Online ISSN : 2249-460X Print ISSN : 0975-587X DOI : 10.17406/GJHSS
KiteAerialPhotographyinGuyana IsWomenʼsFreedomaMythorReality
Mid-HoloceneAnthropogenicLandscapes HistoricalWorksinAmericanLiterature
VOLUME20ISSUE4VERSION1.0
Global Journal of Human-Social Science: D History, Anthropology & Archaeology
Global Journal of Human-Social Science: D History, Anthropology & Archaeology
Volume 0 Issue (Ver. 1.0)
Open Association of Research Society
Global Journals Inc. *OREDO-RXUQDORI+XPDQ (A Delaware USA Incorporation with “Good Standing”; Reg. Number: 0423089) Social Sciences. 2020. Sponsors:Open Association of Research Society Open Scientific Standards $OOULJKWVUHVHUYHG
7KLVLVDVSHFLDOLVVXHSXEOLVKHGLQYHUVLRQ Publisher’s Headquarters office RI³*OREDO-RXUQDORI+XPDQ6RFLDO 6FLHQFHV´%\*OREDO-RXUQDOV,QF Global Journals ® Headquarters $OODUWLFOHVDUHRSHQDFFHVVDUWLFOHVGLVWULEXWHG XQGHU³*OREDO-RXUQDORI+XPDQ6RFLDO 945th Concord Streets, 6FLHQFHV´ Framingham Massachusetts Pin: 01701, 5HDGLQJ/LFHQVHZKLFKSHUPLWVUHVWULFWHGXVH United States of America (QWLUHFRQWHQWVDUHFRS\ULJKWE\RI³*OREDO -RXUQDORI+XPDQ6RFLDO6FLHQFHV´XQOHVV USA Toll Free: +001-888-839-7392 RWKHUZLVHQRWHGRQVSHFLILFDUWLFOHV USA Toll Free Fax: +001-888-839-7392 1RSDUWRIWKLVSXEOLFDWLRQPD\EHUHSURGXFHG Offset Typesetting RUWUDQVPLWWHGLQDQ\IRUPRUE\DQ\PHDQV HOHFWURQLFRUPHFKDQLFDOLQFOXGLQJ SKRWRFRS\UHFRUGLQJRUDQ\LQIRUPDWLRQ Global Journals Incorporated VWRUDJHDQGUHWULHYDOV\VWHPZLWKRXWZULWWHQ 2nd, Lansdowne, Lansdowne Rd., Croydon-Surrey, SHUPLVVLRQ Pin: CR9 2ER, United Kingdom 7KHRSLQLRQVDQGVWDWHPHQWVPDGHLQWKLV ERRNDUHWKRVHRIWKHDXWKRUVFRQFHUQHG 8OWUDFXOWXUHKDVQRWYHULILHGDQGQHLWKHU Packaging & Continental Dispatching FRQILUPVQRUGHQLHVDQ\RIWKHIRUHJRLQJDQG QRZDUUDQW\RUILWQHVVLVLPSOLHG Global Journals Pvt Ltd (QJDJHZLWKWKHFRQWHQWVKHUHLQDW\RXURZQ E-3130 Sudama Nagar, Near Gopur Square, ULVN Indore, M.P., Pin:452009, India 7KHXVHRIWKLVMRXUQDODQGWKHWHUPVDQG FRQGLWLRQVIRURXUSURYLGLQJLQIRUPDWLRQLV JRYHUQHGE\RXU'LVFODLPHU7HUPVDQG Find a correspondence nodal officer near you &RQGLWLRQVDQG3ULYDF\3ROLF\JLYHQRQRXU ZHEVLWHKWWSJOREDOMRXUQDOVus WHUPVDQG FRQGLWLRQPHQXLG1463/ To find nodal officer of your country, please email us at [email protected] %\UHIHUULQJXVLQJUHDGLQJDQ\W\SHRI DVVRFLDWLRQUHIHUHQFLQJWKLVMRXUQDOWKLV VLJQLILHVDQG\RXDFNQRZOHGJHWKDW\RXKDYH eContacts UHDGWKHPDQGWKDW\RXDFFHSWDQGZLOOEH ERXQGE\WKHWHUPVWKHUHRI Press Inquiries: [email protected] $OOLQIRUPDWLRQMRXUQDOVWKLVMRXUQDO DFWLYLWLHVXQGHUWDNHQPDWHULDOVVHUYLFHVDQG Investor Inquiries: [email protected] RXUZHEVLWHWHUPVDQGFRQGLWLRQVSULYDF\ Technical Support: [email protected] SROLF\DQGWKLVMRXUQDOLVVXEMHFWWRFKDQJH DQ\WLPHZLWKRXWDQ\SULRUQRWLFH Media & Releases: [email protected]
Incorporation No.: 0423089 License No.: 42125/022010/1186 Registration No.: 430374 Import-Export Code: 1109007027 Pricing (E xcluding Air Parcel Charges): Employer Identification Number (EIN): USA Tax ID: 98-0673427 Yearly Subscription (Personal & Institutional) 250 USD (B/W) & 350 USD (Color)
Editorial Board
Global Journal of Human-Social Science
Dr. Heying Jenny Zhan Dr. Adrian Armstrong
B.A., M.A., Ph.D. Sociology, University of Kansas, USA BSc Geography, LSE, 1970 Ph.D. Geography Department of Sociology Georgia State University, (Geomorphology) Kings College London 1980 Ordained United States Priest, Church of England 1988 Taunton, Somerset, United Kingdom
Dr. Prasad V Bidarkota Dr. Gisela Steins
Ph.D., Department of Economics Florida International Ph.D. Psychology, University of Bielefeld, Germany University United States Professor, General and Social Psychology, University of Duisburg-Essen, Germany
Dr. Alis Puteh Dr. Stephen E. Haggerty
Ph.D. (Edu.Policy) UUM Sintok, Kedah, Malaysia M.Ed Ph.D. Geology & Geophysics, University of London (Curr. & Inst.) University of Houston, United States Associate Professor University of Massachusetts, United States
Dr. André Luiz Pinto Dr. Helmut Digel
Doctorate in Geology, PhD in Geosciences and Ph.D. University of Tbingen, Germany Honorary President Environment, Universidade Estadual Paulista Julio of German Athletic Federation (DLV), Germany de Mes uita Filho, UNESP, Sao Paulo, Brazil
Dr. Tanyawat Khampa Dr. Hamada Hassanein Ph.d in Candidate (Social Development), MA. in Social Ph.D, MA in Linguistics, BA & Education in English, Development, BS. in Sociology and Anthropology, Department of English, Faculty of Education, Mansoura Naresuan University, Thailand University, Mansoura, Egypt Dr. Gomez-Piqueras, Pedro Dr. Asuncin Lpez-Varela Ph.D in Sport Sciences, University Castilla La Mancha, BA, MA (Hons), Ph.D. (Hons) Facultad de Filolog?a. Spain Universidad Complutense Madrid 29040 Madrid Spain
Dr. Faisal G. Khamis Dr. Mohammed Nasser Al-Suqri
Ph.D in Statistics, Faculty of Economics & Ph.D., M.S., B.A in Library and Information Management,
Administrative Sciences / AL-Zaytoonah University of Sultan Qaboos University, Oman
Jordan, Jordan
Dr. Giaime Berti Dr. Vesna Stankovic Pejnovic
Ph.D. School of Economics and Management University Ph. D. Philosophy Zagreb, Croatia Rusveltova, Skopje of Florence, Italy Macedonia
Dr. Valerie Zawilski Dr. Raymond K. H. Chan
Associate Professor, Ph.D., University of Toronto MA - Ph.D., Sociology, University of Essex, UK Associate Ontario Institute for Studies in Education, Canada Professor City University of Hong Kong, China
Dr. Edward C. Hoang Dr. Tao Yang
Ph.D., Department of Economics, University of Ohio State University M.S. Kansas State University B.E. Colorado United States Zhejiang University, China
Dr. Intakhab Alam Khan Mr. Rahul Bhanubhai Chauhan
Ph.D. in Doctorate of Philosophy in Education, King B.com., M.com., MBA, PhD (Pursuing), Assistant Professor, Abdul Aziz University, Saudi Arabia Parul Institute of Business Administration, Parul University, Baroda, India
Dr. Kaneko Mamoru Dr. Rita Mano
Ph.D., Tokyo Institute of Technology Structural Ph.D. Rand Corporation and University of California, Los Engineering Faculty of Political Science and Economics, Angeles, USA Dep. of Human Services, University of Haifa Waseda University, Tokyo, Japan Israel
Dr. Joaquin Linne Dr. Cosimo Magazzino
Ph. D in Social Sciences, University of Buenos Aires, Aggregate Professor, Roma Tre University Rome, 00145, Argentina Italy
Dr. Hugo Nami Dr. S.R. Adlin Asha Johnson
Ph.D.in Anthropological Sciences, Universidad of Ph.D, M. Phil., M. A., B. A in English Literature, Bharathiar Buenos Aires, Argentina, University of Buenos Aires, University, Coimbatore, India Argentina
Dr. Luisa dall’Acqua Dr. Thierry Feuillet
Ph.D. in Sociology (Decisional Risk sector), Master MU2, Ph.D in Geomorphology, Master’s Degree in College Teacher, in Philosophy (Italy), Edu-Research Geomorphology, University of Nantes, France Group, Zrich/Lugano
Contents of the Issue
i. Copyright Notice ii. Editorial Board Members iii. Chief Author and Dean iv. Contents of the Issue
1. Participatory Mapping of Mid-Holocene Anthropogenic Landscapes in Guyana with Kite Aerial Photography. 1-15 2. The Defense of Brazilian Civilization from the Criticism to the use of Perfumes: Doctors in Medicine in Bahia of the XIX Century. 17-29 3. The Issue of Historical Works in American Literature. 31-36 4. La Capacidad De "No Poder Hacer Milagros": Reflexiones Sobre El Abastecimiento De Las Expediciones De 1715, 1718 Y 1720. 37 -53 5. “Is Women’s Freedom a Myth or Reality”? The Context of Working-Class Women in Bangladesh. 55-64 6. Resource Inventory and Conservation Guidelines for a Historical Site. 65-69
v. Fellows vi. Auxiliary Memberships vii. Preferred Author Guidelines viii. Index
Global Journal of HUMAN-SOCIAL SCIENCE: D History, Archaeology & Anthropology Volume 20 Issue 4 Version 1.0 Year 2020 Type: Double Blind Peer Reviewed International Research Journal Publisher: Global Journals Online ISSN: 2249-460x & Print ISSN: 0975-587X
