Code: Distribution and Haulage Positional Accuracy: Positioned to address or location Points of Interest - Commercial Services 362 Name: Ironcraft A8SE 860 9 457742 Location: 31 Frances Street, Doncaster, DN1 1JB (S) 403377 Category: Construction Services Class Code: Metalworkers Including Blacksmiths Positional Accuracy: Positioned to address or location Points of Interest - Commercial Services 362 Name: Ironcraft A8SE 860 9 457742 Location: 31 Frances Street, Doncaster, DN1 1JB (S) 403377 Category: Construction Services Class Code: Metalworkers Including Blacksmiths Positional Accuracy: Positioned to address or location Points of Interest - Commercial Services 363 Name: A R C Car Wash A12SW 881 9 456789 Location: 13 Bentley Road, Doncaster, DN5 9SD (W) 404106 Category: Personal, Consumer and other Services Class Code: Vehicle Cleaning Services Positional Accuracy: Positioned to address or location Points of Interest - Commercial Services 364 Name: Serck Intertruck A7NW 904 9 456899 Location: Unit 3, Marshgate, Doncaster, DN5 8AF (SW) 403745 Category: Repair and Servicing Class Code: Vehicle Repair, Testing and Servicing Positional Accuracy: Positioned to address or location Points of Interest - Commercial Services 364 Name: F.J.R Automobile Auto Body's A7NW 904 9 456899 Location: Unit 3, Marshgate, Doncaster, DN5 8AF (SW) 403745 Category: Repair and Servicing Class Code: Vehicle Repair, Testing and Servicing Positional Accuracy: Positioned to address or location Order Number: 242475436_1_1 Date: 12-May-2020 rpr_ec_datasheet v53.0 A Landmark Information Group Service Page 80 of 104 Industrial Land Use Quadrant Estimated Map Reference Details Distance Contact NGR ID (Compass Direction) From Site Points of Interest - Commercial Services 365 Name: Bentley Service Station A12NW 909 9 456753 Location: Bentley Road, Doncaster, DN5 9SA (W) 404281 Category: Personal, Consumer and other Services Class Code: Vehicle Cleaning Services Positional Accuracy: Positioned to address or location Points of Interest - Commercial Services 365 Name: Shell Car Wash A12NW 909 9 456753 Location: Bentley Road, Doncaster, DN5 9SA (W) 404281 Category: Personal, Consumer and other Services Class Code: Vehicle Cleaning Services Positional Accuracy: Positioned to address or location Points of Interest - Commercial Services 365 Name: Car Wash A12NW 909 9 456753 Location: Bentley Road, Doncaster, DN5 9SA (W) 404281 Category: Personal, Consumer and other Services Class Code: Vehicle Cleaning Services Positional Accuracy: Positioned to address or location Points of Interest - Commercial Services 366 Name: Autoglass A7SE 972 9 457220 Location: Level 3 Multi-Story Car Park, Frenchgate Shopping, Doncaster, DN1 1QN (SW) 403366 Category: Repair and Servicing Class Code: Vehicle Repair, Testing and Servicing Positional Accuracy: Positioned to address or location Points of Interest - Education and Health 367 Name: Pain Management Solutions (St Vincent's Medical Practice) A9SW 850 9 458168 Location: 77 Thorne Road, Doncaster, DN1 2ET (SE) 403551 Category: Health Practitioners and Establishments Class Code: Hospitals Positional Accuracy: Positioned to address or location Points of Interest - Education and Health 368 Name: The Richard Foundation A8SW 881 9 457590 Location: 32-34 Scot Lane, Doncaster, DN1 1ES (S) 403355 Category: Health Practitioners and Establishments Class Code: Hospitals Positional Accuracy: Positioned to address or location Points of Interest - Education and Health 369 Name: Pain Management Solutions (Glenthorne) A9NW 881 9 458264 Location: 52 Thorne Road, Doncaster, DN1 2JW (SE) 403592 Category: Health Practitioners and Establishments Class Code: Hospitals Positional Accuracy: Positioned to address or location Points of Interest - Manufacturing and Production 370 Name: Business Park A13NE 213 9 457861 Location: DN1 (E) 404301 Category: Industrial Features Class Code: Business Parks and Industrial Estates Positional Accuracy: Positioned to an adjacent address or location Points of Interest - Manufacturing and Production 370 Name: Works A13NE 218 9 457862 Location: Not Supplied (E) 404314 Category: Industrial Features Class Code: Unspecified Works Or Factories Positional Accuracy: Positioned to an adjacent address or location Points of Interest - Manufacturing and Production 371 Name: Tank A13SE 229 9 457861 Location: DN1 (SE) 404124 Category: Industrial Features Class Code: Tanks (Generic) Positional Accuracy: Positioned to an adjacent address or location Points of Interest - Manufacturing and Production 371 Name: Works A13SE 273 9 457893 Location: Not Supplied (SE) 404091 Category: Industrial Features Class Code: Unspecified Works Or Factories Positional Accuracy: Positioned to an adjacent address or location Points of Interest - Manufacturing and Production 371 Name: Works A13SE 273 9 457893 Location: DN1 (SE) 404091 Category: Industrial Features Class Code: Unspecified Works Or Factories Positional Accuracy: Positioned to an adjacent address or location Order Number: 242475436_1_1 Date: 12-May-2020 rpr_ec_datasheet v53.0 A Landmark Information Group Service Page 81 of 104 Industrial Land Use Quadrant Estimated Map Reference Details Distance Contact NGR ID (Compass Direction) From Site Points of Interest - Manufacturing and Production 371 Name: Tank A13SE 313 9 457960 Location: DN1 (E) 404145 Category: Industrial Features Class Code: Tanks (Generic) Positional Accuracy: Positioned to an adjacent address or location Points of Interest - Manufacturing and Production 372 Name: Gas Works A13SE 314 9 457799 Location: Not Supplied (SE) 403951 Category: Industrial Features Class Code: Unspecified Works Or Factories Positional Accuracy: Positioned to an adjacent address or location Points of Interest - Manufacturing and Production 373 Name: Tank A13NW 341 9 457371 Location: DN5 (NW) 404413 Category: Industrial Features Class Code: Tanks (Generic) Positional Accuracy: Positioned to address or location Points of Interest - Manufacturing and Production 373 Name: Tank A13NW 343 9 457367 Location: DN5 (NW) 404410 Category: Industrial Features Class Code: Tanks (Generic) Positional Accuracy: Positioned to address or location Points of Interest - Manufacturing and Production 373 Name: Tank A13NW 345 9 457363 Location: DN5 (NW) 404406 Category: Industrial Features Class Code: Tanks (Generic) Positional Accuracy: Positioned to address or location Points of Interest - Manufacturing and Production 373 Name: Tank A13NW 346 9 457357 Location: DN5 (NW) 404399 Category: Industrial Features Class Code: Tanks (Generic) Positional Accuracy: Positioned to address or location Points of Interest - Manufacturing and Production 373 Name: Tank A13NW 346 9 457360 Location: DN5 (NW) 404403 Category: Industrial Features Class Code: Tanks (Generic) Positional Accuracy: Positioned to address or location Points of Interest - Manufacturing and Production 373 Name: Prosper Demulder Limited Anaerobic Digestion Plant (Waste AD) - ex - A13NW 347 9 457412 Anaerobic Digestion (DECC) (NW) 404475 Location: Ings Road, Bentley, Doncaster, DN5 Category: Industrial Features Class Code: Energy Production Positional Accuracy: Positioned to address or location Points of Interest - Manufacturing and Production 373 Name: Tanks A13NW 365 9 457353 Location: DN5 (NW) 404428 Category: Industrial Features Class Code: Tanks (Generic) Positional Accuracy: Positioned to an adjacent address or location Points of Interest - Manufacturing and Production 373 Name: Prosper Demulder Limited (Waste AD) - Anaerobic Digestion (DECC) A13NW 380 9 457379 Location: Ings Road, Bentley, Doncaster, DN5 (NW) 404488 Category: Industrial Features Class Code: Energy Production Positional Accuracy: Positioned to address or location Points of Interest - Manufacturing and Production 373 Name: Tank A13NW 385 9 457351 Location: DN5 (NW) 404461 Category: Industrial Features Class Code: Tanks (Generic) Positional Accuracy: Positioned to an adjacent address or location Points of Interest - Manufacturing and Production 373 Name: Tanks A13NW 396 9 457329 Location: DN5 (NW) 404449 Category: Industrial Features Class Code: Tanks (Generic) Positional Accuracy: Positioned to an adjacent address or location Order Number: 242475436_1_1 Date: 12-May-2020 rpr_ec_datasheet v53.0 A Landmark Information Group Service Page 82 of 104 Industrial Land Use Quadrant Estimated Map Reference Details Distance Contact NGR ID (Compass Direction) From Site Points of Interest - Manufacturing and Production 373 Name: Tank A13NW 408 9 457340 Location: DN5 (NW) 404484 Category: Industrial Features Class Code: Tanks (Generic) Positional Accuracy: Positioned to an adjacent address or location Points of Interest - Manufacturing and Production 374 Name: Works A14NW 372 9 458024 Location: Not Supplied (E) 404309 Category: Industrial Features Class Code: Unspecified Works Or Factories Positional Accuracy: Positioned to an adjacent address or location Points of Interest - Manufacturing and Production 374 Name: Works A14NW 372 9 458024 