Participatory Mapping of Mid-Holocene Anthropogenic Landscapes in Guyana with Kite Aerial Photography By Isaac Shearn & Michael J. Heckenberger Coppin State University Abstract- The nature and degree of human modifications of humid tropical forests in Amazonia have been widely debated over the past two decades. Many regions provide significant evidence of late Holocene anthropogenic influence by settled populations, but the antiquity of human interventions is still poorly understood due to a lack of earlier archaeological sites across the broad region, particularly pertaining to the mid-Holocene. Here we report on Amerindian occupations spanning the period from ca. 6000-3000 BP along the middle Berbice River, Guyana, including early evidence in Amazonia of cultural practices widely considered indicative of settled villages, notably terra preta or “black earth” soils, mound construction, and ceramic technology. These more settled occupations of the mid-Holocene initiated a trajectory of landscape domestication extending into historical times, including larger-scale late Holocene social formations. Collaborative research with local indigenous communities, including archaeological excavations, landscape mapping using kite based aerial photography, and three-dimensional photogrammetry, was designed to promote the decolonization of archaeological knowledge production and encourage indigenous ownership of Amerindian history and cultural heritage in Guyana. Keywords: amazonia; archaeology; mid-holocene; human-natural systems; indigenous peoples.
GJHSS-D Classification: FOR Code: 160199
ParticipatoryMappingofMidHoloceneAnthropogenicLandscapesinGuyanawithKiteAerialPhotography
Strictly as per the compliance and regulations of:
© 2020. Isaac Shearn & Michael J. Heckenberger. This is a research/review paper, distributed under the terms of the Creative Commons Attribution-Noncommercial 3.0 Unported License http://creativecommons.org/licenses/by-nc/3.0/), permitting all non- commercial use, distribution, and reproduction in any medium, provided the original work is properly cited. Participatory Mapping of Mid-Holocene Anthropogenic Landscapes in Guyana with Kite Aerial Photography
Isaac Shearn α & Michael J. Heckenberger σ
Abstrac t - The nature and degree of human modifications of northern Amazonia (Arroyo-Kalin 2010; Burger and humid tropical forests in Amazonia have been widely debated Rosenswig 2012; Oliver 2008). over the past two decades. Many regions provide significant Excavations at the Dubulay site and the evidence of late Holocene anthropogenic influence by settled mapping of associated earthworks provide a rare 2020 populations, but the antiquity of human interventions is still perspective on early settled communities and the poorly understood due to a lack of earlier archaeological sites
proliferation of landscape domestication features ear
across the broad region, particularly pertaining to the mid- Y Holocene. Here we report on Amerindian occupations associated with villages during the mid-Holocene in spanning the period from ca. 6000-3000 BP along the middle Amazonia. These document the deep antiquity and 1 Berbice River, Guyana, including early evidence in Amazonia scale of human influences on these mosaic tropical of cultural practices widely considered indicative of settled forest ecologies, which do not conform to still popular villages, notably terra preta or “black earth” soils, mound views of sparse and ephemeral human interventions construction, and ceramic technology. These more settled across most Amazonian forest environments (Barlow, et occupations of the mid-Holocene initiated a trajectory of al. 2012; McMichael, et al. 2012; Piperno, et al. 2015). landscape domestication extending into historical times, The six-millennial culture history of the Middle Berbice including larger-scale late Holocene social formations.
Collaborative research with local indigenous communities, River documents substantial dynamic change in including archaeological excavations, landscape mapping coupled human-natural systems, which has important using kite based aerial photography, and three-dimensional implications for global debate regarding climate change photogrammetry, was designed to promote the decolonization and biodiversity, as well as indigenous cultural heritage. of archaeological knowledge production and encourage indigenous ownership of Amerindian history and cultural a) The Geographical and Historical Context of Moundbuilding in Guyana )
heritage in Guyana. D
Although Amazonia was long viewed as the (
Keywords: amazonia; archaeology; mid-holocene; Volume XX Issue IV Version I human-natural systems; indigenous peoples. world’s iconic pristine tropical forest, archaeology and historical ecology over the past two decades suggest I. INTRODUCTION substantial human influence, rivaling other major world forest regions in antiquity, scale and density of esearch in the Berbice region of Guyana provides indigenous populations in pre-modern times (Clement,
- evidence for mid-Holocene human occupations et al. 2015; Heckenberger and Neves 2009; Roosevelt R with unexpectedly early dates for ceramics, 2013). These views emphasize long-term change in settled villages, and agricultural innovations centered on dynamic coupled natural-human systems, including landscape management (Shearn, et al. 2017; substantial pre-colonial modifications of the natural Whitehead, et al. 2010). This included earthen mound- environment, climate change and catastrophic post- building, wetland management systems, and soil contact depopulation (Balée and Erickson 2006; engineering practices designed to improve the sandy Denevan 2001; McEwan, et al. 2001; Rostain 2012; and often impoverished savannah soils into productive Schaan 2012). Most regional specialists agree that parts anthropogenic soils, generally referred to as Amazonian of the region supported substantial socio-historical dark earth or ADE (Woods, et al. 2009). These findings diversity, including cultural innovations and change are indicative of large settlements and regional socio- similar in antiquity and scale to other parts of the Global Journal of Human Social Science political integration by ca. 5000-4500 BP, extending the Americas, including diverse forager occupations and antiquity of these cultural innovations associated with initial plant domestication by the early Holocene, settled “formative” cultures in interior tropical forest settings of agricultural technologies by the middle to late Holocene and densely settled regional polities during late pre- Author α: Ph.D., Department of Applied Political and Social Science, colonial times. Health and Human Services Building, Room 535, Coppin State University, United States. e-mail: [email protected] The cultural history in most areas remains Author σ: Ph.D., Department of Anthropology, 1112 Turlington Hall, poorly resolved, notably for initial settled human University of Florida, Gainesville, United States. occupations during the middle Holocene (ca. 6000-3000
©2020 Global Journals Participatory Mapping of Mid-Holocene Anthropogenic Landscapes in Guyana with Kite Aerial Photography
BP). Our findings document the deep antiquity of populations (Rostain 2008a; Rostain 2010), but cannot cultural innovations widely associated with settled be attributed to the mid-Holocene occupations. communities and associated landscape modifications, The enduring occupation and scale of including ceramics, terra preta (ADE) and major earthen modification reflected in the mounds, associated with mounds. Early mound-building marks the onset of an early ceramic technologies in the region, and the ADE initial or “formative” period of settled village life and soils that were used to construct it, indicate significant regional organization (5000-4000 BP), roughly landscape modification in mid-Holocene times. In contemporaneous with developments in US Southeast, Guyana, this appears to have involved the management Mesoamerica and Andean areas (Arroyo-Kalin 2010; of diverse forest, wetland and savanna resources, but Burger and Rosenswig 2012; Oliver 2008). Human- did not necessarily involve clear-cutting of forests for made mounds and early ceramics are seen to indicate gardening. These initial signs of settled life appear the transition to settled or semi-settled communities, during the mid-Holocene Warm Period (Pachauri, et al. although typically associated with shell mounds across 2014; Prado, et al. 2013). Environmental changes due to northern South America (Roosevelt, et al. 1991; climate clearly would have impacted human-nature Roosevelt 1995). The scale and uniqueness of the interactions, particularly the warmer and wetter 2020 Dubulay mound suggests that this site was more than a conditions of northern South America (Silva Dias, et al.
ear structurally elaborated autonomous village and indicates 2009), and more intensive management of forest Y participation in and some degree of integration within a resources and plant cultivation during this time may
2 regional social group, suggested by similar age ADE have enhanced forest cover in the warmer climates of deposits and diagnostic Dubali ceramics at the Hitia the mid-Holocene (Carson, et al. 2014). These and other sites downstream from Dubulay. Major public occupations clearly represent a substantial footprint on constructions at the Dubulay site from ca. 5000 to 4600 the local landscape, including significant changes in BP suggest that changes in social and symbolic human interactions with plant and animal populations, systems, notably public ritual, were equally as important as reflected in ADE. At the very least, the complexity of as techno-economic change tied to food procurement in the mid-Holocene landscapes of the Middle Berbice the transition to more settled life (Burger and Rosenswig attest that detailed archaeological survey and mapping 2012; Flannery 1976; Lathrap 1977). The proliferation of is necessary to investigate pre-colonial and historic mound sites radiating from the middle Berbice socio-ecological heterogeneity and dynamic change, represents a pattern of agricultural innovation that including documented intra- and inter-regional variation. parallels innovations in ceramic stylistic technologies Moundbuilding is well documented during the late- Shearn, et al. 2017). We propose that these innovations Holocene along coastal regions of the Guianas, )
D are associated with a shift toward more communal however, the origins of the practice and extent to which
(
Volume XX Issue IV Version I landscape management projects. such practices were common, remain open questions The mid-Holocene occupations document for the development of diverse agricultural practices in changes in subsistence strategies related to ADE Amazonia (Clement, et al. 2015; Denevan 2001; formation, often taken to indicate early agricultural Denevan 2003; Iriarte, et al. 2020; McKey, et al. 2010; practices (Oliver 2008). The ADE deposits at the Rostain 2008a; Rostain 2008b; Rostain 2010; Rostain
- Dubulay and Hitia sites suggest domestic refuse 2012). Artificial mounds are reported in coastal regions disposal and probable associated house gardening north of the Guiana plateau in areas dominated by Arroyo-Kalin 2010), the role agricultural crops played in Arawak-speaking peoples, often associated with the subsistence systems during this period awaits Mabaruma sub-tradition (Saladoid-Barrancoid tradition) paleoethnobotanical and geochemical studies of ADE (Evans and Meggers 1960; Plew 2005; Rostain 2012; deposits. A variety of plants used by historically known Williams 2003). In addition to pre-colonial agricultural Arawak language-speaking groups were widely raised fields (Iriarte, et al. 2010; Rostain 2010), recent available by mid-Holocene times across the broad research documents many different kinds of mound region, including early domesticates, such as manioc landscapes of natural origin, including round mounds and maize, but plant use likely focused on the large (Renard, et al. 2012b). The presence of naturally
Global Journal of Human Social Science repertoire of useful non- and semi-domesticated occurring mound features in seasonally flooded species and diversified production systems (Clement, et savanna landscapes has been well documented, and al. 2010; Piperno and Pearsall 1998). The degree to important recent research adopts a historical ecological which house gardening and other casual horticulture approach to investigate the feedback loop created practices were supplemented by more extensive non- between anthropogenic inputs and other ecosystem domestic farming practices, including construction and “managers” such as termites and earthworms (Iriarte, et cultivation of savanna mounds, is uncertain. Forest al. 2010; McKey, et al. 2014; McKey, et al. 2010; slash-and-burn gardening and common use of small Renard, et al. 2012a; Renard, et al. 2012b). In Brazil, agricultural mounds are known for late Holocene similar mound fields, or campos de murundus were
©2020 Global JournalsJournals Participatory Mapping of Mid-Holocene Anthropogenic Landscapes in Guyana with Kite Aerial Photography evaluated to test hypotheses about their construction excavations in the study area were undertaken in 2009, evaluating whether termite construction or differential followed by intensive fieldwork in 2011. In 2014 a return erosion was likely to cause the formation of mounds trip was made to complete the ceramic analysis of the (Silva, et al. 2010). They conclude that erosion was more 2011 materials with local participants in Guyana and to likely than termite nesting, but an anthropogenic origin map the mound sites that were associated with known was not considered. While it cannot be confirmed archaeological sites with the Wiruni/Matara indigenous conclusively that the small, round mounds tested in the community. The results of the archaeological middle Berbice result from human intervention, there are excavations and the mapping of the mound sites are a range of other earthen features that are clearly cultural, discussed here. including large linear single mounds, large village mounds, and an excavated ditch around a circular a) Excavations of Village and Domestic Mound mound interpreted as a platform for a domestic Contexts structures. Terminal pre-colonial to early historic Research conducted in a ~400 km² study area agricultural populations developed farming in areas along the middle Berbice identified 10 pre-colonial sites, away from major habitation sites, including historical use including the large (5-8 ha) Dubulay and Hitia sites,
situated on high (20-25 m), non-inundated river bluffs. 2020 of mounds by contemporary Arawak communities in the Berbice (Whitehead, et al. 2010). Site survey was conducted along the Berbice River, Wiruni Creek and Kaikuchen stream and involved ear Y b) The Survey Area: Middle Berbice, Guyana extensive walk-over inspection and soil augers (8 cm The study area is located approximately 80 km 3 bucket) and test pit excavations (50-x-50-cm and from the mouth of the Berbice River at the junction with 1-x-1-m). Wiruni Creek, the location of the modern Wiruni village, Fieldwork at the Dubulay site included extensive but the distance by boat is about 160 km along the surface inspection and soil augers to determine site winding Berbice River (Figure 1). As one travels boundaries; hand-excavated trench excavations were upstream closed tropical rainforest dominates the positioned to bisect mound 1 and test adjacent areas in landscape, but by the middle reached of the Berbice eastern portions of the site and in central site areas; River downstream to mouth environments are a mixture excavation units (1-x-1-m) were placed along trench of forest areas, including low-lying forests along the river walls and in western portions of the site (Heckenberger, and its tributaries, and open savannah. These et al. 2012). Trench 1 (25 m), adjacent to a 1-m-x-50-cm savannahs often include small forest islands in the study test pit, and trench 4 (10 m) provided cross-sections of areas, which may also have resulted from past the deepest portions of the artificial mound, maximally management strategies, as noted elsewhere in such extending to ≈ 4.0 m deep. Two 1 -x-1-m units were ) transitional settings (Posey and Balée 1989). Models of D
excavated from the west wall of trench 1 to depths of 3.6 ( the topography surrounding Dubulay were developed to Volume XX Issue IV Version I m (N966/W998) and 2.6 m (N978/W998). One predict where water channels would have flowed under excavation unit (1-x-1-m) and two block excavations (4- wetter late-Holocene conditions (Prado, et al. 2013) to x-4-m) were conducted along trench 5 to expose whole further contextualize the anthropogenic features with ceramic vessels and associated domestic areas respect to the dynamic landscape. adjacent to the northern part of the mound 1. Two 1-x-1-
In total, six areas were mapped using the kite- - m units were excavated in western site areas (Locus 2). based photography technique. Four of the areas are Excavation of units 1-x-1-m and greater was located on Dubulay Ranch property, including the ranch conducted in 50-x-50-cm horizontal sub-units, or area itself (the location of 2011 University of Florida quadrants, and in 10 cm arbitrary vertical levels using excavations), two fields of agricultural mounds (referred sharpened shovels, trowels, and fine-grain excavation to here as Mound Group 2 and 3), and the well-known, tools. All sediment was passed through 0.65 cm mesh yet poorly understood linear mounds west of the ranch. hardware cloth. After excavation, all units were profiled, Two additional areas along the Wiruni Creek were photographed, and “grab samples” (81 samples of > mapped; Red Hill, which is located directly on the creek, 500 g) were trowel-collected from all discernable strata. and Matara, which is located approximately 1 km north Soil sampling using an 8 cm diameter bucket auger was of the creek, beyond the historic (Dutch) Fort Nassau. Global Journal of Human Social Science conducted across the site to 2 m depth and changes in
II. METHODS sediment composition and color were noted, including along the mound apex to determine length and variation Here we adopt an archaeological and in depth. ethnographic approach augmented with photogrammetric and spatial analytical methods in order b) Participatory Mapping with Three-Dimensional to associate specific mounds formations with other Photogrammetry evidence of human occupations. After first being In order to contextualize the findings from the identified by Joe Singh in 1986, and identified as Dubulay site with features of the surrounding landscape- Amerindian in origin, preliminary archaeological including forest islands and dry creeks and drainages,