Location: DN1 (E) 404309 Category: Industrial Features Class Code: Unspecified Works Or Factories Positional Accuracy: Positioned to an adjacent address or location Points of Interest - Manufacturing and Production 375 Name: Works A14NW 402 9 458047 Location: DN1 (E) 404339 Category: Industrial Features Class Code: Unspecified Works Or Factories Positional Accuracy: Positioned to an adjacent address or location Points of Interest - Manufacturing and Production 375 Name: Works A14NW 438 9 458053 Location: Not Supplied (NE) 404426 Category: Industrial Features Class Code: Unspecified Works Or Factories Positional Accuracy: Positioned to an adjacent address or location Points of Interest - Manufacturing and Production 376 Name: Works A13NE 416 9 457983 Location: DN1 (NE) 404494 Category: Industrial Features Class Code: Unspecified Works Or Factories Positional Accuracy: Positioned to an adjacent address or location Points of Interest - Manufacturing and Production 376 Name: Tank A14NW 425 9 458032 Location: DN1 (NE) 404438 Category: Industrial Features Class Code: Tanks (Generic) Positional Accuracy: Positioned to address or location Points of Interest - Manufacturing and Production 376 Name: Works A13NE 425 9 457986 Location: Not Supplied (NE) 404505 Category: Industrial Features Class Code: Unspecified Works Or Factories Positional Accuracy: Positioned to an adjacent address or location Points of Interest - Manufacturing and Production 376 Name: Works A14NW 446 9 458054 Location: DN1 (NE) 404440 Category: Industrial Features Class Code: Unspecified Works Or Factories Positional Accuracy: Positioned to address or location Points of Interest - Manufacturing and Production 376 Name: Tanks A14NW 473 9 458016 Location: DN1 (NE) 404544 Category: Industrial Features Class Code: Tanks (Generic) Positional Accuracy: Positioned to an adjacent address or location Points of Interest - Manufacturing and Production 376 Name: Tank A14NW 474 9 458014 Location: DN1 (NE) 404547 Category: Industrial Features Class Code: Tanks (Generic) Positional Accuracy: Positioned to address or location Points of Interest - Manufacturing and Production 376 Name: Tank A14NW 478 9 458019 Location: DN1 (NE) 404547 Category: Industrial Features Class Code: Tanks (Generic) Positional Accuracy: Positioned to address or location Order Number: 242475436_1_1 Date: 12-May-2020 rpr_ec_datasheet v53.0 A Landmark Information Group Service Page 83 of 104 Industrial Land Use Quadrant Estimated Map Reference Details Distance Contact NGR ID (Compass Direction) From Site Points of Interest - Manufacturing and Production 376 Name: Tank A14NW 483 9 458046 Location: DN1 (NE) 404522 Category: Industrial Features Class Code: Tanks (Generic) Positional Accuracy: Positioned to an adjacent address or location Points of Interest - Manufacturing and Production 376 Name: Works A14NW 488 9 458067 Location: DN1 (NE) 404502 Category: Industrial Features Class Code: Unspecified Works Or Factories Positional Accuracy: Positioned to an adjacent address or location Points of Interest - Manufacturing and Production 376 Name: Works A14NW 488 9 458067 Location: Not Supplied (NE) 404502 Category: Industrial Features Class Code: Unspecified Works Or Factories Positional Accuracy: Positioned to an adjacent address or location Points of Interest - Manufacturing and Production 377 Name: Tank A12NE 423 9 457307 Location: DN5 (NW) 404464 Category: Industrial Features Class Code: Tanks (Generic) Positional Accuracy: Positioned to address or location Points of Interest - Manufacturing and Production 377 Name: Tanks A12NE 424 9 457311 Location: DN5 (NW) 404472 Category: Industrial Features Class Code: Tanks (Generic) Positional Accuracy: Positioned to an adjacent address or location Points of Interest - Manufacturing and Production 377 Name: Tank A12NE 429 9 457309 Location: DN5 (NW) 404478 Category: Industrial Features Class Code: Tanks (Generic) Positional Accuracy: Positioned to address or location Points of Interest - Manufacturing and Production 377 Name: Tank A13NW 430 9 457326 Location: DN5 (NW) 404502 Category: Industrial Features Class Code: Tanks (Generic) Positional Accuracy: Positioned to an adjacent address or location Points of Interest - Manufacturing and Production 377 Name: Tank A12NE 431 9 457308 Location: DN5 (NW) 404481 Category: Industrial Features Class Code: Tanks (Generic) Positional Accuracy: Positioned to address or location Points of Interest - Manufacturing and Production 377 Name: Tank A12NE 434 9 457306 Location: DN5 (NW) 404483 Category: Industrial Features Class Code: Tanks (Generic) Positional Accuracy: Positioned to address or location Points of Interest - Manufacturing and Production 377 Name: Tank A12NE 435 9 457300 Location: DN5 (NW) 404475 Category: Industrial Features Class Code: Tanks (Generic) Positional Accuracy: Positioned to address or location Points of Interest - Manufacturing and Production 377 Name: Tank A12NE 464 9 457240 Location: DN5 (NW) 404429 Category: Industrial Features Class Code: Tanks (Generic) Positional Accuracy: Positioned to an adjacent address or location Points of Interest - Manufacturing and Production 377 Name: Tank A12NE 472 9 457258 Location: DN5 (NW) 404479 Category: Industrial Features Class Code: Tanks (Generic) Positional Accuracy: Positioned to address or location Order Number: 242475436_1_1 Date: 12-May-2020 rpr_ec_datasheet v53.0 A Landmark Information Group Service Page 84 of 104 Industrial Land Use Quadrant Estimated Map Reference Details Distance Contact NGR ID (Compass Direction) From Site Points of Interest - Manufacturing and Production 377 Name: Tank A12NE 475 9 457256 Location: DN5 (NW) 404482 Category: Industrial Features Class Code: Tanks (Generic) Positional Accuracy: Positioned to address or location Points of Interest - Manufacturing and Production 377 Name: Tank A12NE 477 9 457267 Location: DN5 (NW) 404502 Category: Industrial Features Class Code: Tanks (Generic) Positional Accuracy: Positioned to address or location Points of Interest - Manufacturing and Production 377 Name: Tank A12NE 478 9 457255 Location: DN5 (NW) 404486 Category: Industrial Features Class Code: Tanks (Generic) Positional Accuracy: Positioned to address or location Points of Interest - Manufacturing and Production 377 Name: Tank A12NE 481 9 457248 Location: DN5 (NW) 404480 Category: Industrial Features Class Code: Tanks (Generic) Positional Accuracy: Positioned to address or location Points of Interest - Manufacturing and Production 377 Name: Tank A12NE 481 9 457264 Location: DN5 (NW) 404505 Category: Industrial Features Class Code: Tanks (Generic) Positional Accuracy: Positioned to address or location Points of Interest - Manufacturing and Production 377 Name: Tank A12NE 482 9 457250 Location: DN5 (NW) 404485 Category: Industrial Features Class Code: Tanks (Generic) Positional Accuracy: Positioned to address or location Points of Interest - Manufacturing and Production 377 Name: Tank A12NE 483 9 457252 Location: DN5 (NW) 404489 Category: Industrial Features Class Code: Tanks (Generic) Positional Accuracy: Positioned to address or location Points of Interest - Manufacturing and Production 377 Name: Tank A12NE 484 9 457270 Location: DN5 (NW) 404518 Category: Industrial Features Class Code: Tanks (Generic) Positional Accuracy: Positioned to address or location Points of Interest - Manufacturing and Production 377 Name: Tank A12NE 485 9 457266 Location: DN5 (NW) 404514 Category: Industrial Features Class Code: Tanks (Generic) Positional Accuracy: Positioned to address or location Points of Interest - Manufacturing and Production 377 Name: Tank A12NE 486 9 457247 Location: DN5 (NW) 404488 Category: Industrial Features Class Code: Tanks (Generic) Positional Accuracy: Positioned to address or location Points of Interest - Manufacturing and Production 377 Name: Tank A12NE 486 9 457262 Location: DN5 (NW) 404511 Category: Industrial Features Class Code: Tanks (Generic) Positional Accuracy: Positioned to address or location Points of Interest - Manufacturing and Production 377 Name: Tank A12NE 487 9 457268 Location: DN5 (NW) 404521 Category: Industrial Features Class Code: Tanks (Generic) Positional Accuracy: Positioned to address or location Order Number: 242475436_1_1 Date: 12-May-2020 rpr_ec_datasheet v53.0 A Landmark Information Group Service Page 85 of 104 Industrial Land Use Quadrant Estimated Map Reference Details Distance Contact NGR ID (Compass Direction) From Site Points of Interest - Manufacturing and Production 377 Name: Tanks A12NE 487 9 457249 Location: DN5 (NW) 404492 Category: Industrial Features Class Code: Tanks (Generic) Positional Accuracy: Positioned to an adjacent address or location Points of Interest - Manufacturing and Production 377 Name: Tank A12NE 489 9 457258 Location: DN5 (NW) 404509 Category: Industrial Features Class Code: Tanks (Generic) Positional Accuracy: Positioned to address or location Points of Interest - Manufacturing and Production 377 Name: Tank A12NE 489 9 457264 Location: DN5 (NW) 404519 