©2020 Global Journals Participatory Mapping of Mid-Holocene Anthropogenic Landscapes in Guyana with Kite Aerial Photography
and round domestic mounds, linear earthworks, and cm thick), notably darker than basal (pre-cultural) several clusters of round conical mounds produced by compact clays and intervening sterile strata in western humans and or soil engineers in terminal mid-Holocene portions of the Dubulay site. They were encountered 80- to mid-Holocene times-reconnaissance teams scouted 150 cm deep, beneath a thick ADE deposit, and and investigated many nearby areas in 2011 that were contained sporadic carbonized botanical remains and then revisited in 2014 to produce better maps of the ceramics (Figure 2), suggesting repeated use of features. domestic areas with intervening natural eolian In 2014, the method utilized for mapping the deposition. A basal date of 6130 BP was obtained from mounds consisted involved participation of local the base (60-80 cm) of the dark ADE anthrosol (20-80 community members to gain insight into the location cm), which contained abundant ceramic and organic and ecological conditions of mound areas. The team of remains. Such pronounced ADE midden deposits are participants from the local communities shared their commonly attributed to household disposal activities, extremely detailed local ecological knowledge helping reflecting more enduring occupations and producing us to rapidly identify locales with mounds and target rich soils for house gardening (Arroyo-Kalin 2010; those areas without having to survey random fields in Woods and McCann 1999). A charcoal-rich layer (60-70 2020 search of mounds. The aim of kite mapping was to cm) in N1390/W1319 that contained >10 small ceramic
ear generate high resolution three-dimensional maps of the sherds was dated to 5825 BP. N1390/W1319 was Y mound areas (Aber, et al. 2002). We used a pair of 7m excavated adjacent to the 2009 test pit that produced a
4 and 9m delta kites to fly cameras over mound areas to C14 age estimate of 5140 BP from the lowest deposits capture aerial imagery. For this project, we used a kite containing cultural remains (60-70 cm). An early ADE for two main reasons. We wanted the mapping of the midden (4710 BP) was also identified along the western mounds to be a participatory and educational project for bank of the Berbice River at the Hitia site, roughly 20 km local communities to get involved with, and because it downstream. represents the lowest-cost solution, making it the most b) Village and Ceremonial Mound widely accessible and easiest entry point into the By 4650 BP, a large river bluff mound was method. We cannot ignore the affect that a kite, as constructed at the Dubulay site, which distinguished it opposed to a drone, has on the perception of our from Hitia and other sites in the study area. The earthen research when abroad. The tradeoff is not in terms of mound measures ~200 x 50 m (~20,000 m³ of moved the quality of data returned, but in the ability to get earth) along the bluff, which plunges an additional ~25 consistent coverage of broad areas. For that reason, our m to the river channel, giving the mound an imposing results were often irregularly shaped slices of landscape ) vertical face from the river, with largely intact stratigraphy
D that more or less captured all mounded areas in a
( to a maximal depth of over 4 m at the mound apex Volume XX Issue IV Version I contiguous landform. The images were processed (Figure 2). Radiocarbon dates suggest it was using Agisoft PhotoScan to utilize stereoscopic constructed during a relatively short time, perhaps a few photogrammetry to produce a high-resolution digital generations. The mound was created by repeated, terrain model from which a digital elevation model highly patterned construction episodes, preserved in 39 (DEM) and an orthomosaic were constructed. alternating “couplets” of lighter, thicker and sandier - layers capped with darker ADE. Large ceramic III. RESULTS fragments were often orientated horizontally within a) Archaeological Excavations at Dubulay Ranch darker micro-strata, suggesting intentional capping and Four mid-Holocene components were defined compaction over light, sandy layers to enhance at Dubulay (Shearn, et al. 2017): 1) initial stratified structural stability. Basal light layers are mottled and occupations of mobile or semi-settled populations, pre- extremely compact due in part to mixing with underlying
6000 BP; 2) initial settled occupations, including ADE clay-rich natural strata. Ceramics were associated with and ceramics, ca. 6000-5000 BP; 3) construction of a all micro-strata, including the deepest, but were much major ceremonial mound, ca. 5000-4500 BP; and 4) denser in mid- to upper dark layers. continued occupations in areas around the mound until The stratigraphy of the mound was fairly Global Journal of Human Social Science ca. 3,000 (Figure 2, Table 1). Occupations continued continuous across higher portions of the mound, through the late Holocene, including possible mound northern portions of trench 1 and across trench 4, farming in savanna areas near the Dubulay site by ca. including well stratified mound deposits (>50 cm), 3000-2000 BP, and historically and archaeologically dating to 4690-4614 BP, and mixed upper strata, documented occupations by Berbice Arawak characterized by a homogeneous dark macro-stratum communities reported from the early 1600s to the created by later pre-colonial and historic hoe and present (Whitehead, et al. 2010). mechanized agriculture and construction activities. Early mid-Holocene occupations, ca. 6000-5000 Lower stratified strata are pinched off toward southern BP, were identified as thin stratified anthrosols (~5-10 portions of Trench 1. The mound is composed of
©20©2020 Global Journals Participatory Mapping of Mid-Holocene Anthropogenic Landscapes in Guyana with Kite Aerial Photography substantial ADE, although not from in-situ domestic d) Surrounding Mound Groups waste disposal or composting behavior. The extremely Investigations conducted in savanna and dark color, oily texture and ceramic density of these scrubland areas adjacent to the pre-colonial occupation charcoal-infused deposits document substantial local sites in forested areas along the Berbice River and ADE formation, which were intentionally redeposited as Wiruni Creek documented a variety of anthropogenic mound construction elements. The associated ceramics features, including small residential sites, forest islands, assemblage is also notable for the large quantity of as well as low conical mounds of possible human origin sherds in mound fill, indicative of more than casual situated along the slopes rising from stream-beds, production. The construction of the mound also informs several of which are seasonally dry. us about other aspects of mid-Holocene cultural i. Mound Group 2 industries, notably the relation between early ceramic We were led to Mound Group 2 by Reard, the technologies and formation of highly modified ADE. manager at Dubulay Ranch. Reard was an expert A technofunctional and stylistic analysis of source of information about the mounds, the landscape ceramic remains excavated in 2011 was conducted in surrounding those mounds, and the recent history of
2014 (Shearn, et al. 2017), so only a brief description of land-use that may have affected the distribution and 2020 the ceramics is presented here. There were two main preservation of mound sites. Mound Group 2 is located features of the ceramic assemblages that were identified on a gentle slope, which, although truncated by the tree ear Y in the analysis that required explanation and were line, leads down to a creek bed to the west (Figure 4). relevant to the proposed interpretation of the Mound group 2 is a very typical example of the types of 5 relationship between village sites and mound sites. locations we came to find the majority of the mound These included the sequence of stylistic innovation that sites. Notably, the mounds were found consistently began during construction of the mound consisting of along gently sloping ground rising from a pond or creek- small- to medium-sized coiled, low-fired vessels with bed, but are theorized to have been wetter during other predominately sand tempers decorated by small periods. appliqué strips in simple geometric designs giving way The distance between Mound Group 2 and the rapidly to more complex, or cross-hatched designs on settlement at Dubulay is approximately 7.5 km. Mound the rims. The second feature of the assemblage we Group 2 is near the western edge of the Dubulay Ranch sought to explain was the apparently intentional property, approximately 4 km east of the Kaikuchen deposition of five serving vessels in a cache on the Creek mounds, which were tested in 2011. Furthermore, outskirts of the Dubulay Village site. In 2017, the authors the mound group itself extends further to the north, and put forward the hypothesis that both of these innovative likely into the forest to the northwest, although these ) features of the ceramic assemblage were related to D
areas were not captured during our kite survey of the ( innovations in agriculture, a hypothesis we expand upon area. More extensive mapping of the savannah will Volume XX Issue IV Version I here with an analysis of innovations in relationships with provide better information about the boundaries, and the landscape. sizes of these mound fields, while more technology, such as LIDAR (which has the capability to penetrate c) Linear Mound Group tree cover) might be necessary to identify mounds
The linear mound features are located inside the forested areas. - approximately 3-4 km west of the 2011 excavations, and just north of the Wanyabo creek, an excellent source of ii. Mound Group 3 fresh water. Although several of the linear features can Mound Group 3 represents the agricultural be seen in the map provided above, several are difficult mounds most closely associated with the excavations at to make out because of the low vertical profile that many Dubulay, at approximately 3.5 km to the northwest, and of the linear mounds feature, as well as the high grass across a drainage that has been impacted by modern cover both on and off the mounds. However, when ranching activities. Despite the setting of Mound Group looking at the digital elevation model (generated with the 3 on an opposing drainage from Dubulay, we assume same software) the linear features are easier to resolve that if the mounds here were agricultural, and used during a time period overlapping with occupations at
and exhibit three distinct patterns. (Figure 3). 1) Linear, Global Journal of Human Social Science near parallel mounds that potentially radiate from a Dubulay, that these would likely have served as similar point, 2) S-twist linear mounds, and 3) arcing agricultural fields to service those populations. The parallel linear mounds. The presence of linear and semi- intervening area east of the creek was also mapped, but circular earthwork features in savannah areas closely was found to be absent of mounds, which highlights the associated to the mound at Dubulay lends support to selective nature of mound locations in this region. Given the interpretation of nearby circular mounds as having the spacing between Mound Group 3 and the mound their origin in similar practices. sites across Wiruni Creek, it seems likely that future archaeological research will identify other settlements
©2020 Global Journals Participatory Mapping of Mid-Holocene Anthropogenic Landscapes in Guyana with Kite Aerial Photography
closer to Mound Group 3, as well as affiliation with IV. DISCUSSION: ANALYSIS OF MOUND occupation sites along Wiruni Creek at Matara and PATTERNING Red Hill. One of the goals of the 2014 participatory e) Red Hill Mound Group research was to confirm that the mounds were man- Red Hill mounds are located north of Dubulay made, and not the result of ant hills, which is a Ranch, along the Wiruni creek. By boat, the distance to commonly held belief by many local people in the travel between the areas is 20 km, although over land, region. This observation is likely attributable to a feature the distance is roughly 10 km (Figure 5). It is of anthropogenic landscapes is South America wherein approximately 6 km west of the Matara group and 5-6 certain insect species inhabit former agricultural km NW of Mound Group 3. The mounds at Red Hill are mounds and serve to maintain the structure of human located primarily on the eastern face of the hill, as it constructed earthworks, as explained by McKey, et al. slopes down to the depression that was becomes a (2010). A number of contextual clues and archaeological drainage during the wet season and may have been a evidence support the interpretation of human creation of creek during wetter climatic conditions. these fields of mounds, which are linked to specific 2020 archaeological occupation sites in both time and space, f) Matara Mound Group however the role of humans in creation and function of ear The Matara mound group is located Y
the mounds is still uncertain. approximately 1.0 km² northeast of Fort Nassau, which
The patterning and spacing of the mound 6 is located 10.5 km away from Dubulay Ranch when clusters and the regularity with which they are found in travelling by boat, but over land, the sites are 6.5 km particular types of locations was investigated in the apart. In 1991, nearly 1000 similar mounds were region surrounding Dubulay, a known early residential counted, one of which was radiocarbon dated to ca. location. During the course of mapping the mounds in 1860 BP from a cross-section trench excavated by 2014, the crew observed that mound groups tended to Simon and Whitehead (Whitehead, et al. 2010). The be sited on landforms that slope down to existing Matara mounds represent the most extensive mound streams or seasonally dry stream beds. Additional groups we encountered, covering at least 85 hectares, analysis was conducted to evaluate additional and possibly more than a full square kilometer (Figure characteristics of the anthropogenic landscapes, 6). However, due to poor wind conditions on our only particularly aspects of terrain and hydrology. These were day to work there, we were unable to get complete used to develop hypotheses about the relationships of coverage of this vast area. However, Matara also mound groups to archaeological sites and landscape
) represents one of the most well-preserved mound sites. features. Spatial analysis of mound patterning was D
( Furthermore, the discovery of ceramic remains at the conducted using the nearest neighbor function in GIS, Volume XX Issue IV Version I site in 2011, make it the most likely to contain an which is designed to test of the likelihood that mounds associated village or settlement very nearby and is were randomly distributed over the study area, and therefore one of the highest priorities for additional whether the distribution conforms to a dispersed or investigation during future research. Interestingly, the clustered pattern if nonrandom. site features a forest island, which have been proposed McKey and Renard (McKey, et al. 2014; McKey, - to be associated with Amerindian settlements due to the et al. 2010; Renard, et al. 2012a; Renard, et al. 2012b) increased fertility of soils left behind human provide ample discussion of natural factors responsible occupations. for or contributing to common earthen features of the g) Kaikuchen Mound Group landscape attributed to human manufacture, which were As elsewhere in the study area, mounds near also likely tied to climate related environmental change Kaikuchen Creek (5-6 km west of the Dubulay site) are in these transitional environments. The creation and use situated along the slopes immediately adjacent small of the small, round mounds must be considered against tributaries and adjacent occupation sites in savanna the backdrop of the diversity and prominence of earthen areas. Testing in Kaikuchen evaluated a range of features across both forested areas along major rivers and streams and savannah areas, including ADE Global Journal of Human Social Science potentially anthropogenic features in the savanna including agricultural mounds, forest islands, and one middens, linear mounds, round domestic platforms with occupation site (Sandy Ridge). One mound measuring a low enclosing ditch and expanded or contracted , and 15 m in diameter was bisected, and bulk sediment the monumental construction at Dubulay. These samples were collected from each 10 cm of the profile, significant and enduring features of the built the lowest sample of which included small charcoal environment, suggest that the small, round mounds fragments that returned a basal (90-100 cm) age were also important resources for indigenous plant estimate of ca. 3250 BP. A 1-x-1-m test unit was management, including manioc, as known historically, excavated approximately 1050 m north/northeast of the and other plants that would benefit from the enhanced mound bisection (Figure 7). growing conditions on the mounds. The association of
©2020 Global Journals Participatory Mapping of Mid-Holocene Anthropogenic Landscapes in Guyana with Kite Aerial Photography specific mound areas to well dated archaeological sites, et al. 2012; Mittermeier, et al. 2003; Piperno, et al. 2015). the setting of mound sites with respect to slope and Mid-Holocene occupations affiliated with Dubali local hydrology, the spacing between mound sites, and complex extend across the transitional tropical forest the spacing between mounds within those sites and coastal hinterland interface from Suriname to the supports the conclusion that these features were middle Orinoco. These occupations significantly extend anthropogenic. the antiquity of human interventions associated with We used a 30 m global SRTM DEM to analyze more settled communities in the region, including ADE, slope and construct a hydrology model of the study mound-building and ceramic technology, and had an area. From this it was possible to project the extent of unexpectedly pronounced anthropogenic footprint in river systems during the height of rainy season, and it this mosaic tropical forest setting. The Mid-Holocene became clear the most sterile sandy soils can be found settled communities initiated a trajectory of landscape in these often-dry drainage basins, and the abutting domestication that expanded in the late Holocene times, grasslands that slope above them tend to contain the including semi-intensive management systems mounds we suspect were managed by mid-Holocene described in the 17th century Berbice and described for populations. The mound fields tend to be located on many other tropical forest settings, which were mutually 2020 gently sloping landforms, ranging from 1-4 degrees of sustaining of tropical forest in these transitional areas slope. When compared to a random selection of mound settings (Clement, et al. 2010). ear Y locations in the study area, our analysis showed that the Inter-disciplinary and multi-cultural collaborative selection of this range of slopes was nonrandom. research strategies that address centennial- and 7 The distance between the various agricultural millennial-scale data suggest that contemporary tropical mounds mapped, and the excavations at Dubulay forests are complex and highly textured palimpsests of Ranch, which proved to represent an approximately human-natural interactions reflecting the strategies of 5000-year-old village site, suggests that additional active human agents (Carson, et al. 2014; Dull, et al. village sites are likely to be associated with the 2010). Our findings suggest dynamic change and socio- agricultural mounds, particularly Mound Group 2, Red ecological systems, including substantial intra- and Hill Mounds, and Matara Mounds, all of which are inter-regional variation across the humid forests of between 7 and 10 km from the Dubulay excavations. Amazonia (Balée 2010; Balée and Erickson 2006; The distance between any two mound groups rarely Clement, et al. 2015; Denevan 2001; Heckenberger and exceeds 5 km and appears to have a tendency toward 4 Neves 2009; McEwan, et al. 2001; Roosevelt 2013), km between mound groups. For example, the five sites which prompt caution in broad extrapolations from mapped south of the Wiruni Creek, Dubulay, the Linear minimally classified orbital imagery and minimal )