Category: Industrial Features Class Code: Tanks (Generic) Positional Accuracy: Positioned to address or location Points of Interest - Manufacturing and Production 377 Name: Tank A12NE 490 9 457244 Location: DN5 (NW) 404491 Category: Industrial Features Class Code: Tanks (Generic) Positional Accuracy: Positioned to address or location Points of Interest - Manufacturing and Production 377 Name: Tank A12NE 493 9 457258 Location: DN5 (NW) 404516 Category: Industrial Features Class Code: Tanks (Generic) Positional Accuracy: Positioned to address or location Points of Interest - Manufacturing and Production 377 Name: Tank A12NE 493 9 457255 Location: DN5 (NW) 404513 Category: Industrial Features Class Code: Tanks (Generic) Positional Accuracy: Positioned to address or location Points of Interest - Manufacturing and Production 377 Name: Tank A12NE 493 9 457265 Location: DN5 (NW) 404527 Category: Industrial Features Class Code: Tanks (Generic) Positional Accuracy: Positioned to address or location Points of Interest - Manufacturing and Production 377 Name: Tank A12NE 494 9 457261 Location: DN5 (NW) 404523 Category: Industrial Features Class Code: Tanks (Generic) Positional Accuracy: Positioned to address or location Points of Interest - Manufacturing and Production 377 Name: Tank A12NE 496 9 457256 Location: DN5 (NW) 404520 Category: Industrial Features Class Code: Tanks (Generic) Positional Accuracy: Positioned to address or location Points of Interest - Manufacturing and Production 377 Name: Tank A12NE 497 9 457239 Location: DN5 (NW) 404495 Category: Industrial Features Class Code: Tanks (Generic) Positional Accuracy: Positioned to address or location Points of Interest - Manufacturing and Production 377 Name: Tank A12NE 498 9 457252 Location: DN5 (NW) 404517 Category: Industrial Features Class Code: Tanks (Generic) Positional Accuracy: Positioned to address or location Points of Interest - Manufacturing and Production 377 Name: Tank A12NE 498 9 457243 Location: DN5 (NW) 404503 Category: Industrial Features Class Code: Tanks (Generic) Positional Accuracy: Positioned to an adjacent address or location Order Number: 242475436_1_1 Date: 12-May-2020 rpr_ec_datasheet v53.0 A Landmark Information Group Service Page 86 of 104 Industrial Land Use Quadrant Estimated Map Reference Details Distance Contact NGR ID (Compass Direction) From Site Points of Interest - Manufacturing and Production 377 Name: Tank A12NE 505 9 457200 Location: DN5 (NW) 404439 Category: Industrial Features Class Code: Tanks (Generic) Positional Accuracy: Positioned to address or location Points of Interest - Manufacturing and Production 377 Name: Tanks A12NE 505 9 457200 Location: DN5 (NW) 404439 Category: Industrial Features Class Code: Tanks (Generic) Positional Accuracy: Positioned to an adjacent address or location Points of Interest - Manufacturing and Production 377 Name: Tank A12NE 506 9 457233 Location: DN5 (NW) 404502 Category: Industrial Features Class Code: Tanks (Generic) Positional Accuracy: Positioned to address or location Points of Interest - Manufacturing and Production 377 Name: Factory A12NE 518 9 457240 Location: Not Supplied (NW) 404535 Category: Industrial Features Class Code: Unspecified Works Or Factories Positional Accuracy: Positioned to an adjacent address or location Points of Interest - Manufacturing and Production 377 Name: Factory A12NE 518 9 457240 Location: DN5 (NW) 404535 Category: Industrial Features Class Code: Unspecified Works Or Factories Positional Accuracy: Positioned to an adjacent address or location Points of Interest - Manufacturing and Production 378 Name: Factory A12NE 445 9 457244 Location: DN5 (W) 404388 Category: Industrial Features Class Code: Unspecified Works Or Factories Positional Accuracy: Positioned to address or location Points of Interest - Manufacturing and Production 378 Name: Factory A12NE 465 9 457229 Location: Not Supplied (W) 404405 Category: Industrial Features Class Code: Unspecified Works Or Factories Positional Accuracy: Positioned to an adjacent address or location Points of Interest - Manufacturing and Production 379 Name: Tank A12NE 491 9 457178 Location: DN5 (W) 404324 Category: Industrial Features Class Code: Tanks (Generic) Positional Accuracy: Positioned to address or location Points of Interest - Manufacturing and Production 379 Name: Tanks A12NE 499 9 457168 Location: DN5 (W) 404313 Category: Industrial Features Class Code: Tanks (Generic) Positional Accuracy: Positioned to an adjacent address or location Points of Interest - Manufacturing and Production 379 Name: Tank A12NE 508 9 457159 Location: DN5 (W) 404314 Category: Industrial Features Class Code: Tanks (Generic) Positional Accuracy: Positioned to address or location Points of Interest - Manufacturing and Production 379 Name: Tank A12NE 510 9 457162 Location: DN5 (W) 404338 Category: Industrial Features Class Code: Tanks (Generic) Positional Accuracy: Positioned to address or location Points of Interest - Manufacturing and Production 379 Name: Tank A12NE 518 9 457152 Location: DN5 (W) 404329 Category: Industrial Features Class Code: Tanks (Generic) Positional Accuracy: Positioned to address or location Order Number: 242475436_1_1 Date: 12-May-2020 rpr_ec_datasheet v53.0 A Landmark Information Group Service Page 87 of 104 Industrial Land Use Quadrant Estimated Map Reference Details Distance Contact NGR ID (Compass Direction) From Site Points of Interest - Manufacturing and Production 379 Name: Tanks A12NE 519 9 457152 Location: DN5 (W) 404336 Category: Industrial Features Class Code: Tanks (Generic) Positional Accuracy: Positioned to an adjacent address or location Points of Interest - Manufacturing and Production 379 Name: Tank A12NE 521 9 457151 Location: DN5 (W) 404342 Category: Industrial Features Class Code: Tanks (Generic) Positional Accuracy: Positioned to address or location Points of Interest - Manufacturing and Production 380 Name: Works A7NE 529 9 457287 Location: Not Supplied (SW) 403858 Category: Industrial Features Class Code: Unspecified Works Or Factories Positional Accuracy: Positioned to an adjacent address or location Points of Interest - Manufacturing and Production 380 Name: Works A7NE 532 9 457311 Location: Not Supplied (SW) 403832 Category: Industrial Features Class Code: Unspecified Works Or Factories Positional Accuracy: Positioned to an adjacent address or location Points of Interest - Manufacturing and Production 380 Name: Works A7NE 532 9 457311 Location: DN1 (SW) 403832 Category: Industrial Features Class Code: Unspecified Works Or Factories Positional Accuracy: Positioned to an adjacent address or location Points of Interest - Manufacturing and Production 380 Name: Works A7NE 551 9 457272 Location: DN1 (SW) 403842 Category: Industrial Features Class Code: Unspecified Works Or Factories Positional Accuracy: Positioned to an adjacent address or location Points of Interest - Manufacturing and Production 381 Name: Factory A9NW 531 9 458049 Location: Not Supplied (SE) 403871 Category: Industrial Features Class Code: Unspecified Works Or Factories Positional Accuracy: Positioned to an adjacent address or location Points of Interest - Manufacturing and Production 381 Name: Factory A9NW 535 9 458053 Location: DN1 (SE) 403870 Category: Industrial Features Class Code: Unspecified Works Or Factories Positional Accuracy: Positioned to address or location Points of Interest - Manufacturing and Production 381 Name: Factory A9NW 550 9 458042 Location: DN1 (SE) 403838 Category: Industrial Features Class Code: Unspecified Works Or Factories Positional Accuracy: Positioned to address or location Points of Interest - Manufacturing and Production 381 Name: Factory A9NW 551 9 458043 Location: Not Supplied (SE) 403837 Category: Industrial Features Class Code: Unspecified Works Or Factories Positional Accuracy: Positioned to an adjacent address or location Points of Interest - Manufacturing and Production 381 Name: Works A9NW 564 9 458076 Location: Not Supplied (SE) 403852 Category: Industrial Features Class Code: Unspecified Works Or Factories Positional Accuracy: Positioned to an adjacent address or location Points of Interest - Manufacturing and Production 381 Name: Works A9NW 564 9 458076 Location: DN1 (SE) 403852 Category: Industrial Features Class Code: Unspecified Works Or Factories Positional Accuracy: Positioned to an adjacent address or location Order Number: 242475436_1_1 Date: 12-May-2020 rpr_ec_datasheet v53.0 A Landmark Information Group Service Page 88 of 104 Industrial Land Use Quadrant Estimated Map Reference Details Distance Contact NGR ID (Compass Direction) From Site Points of Interest - Manufacturing and Production 382 Name: Works A12NE 611 9 457054 Location: Not Supplied (W) 404306 Category: Industrial Features Class Code: Unspecified Works Or Factories Positional Accuracy: Positioned to an adjacent address or location Points of Interest - Manufacturing and Production 382 Name: Works A12NE 611 9 457054 Location: DN5 (W) 404306 Category: Industrial Features Class Code: Unspecified Works Or Factories Positional Accuracy: Positioned to an adjacent address or location Points of Interest - Manufacturing and Production 382 Name: Tank A12NE 628 9 457036 Location: DN5 (W) 404300 Category: Industrial Features Class Code: Tanks (Generic) Positional Accuracy: Positioned to an adjacent address or location Points of Interest - Manufacturing and Production 382 Name: Works A12NE 652 9 457027 Location: Not Supplied (W) 404384 Category: Industrial Features Class Code: Unspecified Works Or Factories Positional Accuracy: Positioned to an adjacent address or location Points of Interest - Manufacturing and Production 383 Name: Works A12NE 633 9 457055 Location: DN5 (W) 404416 Category: Industrial Features Class Code: Unspecified Works Or Factories Positional Accuracy: Positioned to an adjacent address or location Points of Interest - Manufacturing and Production 383 Name: Works A12NE 636 9 457050 Location: Not Supplied (W) 404409 Category: Industrial Features Class Code: Unspecified Works Or Factories Positional Accuracy: Positioned to an adjacent address or location Points of Interest - Manufacturing and Production 384 Name: Works A14NW 640 9 458210 Location: Not Supplied (NE) 404559 Category: Industrial Features Class Code: Unspecified Works Or Factories Positional Accuracy: Positioned to an adjacent address or location Points of Interest - Manufacturing and Production 384 Name: Works A14NW 640 9 458210 Location: DN2 (NE) 404559 Category: Industrial Features Class Code: Unspecified Works Or Factories Positional Accuracy: Positioned to an adjacent address or location Points of Interest - Manufacturing and Production 384 Name: Business Centre A19SW 659 9 458213 Location: DN2 (NE) 404590 Category: Industrial Features Class Code: Business Parks and Industrial Estates Positional Accuracy: Positioned to an adjacent address or location Points of Interest - Manufacturing and Production 385 Name: Urban Biz A8NE 641 9 457706 Location: 24-26 Market Road, Doncaster, DN1 1LP (S) 403594 Category: Industrial Features Class Code: Business Parks and Industrial Estates Positional Accuracy: Positioned to address or location Points of Interest - Manufacturing and Production 385 Name: Works A8SE 707 9 457727 Location: DN1 (S) 403529 Category: Industrial Features Class Code: Unspecified Works Or Factories Positional Accuracy: Positioned to an adjacent address or location Points of Interest - Manufacturing and Production 385 Name: Works A8SE 708 9 457731 Location: Not Supplied (S) 403529 Category: Industrial Features Class Code: Unspecified Works Or Factories Positional Accuracy: Positioned to an adjacent address or location Order Number: 242475436_1_1 Date: 12-May-2020 rpr_ec_datasheet v53.0 A Landmark Information Group Service Page 89 of 104 Industrial Land Use Quadrant Estimated Map Reference Details Distance Contact NGR ID (Compass Direction) From Site Points of Interest - Manufacturing and Production 386 Name: Works A12NE 653 9 457026 Location: DN5 (W) 404387 Category: Industrial Features Class Code: Unspecified Works Or Factories Positional Accuracy: Positioned to address or location Points of Interest - Manufacturing and Production 386 Name: Works A12NE 656 9 457017 Location: Not Supplied (W) 404358 Category: Industrial Features Class Code: Unspecified Works Or Factories Positional Accuracy: Positioned to an adjacent address or location Points of Interest - Manufacturing and Production 386 Name: Works A12NE 656 9 457017 Location: DN5 (W) 404358 Category: Industrial Features Class Code: Unspecified Works Or Factories Positional Accuracy: Positioned to an adjacent address or location Points of Interest - Manufacturing and Production 386 Name: D K Marble & Granite Ltd A12NW 736 9 456939 Location: 1 Ings Road, Doncaster, DN5 9SN (W) 404378 Category: Extractive Industries Class Code: Stone Quarrying and Preparation Positional Accuracy: Positioned to address or location Points of Interest - Manufacturing and Production 386 Name: Works A12NW 752 9 456921 Location: DN5 (W) 404366 Category: Industrial Features Class Code: Unspecified Works Or Factories Positional Accuracy: Positioned to address or location Points of Interest - Manufacturing and Production 386 Name: Works A12NW 757 9 456916 Location: Not Supplied (W) 404370 Category: Industrial Features Class Code: Unspecified Works Or Factories Positional Accuracy: Positioned to an adjacent address or location Points of Interest - Manufacturing and Production 387 Name: Tank A19SW 694 9 458174 Location: DN1 (NE) 404698 Category: Industrial Features Class Code: Tanks (Generic) Positional Accuracy: Positioned to an adjacent address or location Points of Interest - Manufacturing and Production 388 Name: Works A7NE 714 9 457263 Location: Not Supplied (SW) 403640 Category: Industrial Features Class Code: Unspecified Works Or Factories Positional Accuracy: Positioned to an adjacent address or location Points of Interest - Manufacturing and Production 388 Name: Works A7NE 714 9 457263 Location: DN1 (SW) 403640 Category: Industrial Features Class Code: Unspecified Works Or Factories Positional Accuracy: Positioned to an adjacent address or location Points of Interest - Manufacturing and Production 389 Name: Tanks A19SW 734 9 458161 Location: DN1 (NE) 404768 Category: Industrial Features Class Code: Tanks (Generic) Positional Accuracy: Positioned to an adjacent address or location Points of Interest - Manufacturing and Production 389 Name: Works A19SW 768 9 458193 Location: Not Supplied (NE) 404785 Category: Industrial Features Class Code: Unspecified Works Or Factories Positional Accuracy: Positioned to an adjacent address or location Points of Interest - Manufacturing and Production 389 Name: Tanks A19SW 807 9 458244 Location: DN1 (NE) 404789 Category: Industrial Features Class Code: Tanks (Generic) Positional Accuracy: Positioned to an adjacent address or location Order Number: 242475436_1_1 Date: 12-May-2020 rpr_ec_datasheet v53.0 A Landmark Information Group Service Page 90 of 104 Industrial Land Use Quadrant Estimated Map Reference Details Distance Contact NGR ID (Compass Direction) From Site Points of Interest - Manufacturing and Production 390 Name: Tanks A19SW 747 9 458151 Location: DN1 (NE) 404795 Category: Industrial Features Class Code: Tanks (Generic) Positional Accuracy: Positioned to an adjacent address or location Points of Interest - Manufacturing and Production 391 Name: Works A7NE 762 9 457090 Location: DN5 (SW) 403728 Category: Industrial Features Class Code: Unspecified Works Or Factories Positional Accuracy: Positioned to an adjacent address or location Points of Interest - Manufacturing and Production 391 Name: Works A7NE 763 9 457090 Location: Not Supplied (SW) 403727 Category: Industrial Features Class Code: Unspecified Works Or Factories Positional Accuracy: Positioned to an adjacent address or location Points of Interest - Manufacturing and Production 391 Name: Works A7NE 811 9 457080 Location: DN5 (SW) 403666 Category: Industrial Features Class Code: Unspecified Works Or Factories Positional Accuracy: Positioned to an adjacent address or location Points of Interest - Manufacturing and Production 391 Name: Works A7NE 813 9 457080 Location: Not Supplied (SW) 403664 Category: Industrial Features Class Code: Unspecified Works Or Factories Positional Accuracy: Positioned to an adjacent address or location Points of Interest - Manufacturing and Production 392 Name: Works A8SE 778 9 457834 Location: Not Supplied (S) 403475 Category: Industrial Features Class Code: Unspecified Works Or Factories Positional Accuracy: Positioned to an adjacent address or location Points of Interest - Manufacturing and Production 392 Name: Works A8SE 778 9 457834 Location: DN1 (S) 403475 Category: Industrial Features Class Code: Unspecified Works Or Factories Positional Accuracy: Positioned to an adjacent address or location Points of Interest - Manufacturing and Production 393 Name: Tanks A19SW 811 9 458220 Location: DN1 (NE) 404819 Category: Industrial Features Class Code: Tanks (Generic) Positional Accuracy: Positioned to an adjacent address or location Points of Interest - Manufacturing and Production 393 Name: Tank A19SW 893 9 458251 Location: DN2 (NE) 404901 Category: Industrial Features Class Code: Tanks (Generic) Positional Accuracy: Positioned to an adjacent address or location Points of Interest - Manufacturing and Production 393 Name: Tanks A19NW 946 9 458289 Location: DN2 (NE) 404939 Category: Industrial Features Class Code: Tanks (Generic) Positional Accuracy: Positioned to an adjacent address or location Points of Interest - Manufacturing and Production 393 Name: Tank A19NW 950 9 458296 Location: DN2 (NE) 404938 Category: Industrial Features Class Code: Tanks (Generic) Positional Accuracy: Positioned to address or location Points of Interest - Manufacturing and Production 394 Name: Works A7NW 850 9 456983 Location: Not Supplied (SW) 403719 Category: Industrial Features Class Code: Unspecified Works Or Factories Positional Accuracy: Positioned to an