Mounds, and Mound Group 3 form an equilateral exploratory sampling, which do not address the D
( triangle, 4 km on each side. Mound Group 2 is almost remarkable heterogeneity and change within regions Volume XX Issue IV Version I exactly 4 km west of the Linear mounds, and Kaikuchen across Amazonia. The research contributes to global is another 4 km west of Mound Group 2. Given the comparisons of pre-modern systems of forest pattern of 4 km intervals between mound groups, it is management and human modification of species and possible to predict the location of further mound groups eco-system biodiversity, often ignored in depictions of and villages, as well as additional connection between natural biodiversity of the Guiana shield (Balée 2010). - the mapped mound groups. The spacing of mounds in Initial settled life and concomitant changes in Mound Group 2, 3, Redhill, and Matara, was analyzed technology and built environment appear during the using the average nearest neighbor function in GIS, mid-Holocene climatic optimum in transitional which revealed a less than 1% chance that the mounds environments in northern and southern Amazonia, were randomly distributed, and that they conformed to a including early domestication and cultivated plants dispersed pattern. (Hilbert et al. 2017; Iriarte et al. 2020). The domesticated landscapes of the coastal hinterland transitional forests V. CONCLUSION suggest alternative conversion strategies to extensive The findings from the Dubulay sites and other clear-cutting. The return to untended (fallow) forests th th sites in the middle Berbice River contribute to growing from the 16 to 18 century contributed to the “Little Ice- Global Journal of Human Social Science consensus that the forested landscapes of Amazonia Age” as large settled populations were decimated by were substantially transformed by fairly large Amerindian disease and colonial oppression (Denevan 1996). populations. This raises doubt about claims of sparse Mid-Holocene occupations affiliated with the human populations and ephemeral impacts on the Dubali complex and other similar complexes across the natural forest environment, as suggested from many transitional tropical forest and coastal hinterland lowland forests and, in particular, Guiana shield tropical interface from Suriname to the middle Orinoco, had an forests in the absence of systematic archaeological unexpectedly pronounced anthropogenic footprint in survey and testing (e.g., Barlow, et al. 2012; McMichael, this mosaic transitional tropical forest. These
©2020 Global Journals Participatory Mapping of Mid-Holocene Anthropogenic Landscapes in Guyana with Kite Aerial Photography
communities were not only uniquely adapted to the well as pride of place among native peoples, including tropical forest but potentially mutually sustaining of cultural heritage rights. transitional lowland tropical forest settings, particularly sensitive to climate fluctuations and human influence. Acknowledgments These early occupations established an enduring Investigations were supported by the US cultural frontier between settled groups of the northern National Science Foundation, including preliminary Guiana piedmont and coastal lowlands and often investigations (8/2009; OCE 092370), primary fieldwork smaller-scale and more mobile upland groups within reported here (7-8/2011; BCS 1022537), and regional networks. participatory mapping and ethnoecology (9/13-6/15; The six-millennial history of the Middle Berbice BCS 1323876). The project was sponsored by the underscores the fact that contemporary tropical forests University of Guyana (UG) and the Guyana Ministry of are complex and highly textured palimpsests of human- Culture, Youth and Sports (MCYS). Numerous natural interactions reflecting the strategies of active individuals contributed to the field project, including UF human agents (Erickson and Balée 2006). They graduate students, and UG undergraduates and over a document sophisticated systems of land management dozen local assistants. Support from the indigenous 2020 uniquely adapted to the tropical ecology, which is often community of Matara was critical to research reported ignored in depictions of the biodiversity of the Guiana here. In Guyana, Alex Mendes, Joseph Singh, Alim ear Y
shield (Willis, et al. 2004). The culture history and Hosein, Jenny Wishart provided valuable insights on the
8 historical ecology of these settled populations, including research, as did Minister Frank Anthony (MCYS). sophisticated systems of indigenous land management Numerous individuals contributed to the field project in uniquely adapted to the tropical ecology of these areas, Guyana, including Marcus Cuffy, Trevon Baird, Andrew therefore has vital implications for current debates in Campbell, Leyperth King, Tedroy King Jr., and Kurleigh biodiversity, ecological resilience and sustainable King. In addition, Joseph Singh, and Reard Elias were development, including forest restoration in transitional particularly helpful in supporting the project. The project ecological settings, as well as pride of place among was first developed by Dr. Neil L. Whitehead native peoples, including cultural heritage rights (UWisconsin; NSF Co-PI) and George Simon, who are (Denevan 1996; Staver, et al. 2011). Through our posthumously acknowledged for their critical participation with the local communities, over several contributions to the research reported here. Finally,
years, and the cooperation of team of cultural David Firman made significant contributions by helping anthropologists and archaeologists, this research helps to design the kite based data collection strategy, and to bring some evidence to bear on the local advising on data analysis. ) disagreement, as well as furthers our understanding of The ASTER V03 GDEM was retrieved from the D
( settlement trajectory and early agricultural strategies of online Data Pool, courtesy of the NASA Land Processes Volume XX Issue IV Version I pre-colonial Arawak groups in the region. Further Distributed Active Archive Center (LP DAAC), resolution of these deep cultural histories has important USGS/Earth Resources Observation and Science implications for current debates in biodiversity, (EROS) Center, Sioux Falls, South Dakota, https:// ecological resilience and sustainable development, as lpdaac.usgs.gov/data_access/data_pool".
- TABLES
Table 1: Radiocarbon dates for Dubulay and related sites along Middle Berbice River.
Area/Provenience/ Depth Conv. 14 C 2 Σ Age Range Lab # Context/Affiliation (cmbd**) age (mid-point)
Beta- Locus 1: N 966 W 998; N mound peak (upper); Late 4070 +/ - 30 Cal BP 4790 -4440 86 cm 305502* Dubali I complex BP (4615)
Global Journal of Human Social Science Beta- Locus 1: N 966 W 998; N mound peak (upper); Late 4120 +/ - 30 Cal BP 4820 -4530 180 - 190 cm 305503 Dubali I complex BP (4675)
Beta- Locus 1: N 966 W 998; N mound peak (upper); Late 4160 +/ - 40 Cal BP 4840 -4540 360 - 370 cm 306369 Dubali I complex BP (4690)
Beta- Locus 1: 2009 Test Pit: N mound peak; Late Dubali I 4290 +/ - 50 Cal BP 4960 -4820 130-140 cmbs 265991 complex BP (4890)
©2020 Global Journals Participatory Mapping of Mid-Holocene Anthropogenic Landscapes in Guyana with Kite Aerial Photography
Beta- Locus 1: N 1002 W 996; just W of mound; Dubali II 3050 +/- 30 Cal BP 3350-3210 80 - 90 cm 305505 complex BP (3280)
Beta- Locus 2: N 1393 W 1197: ADE area; Early Dubali I 5330 +/- 40 Cal BP 6270-5990 93 - 95 cm 305506 complex BP (6130)
Beta- 4330 +/- 80 Cal BP 5570-4710 Locus 2: 2009 Test Pit: non-ADE; Early Dubali I complex 60-70 cmbs 265990 BP (5140)
Beta- Locus 2: N 1390 W 1319: non-ADE; Early Dubali I 5030 +/- 40 Cal BP 5990-5660 60 - 70 cm 305507 complex BP (5825)
Beta- Hitia Test Pit 1: riverbank ADE midden; Late Dubali I 4170 +/- 40 Cal BP 4840-4570 80 - 90 cm 305508 complex BP (4705) 2020 Beta- Kaikuchen Trench 1; large circular mound; Dubali II/Post- 3030 +/- 30 Cal BP 3340-3160 90 - 100 cm 305509 Dubali complex BP (3250) ear Y
Notes: 9 * palm fruit, all others are wood charcoal; ** cmbd = cm below datum (arbitrary vertical control point); cmbs = cm below actual ground surface
Figures ) D
( Volume XX Issue IV Version I -
Global Journal of Human Social Science
Figure 1: Map of Study Area with areas of kite-mapping coverage associated with the principle site of Dubulay and surrounding mound complexes to the south of Wiruni Creek and Matara and Red Hill sites to the north.
©2020 Global Journals Participatory Mapping of Mid-Holocene Anthropogenic Landscapes in Guyana with Kite Aerial Photography 2020 ear Y
10 ) D
( Volume XX Issue IV Version I -
Figure 2: A. Schematic of mound 1 profile with radiocarbon dates; B. Overview photo of mound 1 post-excavation collection of soil samples by micro-stratigraphic unit; C. N996W998 during excavation (note partially slumped north wall); D. N978W998 during excavation. Global Journal of Human Social Science
©2020 Global Journals Participatory Mapping of Mid-Holocene Anthropogenic Landscapes in Guyana with Kite Aerial Photography
Figure 3: Linear Mound Group. A. Geo-referenced orthomosaic; B. Digital Elevation Model in photoscan. 2020 ear Y
11 ) D
( Volume XX Issue IV Version I -
Figure 4: Mound Group 2. A. Geo-referenced orthomosaic; B. Digital Elevation Model in photoscan. Global Journal of Human Social Science
©2020 Global Journals Participatory Mapping of Mid-Holocene Anthropogenic Landscapes in Guyana with Kite Aerial Photography 2020 ear Y
12
Figure 5: Red Hill Mound Group. A. Geo-referenced orthomosaic; B. Digital Elevation Model in photoscan. ) D
( Volume XX Issue IV Version I
- Figure 6: Matara Mound Group. A. Geo-referenced orthomosaic; B. Digital Elevation Model in photoscan.
Global Journal of Human Social Science
©2020 Global Journals Participatory Mapping of Mid-Holocene Anthropogenic Landscapes in Guyana with Kite Aerial Photography 2020 ear Y
13
Figure 7: A. Kaikuchen excavation showing open cavity in SW corner (upper right) were ceramic concentration was encountered at 20-30 cm below ground surface corresponds to; B. Kaikuchen mound trench bisection (carbonized botanical remains from a column sample returned a date of 3030 +/- 30 BP from 90-100 cm below ground surface); C. Map of Kaikuchen Area. References Cited impact of geometric earthwork construction in pre- Columbian Amazonia. Proceedings of the National 1. Aber, James S, Susan W Aber, and Firooza Pavri Academy of Sciences 111(29): 10497–10502. 2002 Unmanned Small Format Aerial Photography 8. Clement, Charles, Michelly De Cristo-Araújo, Geo From Kites Acquiring Large-Scale, High-Resolution, ) Coppens D’Eeckenbrugge, Alessandro Alves D
Multiview-Angle Imagery. International Archives of ( Pereira, and Doriane Picanço-Rodrigues 2010 Volume XX Issue IV Version I Photogrammetry Remote Sensing and Spatial Origin and Domestication of Native Amazonian Information Sciences 34(1):1–6. Crops. Diversity 2(1): 72. 2. Arroyo-Kalin, Manuel 2010 The Amazonian 9. Clement, Charles R., William M. Denevan, Michael J. formative: Crop domestication and anthropogenic Heckenberger, André Braga Junqueira, Eduardo G. soils. Diversity 2(4): 473–504. Neves, Wenceslau G. Teixeira, and William I. Woods - 3. Balée, William L. 2010 Long-term anthropic 2015 The domestication of Amazonia before influences on the diversity of amazonian land European conquest. Proceedings of the Royal scapes and biota. Diversity, Special Issue. Basel, Society B: Biological Sciences 282 (1812). Switzerland. 10. Denevan, William M. 1996 A Bluff Model of 4. Balée, William L., and Clark L. Erickson 2006 Time Riverine Settlement in Prehistoric Amazonia. Annals and complexity in historical ecology: studies in the of the Association of American Geographers 86 (4): neotropical lowlands: Columbia University Press. 654–681. 5. Barlow, Jos, Toby A. Gardner, Alexander C. Lees, 11. — 2001 Cultivated landscapes of Native Luke Parry, and Carlos A. Peres 2012 How pristine Amazonia and the Andes: triumph over the soil.
are tropical forests? An ecological perspective on Oxford, UK New York: Oxford University Press. Global Journal of Human Social Science the pre-Columbian human footprint in Amazonia 12. — 2003 Semi-intensive Pre-European Cultivation and implications for contemporary conservation. and the Origins of Anthropogenic Dark Earths in Biological Conservation 151(1): 45–49. Amazonia. In Amazonian Dark Earths: Explorations 6. Burger, Richard L., and Robert M. Rosenswig 2012 in Space and Time. B. Glaser and W.I. Woods, eds. Early New World Monumentality. Gainesville: Pp. 135–43. Berlin: Springer. University Press of Florida. 13. Dull, Robert A., Richard J. Nevle, William I. Woods, 7. Carson, John Francis, Bronwen S. Whitney, Francis Dennis K. Bird, Shiri Avnery, and William M. E. Mayle, José Iriarte, Heiko Prümers, J. Daniel Denevan 2010 The Columbian Encounter and the Soto, and Jennifer Watling 2014 Environmental Little Ice Age: Abrupt Land Use Change, Fire, and
©2020 Global Journals Participatory Mapping of Mid-Holocene Anthropogenic Landscapes in Guyana with Kite Aerial Photography
Greenhouse Forcing. Annals of the Association of Delphine Renard 2010 Pre-Columbian agricultural American Geographers 100(4): 755–771. landscapes, ecosystem engineers, and self- 14. Erickson, Clark L, and William Balée 2006 The organized patchiness in Amazonia. Proceedings historical ecology of a complex landscape in Bolivia. of the National Academy of Sciences 107 (17): Time and complexity in historical ecology: Studies in 7823–7828. the Neotropical Lowlands: 187–233. 25. McMichael, C. H., D. R. Piperno, M. B. Bush, M. R. 15. Evans, Clifford, and Betty Meggers 1960 Silman, A. R. Zimmerman, M. F. Raczka, and L. C. Archeological investigations in British Guiana. Lobato 2012 Sparse Pre-Columbian Human Washington,: U.S. Govt. Print. Off. Habitation in Western Amazonia. Science 336 16. Flannery, Kent, ed. 1976 The early Mesoameri- (6087): 1429–1431. can village. New York: Academic Press. 26. Mittermeier, R. A., C. G. Mittermeier, T. M. Brooks, J. 17. Heckenberger, Michael J., George Simon, J. D. Pilgrim, W. R. Konstant, G. A. B. da Fonseca, and Christian Russell, and Neil L. Whitehead 2012 C. Kormos 2003 Wilderness and biodiversity Berbice Archaeology Project: Report on 2011 conservation. Proceedings of the National Academy Investigations. the Amerindian Research Unit, of Sciences 100(18): 10309–10313. 2020 Department of Anthropology, University of Guyana 27. Oliver, José R 2008 The archaeology of agriculture
ear and the Ministry of Culture, Youth, and Sport, in ancient Amazonia. In The Handbook of South Y Georgetown, Guyana, Department of Anthropology American Archaeology. Pp. 185–216: Springer.
14 and Land-Use and Environmental Change Institute, 28. Pachauri, Rajendra K, Myles R Allen, Vicente R University of Florida. Barros, John Broome, Wolfgang Cramer, Renate 18. Heckenberger, Michael, and Eduardo Góes Neves Christ, John A Church, Leon Clarke, Qin Dahe, and 2009 Amazonian Archaeology. Annual Review of Purnamita Dasgupta 2014 Climate change 2014: Anthropology 38(1): 251–266. synthesis report. Contribution of Working Groups I, II 19. Iriarte, Jose, Sarah Elliott, S. Yoshi Maezumi, Daiana and III to the fifth assessment report of the Alves, Regina Gonda, Mark Robinson, Jonas Intergovernmental Panel on Climate Change: Ipcc. Gregorio de Souza, Jennifer Watling, and Josephine 29. Piperno, Dolores R, Crystal McMichael, and Mark B Handley 2020 The origins of Amazonian Bush 2015 Amazonia and the Anthropocene: What landscapes: Plant cultivation, domestication and the was the spatial extent and intensity of human spread of food production in tropical South landscape modification in the Amazon Basin at the America. Quaternary Science Reviews 248: 106582. end of prehistory? The Holocene 25(10):1588–1597. 20. Iriarte, José, Bruno Glaser, Jennifer Watling, Adam
) 30. Piperno, Dolores R., and Deborah M. Pearsall 1998
D Wainwright, Jago Jonathan Birk, Delphine Renard,
( The origins of agriculture in the lowland neotropics.
Volume XX Issue IV Version I Stéphen Rostain, and Doyle McKey 2010 Late San Diego: Academic Press. Holocene Neotropical agricultural landscapes: 31. Plew, Mark G 2005 The archaeology of Guyana: phytolith and stable carbon isotope analysis of Archaeopress. raised fields from French Guianan coastal 32. Posey, D. A., and W. Balée, eds. 1989 Resource savannahs. Journal of Archaeological Science management in Amazonia: Indigenous and folk
- 37(12): 2984–2994. strategies. New York: New York Botanical Garden. 21. Lathrap, Donald W. 1977 Our mother the cayman, 33. Prado, Luciane, Illaina Wainer, Christiano Chiessi, our father the gourd: Spinden revisited or a unitary model for the emergence of agriculture in the New Marie-Pierre Ledru, and Bruno Turcq 2013 A mid- World. In Origins of Agriculture. C. Reed, ed. Pp. Holocene climate reconstruction for eastern South America. 713–51. The Hague: Mouton. 34. Renard, D, J Iriarte, JJ Birk, S Rostain, B Glaser, and 22. McEwan, Colin, Cristiana Barreto, and Eduardo D McKey 2012a Ecological engineers ahead of Neves, eds. 2001 The unknown Amazon. Nature in their time: The functioning of pre-Columbian raised- culture in ancient Brazil. London: British Museum field agriculture and its potential contributions Press. to sustainability today. Ecological Engineering 45: Global Journal of Human Social Science 23. McKey, Doyle, Delphine Renard, Anne Zangerlé, 30–44. Jose Iriarte, Kisay Adame, Elena Suarez Jimenez, Axelle Solibiéda, Mélisse Durécu, Marion Comptour, 35. Renard, Delphine, Jago Jonathan Birk, Bruno Glaser, José Iriarte, Gilles Grisard, Johannes Karl, Stéphen Rostain, and Christine Raimond 2014 New approaches to pre-Columbian raised-field and Doyle McKey 2012b Origin of mound-field agriculture: the ecology of seasonally flooded landscapes: a multi-proxy approach combining contemporary vegetation, carbon stable isotopes savannas, and living raised fields in Africa, as and phytoliths. Plant and Soil 351(1): 337–353. windows on the past and future. 36. Roosevelt, A. C., R. A. Housley, M. Imazio da 24. McKey, Doyle, Stéphen Rostain, José Iriarte, Bruno Glaser, Jago Jonathan Birk, Irene Holst, and Silveira, S. Maranca, and R. Johnson 1991 Eighth
©2020 Global Journals Participatory Mapping of Mid-Holocene Anthropogenic Landscapes in Guyana with Kite Aerial Photography
Millennium Pottery from a Prehistoric Shell Midden 51. Woods, William I, Wenceslau G Teixeira, Johannes in the Brazilian Amazon. Science 254(1621-1624). Lehmann, Christoph Steiner, Antoinette Winkler 37. Roosevelt, Anna C. 1995 Early pottery in the Prins, and Lilian Rebellato 2009 Amazonian dark Amazon. Twenty years of scholarly obscurity. In The earths: Wim Sombroek's vision: Springer. emergence of pottery. W.K. Barnett and J.W. 52. Woods, William I., and Joseph M. McCann 1999 Hoopes, eds. Pp. 115–31. Washington and London: The Anthropogenic Origin and Persistence of Smithsonian Institution Press. Amazonian Dark Earths. Yearbook, Conference of 38. — 2013 The Amazon and the Anthropocene: Latin Americanist Geographers 25: 7–14. 13,000 years of human influence in a tropical rainforest. Anthropocene 4: 69–87. 39. Rostain, Stéphen 2008a Agricultural Earthworks on the French Guiana Coast. In Handbook of South American Archaeology. H. Silverman, and William Isbell, ed. Pp. 217–233. New York: Springer. 40. — 2008b The Archaeology of the Guianas: An 2020 Overview. In Handbook of South American
Archaeology. H. Silverman, and William H. Isbell, ear Y ed. Pp.? New York: Springer.