adjacent address or location Order Number: 242475436_1_1 Date: 12-May-2020 rpr_ec_datasheet v53.0 A Landmark Information Group Service Page 91 of 104 Industrial Land Use Quadrant Estimated Map Reference Details Distance Contact NGR ID (Compass Direction) From Site Points of Interest - Manufacturing and Production 394 Name: Works A7NW 850 9 456983 Location: DN5 (SW) 403720 Category: Industrial Features Class Code: Unspecified Works Or Factories Positional Accuracy: Positioned to an adjacent address or location Points of Interest - Manufacturing and Production 395 Name: Works A8SE 863 9 457743 Location: DN1 (S) 403374 Category: Industrial Features Class Code: Unspecified Works Or Factories Positional Accuracy: Positioned to an adjacent address or location Points of Interest - Manufacturing and Production 395 Name: Works A8SE 909 9 457788 Location: Not Supplied (S) 403333 Category: Industrial Features Class Code: Unspecified Works Or Factories Positional Accuracy: Positioned to an adjacent address or location Points of Interest - Manufacturing and Production 395 Name: Works A8SE 909 9 457788 Location: DN1 (S) 403333 Category: Industrial Features Class Code: Unspecified Works Or Factories Positional Accuracy: Positioned to an adjacent address or location Points of Interest - Manufacturing and Production 396 Name: Works A7SE 915 9 457061 Location: DN5 (SW) 403542 Category: Industrial Features Class Code: Unspecified Works Or Factories Positional Accuracy: Positioned to an adjacent address or location Points of Interest - Manufacturing and Production 396 Name: Works A7SE 916 9 457061 Location: Not Supplied (SW) 403541 Category: Industrial Features Class Code: Unspecified Works Or Factories Positional Accuracy: Positioned to an adjacent address or location Points of Interest - Manufacturing and Production 396 Name: Works A7SE 973 9 457028 Location: Not Supplied (SW) 403493 Category: Industrial Features Class Code: Unspecified Works Or Factories Positional Accuracy: Positioned to an adjacent address or location Points of Interest - Manufacturing and Production 396 Name: Works A7SE 992 9 456988 Location: DN5 (SW) 403504 Category: Industrial Features Class Code: Unspecified Works Or Factories Positional Accuracy: Positioned to an adjacent address or location Points of Interest - Manufacturing and Production 396 Name: Works A7SE 998 9 456987 Location: DN5 (SW) 403496 Category: Industrial Features Class Code: Unspecified Works Or Factories Positional Accuracy: Positioned to an adjacent address or location Points of Interest - Manufacturing and Production 397 Name: Works A7NW 990 9 456844 Location: DN5 (SW) 403673 Category: Industrial Features Class Code: Unspecified Works Or Factories Positional Accuracy: Positioned to an adjacent address or location Points of Interest - Manufacturing and Production 397 Name: Works A7NW 991 9 456844 Location: Not Supplied (SW) 403672 Category: Industrial Features Class Code: Unspecified Works Or Factories Positional Accuracy: Positioned to an adjacent address or location Points of Interest - Public Infrastructure 398 Name: Recycling Business A13SW 33 9 457633 Location: DN1 (SW) 404214 Category: Infrastructure and Facilities Class Code: Recycling Centres Positional Accuracy: Positioned to an adjacent address or location Order Number: 242475436_1_1 Date: 12-May-2020 rpr_ec_datasheet v53.0 A Landmark Information Group Service Page 92 of 104 Industrial Land Use Quadrant Estimated Map Reference Details Distance Contact NGR ID (Compass Direction) From Site Points of Interest - Public Infrastructure 399 Name: Sluice A13NW 108 9 457651 Location: DN2 (N) 404340 Category: Water Class Code: Weirs, Sluices and Dams Positional Accuracy: Positioned to an adjacent address or location Points of Interest - Public Infrastructure 399 Name: Sluice A13NW 109 9 457646 Location: DN2 (N) 404340 Category: Water Class Code: Weirs, Sluices and Dams Positional Accuracy: Positioned to an adjacent address or location Points of Interest - Public Infrastructure 400 Name: Sluice A13SE 150 9 457760 Location: DN1 (SE) 404121 Category: Water Class Code: Weirs, Sluices and Dams Positional Accuracy: Positioned to an adjacent address or location Points of Interest - Public Infrastructure 400 Name: Sluice A13SE 153 9 457765 Location: DN1 (SE) 404122 Category: Water Class Code: Weirs, Sluices and Dams Positional Accuracy: Positioned to an adjacent address or location Points of Interest - Public Infrastructure 400 Name: Sewage Pumping Station A13SE 191 9 457800 Location: DN1 (SE) 404103 Category: Infrastructure and Facilities Class Code: Waste Storage, Processing and Disposal Positional Accuracy: Positioned to an adjacent address or location Points of Interest - Public Infrastructure 401 Name: Sluice A13SE 177 9 457675 Location: DN1 (S) 404057 Category: Water Class Code: Weirs, Sluices and Dams Positional Accuracy: Positioned to an adjacent address or location Points of Interest - Public Infrastructure 401 Name: Sluice A13SE 177 9 457680 Location: DN1 (S) 404057 Category: Water Class Code: Weirs, Sluices and Dams Positional Accuracy: Positioned to an adjacent address or location Points of Interest - Public Infrastructure 401 Name: Sewage Pumping Station A13SE 202 9 457768 Location: DN1 (SE) 404062 Category: Infrastructure and Facilities Class Code: Waste Storage, Processing and Disposal Positional Accuracy: Positioned to an adjacent address or location Points of Interest - Public Infrastructure 402 Name: Leger Bus A13SE 278 9 457923 Location: Leger House, Brooke Street, Doncaster, DN1 2SW (E) 404143 Category: Public Transport, Stations and Infrastructure Class Code: Bus and Coach Stations, Depots and Companies Positional Accuracy: Positioned to address or location Points of Interest - Public Infrastructure 402 Name: Leger Bus A13SE 278 9 457923 Location: Leger House, Brooke Street, Doncaster, DN1 2SW (E) 404143 Category: Public Transport, Stations and Infrastructure Class Code: Bus and Coach Stations, Depots and Companies Positional Accuracy: Positioned to address or location Points of Interest - Public Infrastructure 403 Name: Recycling Business A13NW 452 9 457346 Location: DN5 (NW) 404557 Category: Infrastructure and Facilities Class Code: Recycling Centres Positional Accuracy: Positioned to an adjacent address or location Points of Interest - Public Infrastructure 404 Name: BP Service Station A8NE 456 9 457698 Location: Church Way, Doncaster, DN1 2RE (S) 403779 Category: Road And Rail Class Code: Petrol and Fuel Stations Positional Accuracy: Positioned to address or location Order Number: 242475436_1_1 Date: 12-May-2020 rpr_ec_datasheet v53.0 A Landmark Information Group Service Page 93 of 104 Industrial Land Use Quadrant Estimated Map Reference Details Distance Contact NGR ID (Compass Direction) From Site Points of Interest - Public Infrastructure 404 Name: St Georges Filling Station A8NE 456 9 457698 Location: Church Way, Doncaster, DN1 2RE (S) 403779 Category: Road And Rail Class Code: Petrol and Fuel Stations Positional Accuracy: Positioned to address or location Points of Interest - Public Infrastructure 404 Name: St Georges Filling Station A8NE 457 9 457697 Location: Church Way, Doncaster, DN1 2RE (S) 403778 Category: Road And Rail Class Code: Petrol and Fuel Stations Positional Accuracy: Positioned to address or location Points of Interest - Public Infrastructure 405 Name: Marshgate Junction A7NE 697 9 457092 Location: DN5 (SW) 403829 Category: Public Transport, Stations and Infrastructure Class Code: Railway Stations, Junctions and Halts Positional Accuracy: Positioned to an adjacent address or location Points of Interest - Public Infrastructure 406 Name: Tesco Petrol Filling Station A7SE 812 9 457227 Location: Church View, Doncaster, DN1 1RE (SW) 403546 Category: Road And Rail Class Code: Petrol and Fuel Stations Positional Accuracy: Positioned to address or location Points of Interest - Public Infrastructure 407 Name: Sluice A18NW 900 9 457465 Location: DN5 (N) 405111 Category: Water Class Code: Weirs, Sluices and Dams Positional Accuracy: Positioned to an adjacent address or location Points of Interest - Public Infrastructure 407 Name: Sluice A18NW 901 9 457460 Location: DN5 (N) 405111 Category: Water Class Code: Weirs, Sluices and Dams Positional Accuracy: Positioned to an adjacent address or location Points of Interest - Public Infrastructure 408 Name: Sluice A17SW 908 9 456824 Location: DN5 (NW) 404584 Category: Water Class Code: Weirs, Sluices and Dams Positional Accuracy: Positioned to an adjacent address or location Points of Interest - Public Infrastructure 409 Name: Shell Service Station A12NW 909 9 456753 Location: Bentley Road, Doncaster, DN5 9SA (W) 404281 Category: Road And Rail Class Code: Petrol and Fuel Stations Positional Accuracy: Positioned to address or location Points of Interest - Public Infrastructure 409 Name: Bentley Service Station A12NW 909 9 456753 Location: Bentley Road, Doncaster, DN5 9SA (W) 404280 Category: Road And Rail Class Code: Petrol and Fuel Stations Positional Accuracy: Positioned to address or location Points of Interest - Public Infrastructure 409 Name: Bentley Service Station A12NW 909 9 456753 Location: Bentley Road, Doncaster, DN5 9SA (W) 404281 Category: Road And Rail Class Code: Petrol and Fuel Stations Positional Accuracy: Positioned to address or location Points of Interest - Public Infrastructure 409 Name: Bentley Service Station A12NW 909 9 456753 Location: Bentley Road, Doncaster, DN5 9SA (W) 404281 Category: Road And Rail Class Code: Petrol and Fuel Stations Positional Accuracy: Positioned to address or location Points of Interest - Public Infrastructure 410 Name: Bentley Junction A18NE 965 9 457972 Location: DN5 (N) 405145 Category: Public Transport, Stations and Infrastructure Class Code: Railway Stations, Junctions and Halts Positional Accuracy: Positioned to an adjacent address or location Order Number: 242475436_1_1 Date: 12-May-2020 rpr_ec_datasheet v53.0 A Landmark Information Group Service Page 94 of 104 Industrial Land Use Quadrant Estimated Map Reference Details Distance Contact NGR ID (Compass Direction) From Site Points of Interest - Public Infrastructure 411 Name: Bus Station (below) A7SE 970 9 457190 Location: DN1 (SW) 403385 Category: Public Transport, Stations and Infrastructure Class Code: Bus and Coach Stations, Depots and Companies Positional Accuracy: Positioned to address or location Points of Interest - Public Infrastructure 412 Name: Sluice A12SW 991 9 456716 Location: DN5 (W) 403932 Category: Water Class Code: Weirs, Sluices and Dams Positional Accuracy: Positioned to an adjacent address or location Points of Interest - Recreational and Environmental 413 Name: Play Area A14SW 541 9 458094 Location: DN1 (SE) 403910 Category: Recreational Class Code: Playgrounds Positional Accuracy: Positioned to an adjacent address or location Points of Interest - Recreational and Environmental 414 Name: Play Area A8NE 717 9 457992 Location: DN1 (SE) 403597 Category: Recreational Class Code: Playgrounds Positional Accuracy: Positioned to an adjacent address or location Points of Interest - Recreational and Environmental 415 Name: Play Area A17SW 940 9 456796 Location: DN5 (NW) 404602 Category: Recreational Class Code: Playgrounds Positional Accuracy: Positioned to an adjacent address or location Order Number: 242475436_1_1 Date: 12-May-2020 rpr_ec_datasheet v53.0 A Landmark Information Group Service Page 95 of 104 Sensitive Land Use Quadrant Estimated Map Reference Details Distance Contact NGR ID (Compass Direction) From Site Areas of Adopted Green Belt 416 Authority: Doncaster Metropolitan Borough Council A12NE 557 10 457112 Plan Name: Doncaster Unitary Development Plan (W) 404326 Status: Adopted Plan Date: 31st July 1998 Areas of Adopted Green Belt 417 Authority: Doncaster Metropolitan Borough Council A12NE 611 10 457125 Plan Name: Doncaster Unitary Development Plan (NW) 404526 Status: Adopted Plan Date: 31st July 1998 Nitrate Vulnerable Zones 418 Name: Lower Don Nvz A13NE 0 4 457660 Description: Surface Water (NE) 404233 Source: Environment Agency, Head Office Nitrate Vulnerable Zones 419 Name: R Torne / Three Rivers From Mother Dr To R Trent Nvz A9NW 900 4 458300 Description: Surface Water (SE) 403600 Source: Environment Agency, Head Office Order Number: 242475436_1_1 Date: 12-May-2020 rpr_ec_datasheet v53.0 A Landmark Information Group Service Page 96 of 104 Data Currency Agency & Hydrological Version Update Cycle Contaminated Land Register Entries and Notices Doncaster Metropolitan Borough Council - Environmental Services April 2014 Annual Rolling Update Environment Agency - Head Office September 2019 Annually Discharge Consents Environment Agency - Midlands Region January 2020 Quarterly Environment Agency - North East Region January 2020 Quarterly Enforcement and Prohibition Notices Environment Agency - North East Region March 2013 Annual Rolling Update Integrated Pollution Controls Environment Agency - North East Region October 2008 Variable Integrated Pollution Prevention And Control Environment Agency - North East Region January 2020 Quarterly Local Authority Integrated Pollution Prevention And Control Doncaster Metropolitan Borough Council - Environmental Services June 2014 Variable Local Authority Pollution Prevention and Controls Doncaster Metropolitan Borough Council - Environmental Services June 2014 Annual Rolling Update Local Authority Pollution Prevention and Control Enforcements Doncaster Metropolitan Borough Council - Environmental Services June 2014 Variable Nearest Surface Water Feature Ordnance Survey February 2020 Pollution Incidents to Controlled Waters Environment Agency - North East Region December 1998 Not Applicable Environment Agency - Midlands Region December 1999 Not Applicable Prosecutions Relating to Authorised Processes Environment Agency - North East Region March 2013 Annual Rolling Update Prosecutions Relating to Controlled Waters Environment Agency - North East Region March 2013 Annual Rolling Update Registered Radioactive Substances Environment Agency - North East Region June 2016 River Quality Environment Agency - Head Office November 2001 Not Applicable River Quality Biology Sampling Points Environment Agency - Head Office July 2012 Annually River Quality Chemistry Sampling Points Environment Agency - Head Office July 2012 Annually Substantiated Pollution Incident Register Environment Agency - North East Region - Ridings Area January 2020 Quarterly Environment Agency - North East Region - Yorkshire Area January 2020 Quarterly Water Abstractions Environment Agency - Midlands Region April 2020 Quarterly Environment Agency - North East Region April 2020 Quarterly Water Industry Act Referrals Environment Agency - North East Region October 2017 Quarterly Groundwater Vulnerability Map Environment Agency - Head Office June 2018 As notified Bedrock Aquifer Designations Environment Agency - Head Office January 2018 Annually Superficial Aquifer Designations Environment Agency - Head Office January 2018 Annually Source Protection Zones Environment Agency - Head Office October 2019 Quarterly Order Number: 242475436_1_1 Date: 12-May-2020 rpr_ec_datasheet v53.0 A Landmark Information Group Service Page 97 of 104 Data Currency Agency & Hydrological Version Update Cycle Extreme Flooding from Rivers or Sea without Defences Environment Agency - Head Office February 2020 Quarterly Flooding from Rivers or Sea without Defences Environment Agency - Head Office February 2020 Quarterly Areas Benefiting from Flood Defences Environment Agency - Head Office February 2020 Quarterly Flood Water Storage Areas Environment Agency - Head Office February 2020 Quarterly Flood Defences Environment Agency - Head Office February 2020 Quarterly OS Water Network Lines Ordnance Survey January 2020 Quarterly Surface Water 1 in 30 year Flood Extent Environment Agency - Head Office October 2013 Annually Surface Water 1 in 100 year Flood Extent Environment Agency - Head Office October 2013 Annually Surface Water 1 in 1000 year Flood Extent Environment Agency - Head Office October 2013 Annually Surface Water Suitability Environment Agency - Head Office October 2013 Annually BGS Groundwater Flooding Susceptibility British Geological Survey - National Geoscience Information Service May 2013 Annually Order Number: 242475436_1_1 Date: 12-May-2020 rpr_ec_datasheet v53.0 A Landmark Information Group Service Page 98 of 104 Data Currency Waste Version Update Cycle BGS Recorded Landfill Sites British Geological Survey - National Geoscience Information Service June 1996 Not Applicable Historical Landfill Sites Environment Agency - Head Office October 2019 Quarterly Integrated Pollution Control Registered Waste Sites Environment Agency - North East Region October 2008 Not Applicable Licensed Waste Management Facilities (Landfill Boundaries) Environment Agency - North East Region - Ridings Area November 2019 Quarterly Environment Agency - North East Region - Yorkshire Area November 2019 Quarterly Licensed Waste Management Facilities (Locations) Environment Agency - North East Region - Ridings Area January 2020 Quarterly Environment Agency - North East Region - Yorkshire Area January 2020 Quarterly Local Authority Landfill Coverage Doncaster Metropolitan Borough Council - Environmental Services May 2000 Not Applicable Local Authority Recorded Landfill Sites Doncaster Metropolitan Borough Council - Environmental Services May 2000 Not Applicable Potentially Infilled Land (Non-Water) Landmark Information Group Limited December 1999 Not Applicable Potentially Infilled Land (Water) Landmark Information Group Limited December 1999 Not Applicable Registered Landfill Sites Environment Agency - North East Region - Ridings Area March 2003 Not Applicable Environment Agency - North East Region - Yorkshire Area March 2003 Not Applicable Registered Waste Transfer Sites Environment Agency - North East Region - Ridings Area March 2003 Not Applicable Environment Agency - North East Region - Yorkshire Area March 2003 Not Applicable Registered Waste Treatment or Disposal Sites Environment Agency - North East Region - Ridings Area March 2003 Not Applicable Environment Agency - North East Region - Yorkshire Area March 2003 Not Applicable Hazardous Substances Version Update Cycle Control of Major Accident Hazards Sites (COMAH) Health and Safety Executive April 2018 Bi-Annually Explosive Sites Health and Safety Executive March 2017 Annually Notification of Installations Handling Hazardous Substances (NIHHS) Health and Safety Executive November 2000 Not Applicable Planning Hazardous Substance Enforcements Doncaster Metropolitan Borough Council October 2015 Variable Planning Hazardous Substance Consents Doncaster Metropolitan Borough Council October 2015 Variable Order Number: 242475436_1_1 Date: 12-May-2020 rpr_ec_datasheet v53.0 A Landmark Information Group Service Page 99 of 104 Data Currency Geological Version Update Cycle BGS 1:625,000 Solid Geology British Geological Survey - National Geoscience Information Service January 2009 Not Applicable BGS Estimated Soil Chemistry British Geological Survey - National Geoscience Information Service October 2015 Annually BGS Recorded Mineral Sites British Geological Survey - National Geoscience Information Service October 2019 Bi-Annually BGS Urban Soil Chemistry British Geological Survey - National Geoscience Information Service October 2015 Annually BGS Urban Soil Chemistry Averages British Geological Survey - National Geoscience Information Service October 2015 Annually CBSCB Compensation District Cheshire Brine Subsidence Compensation Board (CBSCB) August 2011 Not Applicable Coal Mining Affected Areas The Coal Authority - Property Searches March 2014 Annual Rolling Update Mining Instability Ove Arup & Partners October 2000 Not Applicable Non Coal Mining Areas of Great Britain British Geological Survey - National Geoscience Information Service May 2015 Not Applicable Potential for Collapsible Ground Stability Hazards British Geological Survey - National Geoscience Information Service January 2019 Annually Potential for Compressible Ground Stability Hazards British Geological Survey - National Geoscience Information Service January 2019 Annually Potential for Ground Dissolution Stability Hazards British Geological Survey - National Geoscience Information Service January 2019 Annually Potential for Landslide Ground Stability Hazards British Geological Survey - National Geoscience Information Service January 2019 Annually Potential for Running Sand Ground Stability Hazards British Geological Survey - National Geoscience Information Service January 2019 Annually Potential for Shrinking or Swelling Clay Ground Stability Hazards British Geological Survey - National Geoscience Information Service January 2019 Annually Radon Potential - Radon Affected Areas British Geological Survey - National Geoscience Information Service July 2011 Annually Radon Potential - Radon Protection Measures British Geological Survey - National Geoscience Information Service July 2011 Annually Order Number: 242475436_1_1 Date: 12-May-2020 rpr_ec_datasheet v53.0 A Landmark Information Group Service Page 100 of 104 Data Currency Industrial Land Use Version Update Cycle Contemporary Trade Directory Entries Thomson Directories January 2020 Quarterly Fuel Station Entries Catalist Ltd - Experian April 2020 Quarterly Gas Pipelines National Grid July 2014 Points of Interest - Commercial Services PointX March 2020 Quarterly Points of Interest - Education and Health PointX March 2020 Quarterly Points of Interest - Manufacturing and Production PointX March 2020 Quarterly Points of Interest - Public Infrastructure PointX March 2020 Quarterly Points of Interest - Recreational and Environmental PointX March 2020 Quarterly Underground Electrical Cables National Grid October 2019 Order Number: 242475436_1_1 Date: 12-May-2020 rpr_ec_datasheet v53.0 A Landmark Information Group Service Page 101 of 104 Data Currency Sensitive Land Use Version Update Cycle Ancient Woodland Natural England April 2020 Bi-Annually Areas of Adopted Green Belt Doncaster Metropolitan Borough Council February 2020 As notified Areas of Unadopted Green Belt Doncaster Metropolitan Borough Council February 2020 As notified Areas of Outstanding Natural Beauty Natural England June 2019 Bi-Annually Environmentally Sensitive Areas Natural England January 2017 Forest Parks Forestry Commission April 1997 Not Applicable Local Nature Reserves Natural England April 2020 Bi-Annually Marine Nature Reserves Natural England July 2019 Bi-Annually National Nature Reserves Natural England July 2019 Bi-Annually National Parks Natural England April 2017 Bi-Annually Nitrate Sensitive Areas Natural England April 2016 Not Applicable Nitrate Vulnerable Zones Environment Agency - Head Office December 2017 Bi-Annually Department for Environment, Food and Rural Affairs (DEFRA - formerly FRCA) October 2015 Ramsar Sites Natural England April 2019 Bi-Annually Sites of Special Scientific Interest Natural England March 2019 Bi-Annually Special Areas of Conservation Natural England June 2019 Bi-Annually Special Protection Areas Natural England April 2019 Bi-Annually Order Number: 242475436_1_1 Date: 12-May-2020 rpr_ec_datasheet v53.0 A Landmark Information Group Service Page 102 of 104 Data Suppliers A selection of organisations who provide data within this report Data Supplier Data Supplier Logo Ordnance Survey Environment Agency Scottish Environment Protection Agency The Coal Authority British Geological Survey Centre for Ecology and Hydrology Natural Resources Wales Scottish Natural Heritage Natural England Public Health England Ove Arup Peter Brett Associates Order Number: 242475436_1_1 Date: 12-May-2020 rpr_ec_datasheet v53.0 A Landmark Information Group Service Page 103 of 104 Useful Contacts Contact Name and Address Contact Details 1 British Geological Survey - Enquiry Service Telephone: 0115 936 3143 Fax: 0115 936 3276 British Geological Survey, Environmental Science Centre, Keyworth, Email: [email protected] Nottingham, Nottinghamshire, NG12 5GG Website: www.bgs.ac.uk 2 Environment Agency - National Customer Contact Telephone: 03708 506 506 Centre (NCCC) Email: [email protected] PO Box 544, Templeborough, Rotherham, S60 1BY 3 Doncaster Metropolitan Borough Council - Telephone: 01302 734444 Environmental Services Fax: 01302 734949 Website: www.doncaster.gov.uk Floor 3, Council House, College Road, Doncaster, South Yorkshire, DN1 1RN 4 Environment Agency - Head Office Telephone: 01454 624400 Fax: 01454 624409 Rio House, Waterside Drive, Aztec West, Almondsbury, Bristol, Avon, BS32 4UD 5 Ordnance Survey Telephone: 03456 05 05 05 Email: [email protected] Adanac Drive, Southampton, Hampshire, SO16 0AS Website: www.ordnancesurvey.gov.uk 6 Health and Safety Executive Website: www.hse.gov.uk 5S.2 Redgrave Court, Merton Road, Bootle, L20 7HS 7 Doncaster Metropolitan Borough Council Telephone: 01302 734854 Fax: 01302 734949 PO Box 257, The Council House, Doncaster, South Yorkshire, DN1 3EP Website: www.doncaster.gov.uk 8 The Coal Authority - Property Searches Telephone: 0345 762 6848 Fax: 01623 637 338 200 Lichfield Lane, Mansfield, Nottinghamshire, NG18 4RG Email: [email protected] Website: www2.groundstability.com 9 PointX Website: www.pointx.co.uk 7 Abbey Court, Eagle Way, Sowton, Exeter, Devon, EX2 7HY 10 Doncaster Metropolitan Borough Council Telephone: 01302 734854 Fax: 01302 734949 Danum House, St Sepulchre Gate, Doncaster, South Yorkshire, DN1 1UB Website: www.doncaster.gov.uk - Public Health England - Radon Survey, Centre for Telephone: 01235 822622 Radiation, Chemical and Environmental Hazards Fax: 01235 833891 Email: [email protected] Chilton, Didcot, Oxfordshire, OX11 0RQ Website: www.ukradon.org - Landmark Information Group Limited Telephone: 0844 844 9952 Fax: 0844 844 9951 Imperium, Imperial Way, Reading, Berkshire, RG2 0TD Email: [email protected] Website: www.landmarkinfo.co.uk Please note that the Environment Agency / Natural Resources Wales / SEPA have a charging policy in place for enquiries. Order Number: 242475436_1_1 Date: 12-May-2020 rpr_ec_datasheet v53.0 A Landmark Information Group Service Page 104 of 104 Historical Mapping Legends Ordnance Survey County Series 1:10,560 Ordnance Survey Plan 1:10,000 1:10,000 Raster Mapping Historical Mapping & Photography included: Mapping Type Scale Date Pg Yorkshire 1:10,560 1851 - 1854 3 Yorkshire 1:10,560 1893 - 1894 4 Yorkshire 1:10,560 1893 5 Yorkshire 1:10,560 1904 - 1907 6 Yorkshire 1:10,560 1931 7 Yorkshire 1:10,560 1931 8 Yorkshire 1:10,560 1938 9 Yorkshire 1:10,560 1946 - 1948 10 Ordnance Survey Plan 1:10,000 1955 - 1956 11 Ordnance Survey Plan 1:10,000 1966 12 Ordnance Survey Plan 1:10,000 1972 13 Doncaster 1:10,000 1976 14 Ordnance Survey Plan 1:10,000 1980 - 1984 15 Ordnance Survey Plan 1:10,000 1992 16 10K Raster Mapping 1:10,000 2000 17 10K Raster Mapping 1:10,000 2006 18 VectorMap Local 1:10,000 2020 19 Historical Map - Slice A Order Details 2UGHU1XPEHU BB &XVWRPHU5HI 1DWLRQDO*ULG5HIHUHQFH 6OLFH $ 6LWH$UHD +D 6HDUFK%XIIHU P Site Details 6DLFD1DWXU:KDUI5RDG:KHDWOH\'21&$67(5'167 7HO )D[ :HE ZZZHQYLURFKHFNFRXN $/DQGPDUN,QIRUPDWLRQ*URXS6HUYLFHY0D\ 3DJHRI Russian Military Mapping Legends 1:5,000 and 1:10,000 mapping 1:25,000 mapping Key to Numbers on Mapping Historical Mapping & Photography included: SE50SE_Doncaster Mapping Type Scale Date Pg Yorkshire 1:10,560 1851 - 1854 3 1R 'HVFULSWLRQ )DFWRU\ *DV Yorkshire 1:10,560 1893 - 1894 4 6DZPLOO Yorkshire 1:10,560 1893 5 )DFWRU\ )ODPPDEOH$QG/XEULFDQW0DWHULDOV Yorkshire 1:10,560 1904 - 1907 6 3RVW2IILFH Yorkshire 1:10,560 1931 7 3RVW2IILFH Yorkshire 1:10,560 1931 8 3RVW2IILFH Yorkshire 1:10,560 1938 9 %XV6WDWLRQ Yorkshire 1:10,560 1946 - 1948 10 3XPSLQJ6WDWLRQ Ordnance Survey Plan 1:10,000 1955 - 1956 11 Ordnance Survey Plan 1:10,000 1966 12 Ordnance Survey Plan 1:10,000 1972 13 Doncaster 1:10,000 1976 14 Ordnance Survey Plan 1:10,000 1980 - 1984 15 Ordnance Survey Plan 1:10,000 1992 16 10K Raster Mapping 1:10,000 2000 17 10K Raster Mapping 1:10,000 2006 18 VectorMap Local 1:10,000 2020 19 Russian Map - Slice A Order Details 2UGHU1XPEHU BB &XVWRPHU5HI 1DWLRQDO*ULG5HIHUHQFH 6OLFH $ 6LWH$UHD +D 6HDUFK%XIIHU P Site Details 6DLFD1DWXU:KDUI5RDG:KHDWOH\'21&$67(5'167 7HO )D[ :HE ZZZHQYLURFKHFNFRXN $/DQGPDUN,QIRUPDWLRQ*URXS6HUYLFHY0D\ 3DJHRI Yorkshire Published 1851 - 1854 Source map scale - 1:10,560 7KHKLVWRULFDOPDSVVKRZQZHUHUHSURGXFHGIURPPDSVSUHGRPLQDQWO\KHOG DWWKHVFDOHDGRSWHGIRU(QJODQG:DOHVDQG6FRWODQGLQWKHCV,Q WKH VFDOHZDVDGRSWHGIRUPDSSLQJXUEDQDUHDV WKHVHPDSVZHUH XVHGWRXSGDWHWKH PDSV7KHSXEOLVKHGGDWHJLYHQWKHUHIRUHLV RIWHQVRPH\HDUVODWHUWKDQWKHVXUYH\HGGDWH%HIRUH DOO26PDSV ZHUHEDVHGRQWKH&DVVLQL3URMHFWLRQZLWKLQGHSHQGHQWVXUYH\VRIDVLQJOH FRXQW\RUJURXSRIFRXQWLHVJLYLQJULVHWRVLJQLILFDQWLQDFFXUDFLHVLQRXWO\LQJ DUHDV,QWKHODWH CVD3URYLVLRQDO(GLWLRQZDVSURGXFHGZKLFKXSGDWHG WKH PDSSLQJIURPDQXPEHURIVRXUFHV7KHPDSVDSSHDU XQILQLVKHGZLWKDOOPLOLWDU\FDPSVDQGRWKHUVWUDWHJLFVLWHVUHPRYHG7KHVH PDSVZHUHLQLWLDOO\RYHUSULQWHGZLWKWKH1DWLRQDO*ULG,Q WKHILUVW PDSVZHUHSURGXFHGXVLQJWKH7UDQVYHUVH0HUFDWRU3URMHFWLRQ7KH UHYLVLRQSURFHVVFRQWLQXHGXQWLOUHFHQWO\ZLWKQHZHGLWLRQVDSSHDULQJHYHU\ \HDUVRUVRIRUXUEDQDUHDV Map Name(s) and Date(s) Historical Map - Slice A Order Details 2UGHU1XPEHU BB &XVWRPHU5HI 1DWLRQDO*ULG5HIHUHQFH 6OLFH $ 6LWH$UHD +D 6HDUFK%XIIHU P Site Details 6DLFD1DWXU:KDUI5RDG:KHDWOH\'21&$67(5'167 7HO )D[ :HE ZZZHQYLURFKHFNFRXN $/DQGPDUN,QIRUPDWLRQ*URXS6HUYLFHY0D\ 3DJHRI Yorkshire Published 1893 - 1894 Source map scale - 1:10,560 7KHKLVWRULFDOPDSVVKRZQZHUHUHSURGXFHGIURPPDSVSUHGRPLQDQWO\KHOG DWWKHVFDOHDGRSWHGIRU(QJODQG:DOHVDQG6FRWODQGLQWKHCV,Q WKH VFDOHZDVDGRSWHGIRUPDSSLQJXUEDQDUHDV WKHVHPDSVZHUH XVHGWRXSGDWHWKH PDSV7KHSXEOLVKHGGDWHJLYHQWKHUHIRUHLV RIWHQVRPH\HDUVODWHUWKDQWKHVXUYH\HGGDWH%HIRUH DOO26PDSV ZHUHEDVHGRQWKH&DVVLQL3URMHFWLRQZLWKLQGHSHQGHQWVXUYH\VRIDVLQJOH FRXQW\RUJURXSRIFRXQWLHVJLYLQJULVHWRVLJQLILFDQWLQDFFXUDFLHVLQRXWO\LQJ DUHDV,QWKHODWH CVD3URYLVLRQDO(GLWLRQZDVSURGXFHGZKLFKXSGDWHG WKH PDSSLQJIURPDQXPEHURIVRXUFHV7KHPDSVDSSHDU XQILQLVKHGZLWKDOOPLOLWDU\FDPSVDQGRWKHUVWUDWHJLFVLWHVUHPRYHG7KHVH PDSVZHUHLQLWLDOO\RYHUSULQWHGZLWKWKH1DWLRQDO*ULG,Q WKHILUVW PDSVZHUHSURGXFHGXVLQJWKH7UDQVYHUVH0HUFDWRU3URMHFWLRQ7KH UHYLVLRQSURFHVVFRQWLQXHGXQWLOUHFHQWO\ZLWKQHZHGLWLRQVDSSHDULQJHYHU\ \HDUVRUVRIRUXUEDQDUHDV Map Name(s) and Date(s) Historical Map - Slice A Order Details 2UGHU1XPEHU BB &XVWRPHU5HI 1DWLRQDO*ULG5HIHUHQFH 6OLFH $ 6LWH$UHD +D 6HDUFK%XIIHU P Site Details 6DLFD1DWXU:KDUI5RDG:KHDWOH\'21&$67(5'167 7HO )D[ :HE ZZZHQYLURFKHFNFRXN $/DQGPDUN,QIRUPDWLRQ*URXS6HUYLFHY0D\ 3DJHRI Yorkshire Published 1893 Source map scale - 1:10,560 7KHKLVWRULFDOPDSVVKRZQZHUHUHSURGXFHGIURPPDSVSUHGRPLQDQWO\KHOG DWWKHVFDOHDGRSWHGIRU(QJODQG:DOHVDQG6FRWODQGLQWKHCV,Q WKH VFDOHZDVDGRSWHGIRUPDSSLQJXUEDQDUHDV WKHVHPDSVZHUH XVHGWRXSGDWHWKH PDSV7KHSXEOLVKHGGDWHJLYHQWKHUHIRUHLV RIWHQVRPH\HDUVODWHUWKDQWKHVXUYH\HGGDWH%HIRUH DOO26PDSV ZHUHEDVHGRQWKH&DVVLQL3URMHFWLRQZLWKLQGHSHQGHQWVXUYH\VRIDVLQJOH FRXQW\RUJURXSRIFRXQWLHVJLYLQJULVHWRVLJQLILFDQWLQDFFXUDFLHVLQRXWO\LQJ DUHDV,QWKHODWH CVD3URYLVLRQDO(GLWLRQZDVSURGXFHGZKLFKXSGDWHG WKH PDSSLQJIURPDQXPEHURIVRXUFHV7KHPDSVDSSHDU XQILQLVKHGZLWKDOOPLOLWDU\FDPSVDQGRWKHUVWUDWHJLFVLWHVUHPRYHG7KHVH PDSVZHUHLQLWLDOO\RYHUSULQWHGZLWKWKH1DWLRQDO*ULG,Q WKHILUVW PDSVZHUHSURGXFHGXVLQJWKH7UDQVYHUVH0HUFDWRU3URMHFWLRQ7KH UHYLVLRQSURFHVVFRQWLQXHGXQWLOUHFHQWO\ZLWKQHZHGLWLRQVDSSHDULQJHYHU\ \HDUVRUVRIRUXUEDQDUHDV Map Name(s) and Date(s) Historical Map - Slice A Order Details 2UGHU1XPEHU BB &XVWRPHU5HI 1DWLRQDO*ULG5HIHUHQFH 6OLFH $ 6LWH$UHD +D 6HDUFK%XIIHU P Site Details 6DLFD1DWXU:KDUI5RDG:KHDWOH\'21&$67(5'167 7HO )D[ :HE ZZZHQYLURFKHFNFRXN $/DQGPDUN,QIRUPDWLRQ*URXS6HUYLFHY0D\ 3DJHRI Yorkshire Published 1904 - 1907 Source map scale - 1:10,560 7KHKLVWRULFDOPDSVVKRZQZHUHUHSURGXFHGIURPPDSVSUHGRPLQDQWO\KHOG DWWKHVFDOHDGRSWHGIRU(QJODQG:DOHVDQG6FRWODQGLQWKHCV,Q WKH VFDOHZDVDGRSWHGIRUPDSSLQJXUEDQDUHDV WKHVHPDSVZHUH XVHGWRXSGDWHWKH PDSV7KHSXEOLVKHGGDWHJLYHQWKHUHIRUHLV RIWHQVRPH\HDUVODWHUWKDQWKHVXUYH\HGGDWH%HIRUH DOO26PDSV ZHUHEDVHGRQWKH&DVVLQL3URMHFWLRQZLWKLQGHSHQGHQWVXUYH\VRIDVLQJOH FRXQW\RUJURXSRIFRXQWLHVJLYLQJULVHWRVLJQLILFDQWLQDFFXUDFLHVLQRXWO\LQJ DUHDV,QWKHODWH CVD3URYLVLRQDO(GLWLRQZDVSURGXFHGZKLFKXSGDWHG WKH PDSSLQJIURPDQXPEHURIVRXUFHV7KHPDSVDSSHDU XQILQLVKHGZLWKDOOPLOLWDU\FDPSVDQGRWKHUVWUDWHJLFVLWHVUHPRYHG7KHVH PDSVZHUHLQLWLDOO\RYHUSULQWHGZLWKWKH1DWLRQDO*ULG,Q WKHILUVW PDSVZHUHSURGXFHGXVLQJWKH7UDQVYHUVH0HUFDWRU3URMHFWLRQ7KH UHYLVLRQSURFHVVFRQWLQXHGXQWLOUHFHQWO\ZLWKQHZHGLWLRQVDSSHDULQJHYHU\ \HDUVRUVRIRUXUEDQDUHDV Map Name(s) and Date(s) Historical Map - Slice A Order Details 2UGHU1XPEHU BB &XVWRPHU5HI 1DWLRQDO*ULG5HIHUHQFH 6OLFH $ 6LWH$UHD +D 6HDUFK%XIIHU P Site Details 6DLFD1DWXU:KDUI5RDG:KHDWOH\'21&$67(5'167 7HO )D[ :HE ZZZHQYLURFKHFNFRXN $/DQGPDUN,QIRUPDWLRQ*URXS6HUYLFHY0D\ 3DJHRI Yorkshire Published 1931 Source map scale - 1:10,560 7KHKLVWRULFDOPDSVVKRZQZHUHUHSURGXFHGIURPPDSVSUHGRPLQDQWO\KHOG DWWKHVFDOHDGRSWHGIRU(QJODQG:DOHVDQG6FRWODQGLQWKHCV,Q WKH VFDOHZDVDGRSWHGIRUPDSSLQJXUEDQDUHDV WKHVHPDSVZHUH XVHGWRXSGDWHWKH PDSV7KHSXEOLVKHGGDWHJLYHQWKHUHIRUHLV RIWHQVRPH\HDUVODWHUWKDQWKHVXUYH\HGGDWH%HIRUH DOO26PDSV ZHUHEDVHGRQWKH&DVVLQL3URMHFWLRQZLWKLQGHSHQGHQWVXUYH\VRIDVLQJOH FRXQW\RUJURXSRIFRXQWLHVJLYLQJULVHWRVLJQLILFDQWLQDFFXUDFLHVLQRXWO\LQJ DUHDV,QWKHODWH CVD3URYLVLRQDO(GLWLRQZDVSURGXFHGZKLFKXSGDWHG WKH PDSSLQJIURPDQXPEHURIVRXUFHV7KHPDSVDSSHDU XQILQLVKHGZLWKDOOPLOLWDU\FDPSVDQGRWKHUVWUDWHJLFVLWHVUHPRYHG7KHVH PDSVZHUHLQLWLDOO\RYHUSULQWHGZLWKWKH1DWLRQDO*ULG,Q WKHILUVW PDSVZHUHSURGXFHGXVLQJWKH7UDQVYHUVH0HUFDWRU3URMHFWLRQ7KH UHYLVLRQSURFHVVFRQWLQXHGXQWLOUHFHQWO\ZLWKQHZHGLWLRQVDSSHDULQJHYHU\ \HDUVRUVRIRUXUEDQDUHDV Map Name(s) and Date(s) Historical Map - Slice A Order Details 2UGHU1XPEHU BB &XVWRPHU5HI 1DWLRQDO*ULG5HIHUHQFH 6OLFH $ 6LWH$UHD +D 6HDUFK%XIIHU P Site Details 6DLFD1DWXU:KDUI5RDG:KHDWOH\'21&$67(5'167 7HO )D[ :HE ZZZHQYLURFKHFNFRXN $/DQGPDUN,QIRUPDWLRQ*URXS6HUYLFHY0D\ 3DJHRI Yorkshire Published 1931 Source map scale - 1:10,560 7KHKLVWRULFDOPDSVVKRZQZHUHUHSURGXFHGIURPPDSVSUHGRPLQDQWO\KHOG DWWKHVFDOHDGRSWHGIRU(QJODQG:DOHVDQG6FRWODQGLQWKHCV,Q WKH VFDOHZDVDGRSWHGIRUPDSSLQJXUEDQDUHDV WKHVHPDSVZHUH XVHGWRXSGDWHWKH PDSV7KHSXEOLVKHGGDWHJLYHQWKHUHIRUHLV RIWHQVRPH\HDUVODWHUWKDQWKHVXUYH\HGGDWH%HIRUH DOO26PDSV ZHUHEDVHGRQWKH&DVVLQL3URMHFWLRQZLWKLQGHSHQGHQWVXUYH\VRIDVLQJOH FRXQW\RUJURXSRIFRXQWLHVJLYLQJULVHWRVLJQLILFDQWLQDFFXUDFLHVLQRXWO\LQJ DUHDV,QWKHODWH CVD3URYLVLRQDO(GLWLRQZDVSURGXFHGZKLFKXSGDWHG WKH PDSSLQJIURPDQXPEHURIVRXUFHV7KHPDSVDSSHDU XQILQLVKHGZLWKDOOPLOLWDU\FDPSVDQGRWKHUVWUDWHJLFVLWHVUHPRYHG7KHVH PDSVZHUHLQLWLDOO\RYHUSULQWHGZLWKWKH1DWLRQDO*ULG,Q WKHILUVW PDSVZHUHSURGXFHGXVLQJWKH7UDQVYHUVH0HUFDWRU3URMHFWLRQ7KH UHYLVLRQSURFHVVFRQWLQXHGXQWLOUHFHQWO\ZLWKQHZHGLWLRQVDSSHDULQJHYHU\ \HDUVRUVRIRUXUEDQDUHDV Map Name(s) and Date(s) Historical Map - Slice A Order Details 2UGHU1XPEHU BB &XVWRPHU5HI 1DWLRQDO*ULG5HIHUHQFH 6OLFH $ 6LWH$UHD +D 6HDUFK%XIIHU P Site Details 6DLFD1DWXU:KDUI5RDG:KHDWOH\'21&$67(5'167 7HO )D[ :HE ZZZHQYLURFKHFNFRXN $/DQGPDUN,QIRUPDWLRQ*URXS6HUYLFHY0D\ 3DJHRI Yorkshire Published 1938 Source map scale - 1:10,560 7KHKLVWRULFDOPDSVVKRZQZHUHUHSURGXFHGIURPPDSVSUHGRPLQDQWO\KHOG DWWKHVFDOHDGRSWHGIRU(QJODQG:DOHVDQG6FRWODQGLQWKHCV,Q WKH VFDOHZDVDGRSWHGIRUPDSSLQJXUEDQDUHDV WKHVHPDSVZHUH XVHGWRXSGDWHWKH PDSV7KHSXEOLVKHGGDWHJLYHQWKHUHIRUHLV RIWHQVRPH\HDUVODWHUWKDQWKHVXUYH\HGGDWH%HIRUH DOO26PDSV ZHUHEDVHGRQWKH&DVVLQL3URMHFWLRQZLWKLQGHSHQGHQWVXUYH\VRIDVLQJOH FRXQW\RUJURXSRIFRXQWLHVJLYLQJULVHWRVLJQLILFDQWLQDFFXUDFLHVLQRXWO\LQJ DUHDV,QWKHODWH CVD3URYLVLRQDO(GLWLRQZDVSURGXFHGZKLFKXSGDWHG WKH PDSSLQJIURPDQXPEHURIVRXUFHV7KHPDSVDSSHDU XQILQLVKHGZLWKDOOPLOLWDU\FDPSVDQGRWKHUVWUDWHJLFVLWHVUHPRYHG7KHVH PDSVZHUHLQLWLDOO\RYHUSULQWHGZLWKWKH1DWLRQDO*ULG,Q WKHILUVW PDSVZHUHSURGXFHGXVLQJWKH7UDQVYHUVH0HUFDWRU3URMHFWLRQ7KH UHYLVLRQSURFHVVFRQWLQXHGXQWLOUHFHQWO\ZLWKQHZHGLWLRQVDSSHDULQJHYHU\ \HDUVRUVRIRUXUEDQDUHDV Map Name(s) and Date(s) Historical Map - Slice A Order Details 2UGHU1XPEHU BB &XVWRPHU5HI 1DWLRQDO*ULG5HIHUHQFH 6OLFH $ 6LWH$UHD +D 6HDUFK%XIIHU P Site Details 6DLFD1DWXU:KDUI5RDG:KHDWOH\'21&$67(5'167 7HO )D[ :HE ZZZHQYLURFKHFNFRXN $/DQGPDUN,QIRUPDWLRQ*URXS6HUYLFHY0D\ 3DJH RI