41. — 2010 Pre-Columbian Earthworks in Coastal 15 Amazonia. Diversity 2(3): 331. 42. —2012 Islands in the rainforest: Landscape management in pre-Columbian Amazonia. Walnut Creek, California: Left Coast Press. 43. Schaan, Denise P. 2012 Sacred Geographies of Ancient Amazonia: Historical ecology of social complexity,. New Frontiers in Historical Ecology Vol. 1. 44. Shearn, Isaac, Michael Heckenberger, and George Simon 2017 Ceramic Innovation at Dubulay, an Early Agricultural Village in the Middle Berbice, Guyana. Archaeology and Anthropology 21: 4–19. )
45. Silva Dias, Pedro L., Bruno Turcq, Maria Assunção D
(
F. Silva Dias, Pascale Braconnot, and Tatiana Volume XX Issue IV Version I Jorgetti 2009 Mid-Holocene Climate of Tropical South America: A Model-Data Approach. In Past Climate Variability in South America and Surrounding Regions: From the Last Glacial
Maximum to the Holocene. F. Vimeux, F. Sylvestre, - and M. Khodri, eds. Pp. 259-281. Dordrecht: Springer Netherlands. 46. Silva, Lucas CR, Gabriel D Vale, Ricardo F Haidar, and Leonel da SL Sternberg 2010 Deciphering earth mound origins in central Brazil. Plant and Soil 336(1-2): 3–14. 47. Staver, A. Carla, Sally Archibald, and Simon A. Levin 2011 The Global Extent and Determinants of Savanna and Forest as Alternative Biome States.
Science 334 (6053): 230–232. Global Journal of Human Social Science 48. Whitehead, Neil L., Michael J. Heckenberger, and George Simon 2010 Materializing the past among the Lokono (Arawak) of the Berbice River, Guyana. Antropológica 54 (114): 87–127. 49. Williams, Denis 2003 Prehistoric Guiana. Kingston, Jamaica: Ian Randle Publishers. 50. Willis, K. J., L. Gillson, and T. M. Brncic 2004 How "Virgin" Is Virgin Rainforest? Science 304(5669): 402–403.
©2020 Global Journals Participatory Mapping of Mid-Holocene Anthropogenic Landscapes in Guyana with Kite Aerial Photography
2020
ear Y
16
This page is intentionally left blank ) D
( Volume XX Issue IV Version I -
Global Journal of Human Social Science
©20©2020 Global Journals
Global Journal of HUMAN-SOCIAL SCIENCE: D History, Archaeology & Anthropology Volume 20 Issue 4 Version 1.0 Year 2020 Type: Double Blind Peer Reviewed International Research Journal Publisher: Global Journals Online ISSN: 2249-460x & Print ISSN: 0975-587X
The Defense of Brazilian Civilization from the Criticism to the use of Perfumes: Doctors in Medicine in Bahia of the XIX Century By Maria Salete Universidade Federal do Recôncavo da Bahia (UFRB) Abstract- In academic theses written by doctors in the 19th century state of Bahia (Brazil), we are confronted with the statement that perfumes are an evil to be avoided. Concerned with promoting the health of the population and establishing themselves in a country strongly marked by the dispute between different agents dedicated to healing, doctors trained at the Faculty of Medicine of Bahia, inaugurated in 1832, will insist on the pathological character of the aromatics and, with that, will place themselves against certain customs of colonial Brazil, as well as practices brought at the beginning of the century by the Portuguese Crown. The arguments simultaneously articulate body and morality in the construction of a discourse of truth that would constitute the scientific and aims at the same time to discuss and institute civilization in Brazil. Our goal is, based on the theses, to identify and understand some of the tensions that involve the different ways in which smells and perfumes were thought in the period. Keywords: perfumes; medicine theses; civilization; xix century; brazil. GJHSS-D Classification: FOR Code: 430199p
TheDefenseofBrazilianCivilizationfromtheCriticismtotheuseofPerfumesDoctorsinMedicineinBahiaoftheXIXCentury
Strictly as per the compliance and regulations of:
© 2020. Maria Salete. This is a research/review paper, distributed under the terms of the Creative Commons Attribution- Noncommercial 3.0 Unported License http://creativecommons.org/licenses/by-nc/3.0/), permitting all non-commercial use, distribution, and reproduction in any medium, provided the original work is properly cited. The Defense of Brazilian Civilization from the Criticism to the use of Perfumes: Doctors in Medicine in Bahia of the XIX Century
A Defesa Da Civilização Brasileira A Partir Da Crítica Ao Uso De Perfumes: Os Doutores Em Medicina Na Bahia De Século XIX1
Maria Salete 2020
Resumo - Em tese s acadêmicas escritas por médicos no I. Introdução ear estado da Bahia (Brasil) de século XIX, somos confrontados Y com a afirmação de que perfumes são um mal a ser evitado. ste artigo é parte de um esforço maior visando 17 Preocupados em promover a saúde da população e se compreender a conformação do gosto pelo estabelecerem num país fortemente marcado pela disputa perfu mar-se no Brasil, focalizando-se aqui a entre diferentes agentes dedicados à cura, os médicos E
região nordeste do país. Segundo Ashcar, até o século formados na Faculdade de Medicina da Bahia, inaugurada XIX, a maior parte da popula çã o brasileira desconhecia em 1832, insistirão no caráter patológico dos aromáticos e, com isso, se colocarão contra determinados costumes do perfumes, no sentido comercial. Com a vinda da família
Brasil colonial, bem como apráticas trazidas no início do real portuguesa para o Brasil, os portos foram abertos século pela Coroa Portuguesa. Os argumentos articulam em 1808 e inicio u-se, muito modestamente, a produ ção simultaneamente corpo e moralidade na construção de um local. Após a independ ência, em 1822, o Brasil , no discurso de verdade que constituiria o científico e visa entanto , já simultaneamente discutir e instituir a civilização no Brasil. O consumia perfumes com incrível avidez. Registros da época nosso objetivo é, a partir das teses, identificar e compreender mostram que em 1867 - durante o reinado de Pedro II, algumas das tensões que envolvem os diferentes modos sucessor do pai - o Brasil, por estranho que pareça, como cheiros e perfumes eram pensados no período. figurava entre os maiores importadores de perfumes ) Palavras-chave: perfumes; teses de medicina; D
franceses. Batidos apenas pela Inglaterra, o Brasil ( civilização; século xix; brasil. Volume XX Issue IV Version I importava 252 mil quilos - medida que consta da lista Abstract- In academic theses written by doctors in the 19th publicada em Le Livre des Parfums , livro editado em Paris century state of Bahia (Brazil), we are confronted with the em 1870 - enquanto Portugal não chegava a 19 mil. No statement that perfumes are an evil to be avoided. Concerned entanto, a ind ústria de higiene e perfumaria local só with promoting the health of the population and establishing come çaria a ter alguma expressão cerca de vinte anos themselves in a country strongly marked by the dispute depois (ASHCAR, 2001, p. 107). - between different agents dedicated to healing, doctors trained at the Faculty of Medicine of Bahia, inaugurated in 1832, will A explicaçã o in icia l pode estar relacionada ao insist on the pathological character of the aromatics and, with significado e papel dos cheiros no complexo formado that, will place themselves against certain customs of colonial entre magia-saúde-erotismo nas dinâmicas relacionais Brazil, as well as practices brought at the beginning of the cotidianas no Brasil desde os tempos coloniais. Tal century by the Portuguese Crown. The arguments simbolismo pode ter se prolongado nos modos de simultaneously articulate body and morality in the construction significaçã o direcionados aos perfumes comerciais of a discourse of truth that would co nstitute the scientific and recém-ingressos, apesar de sua produção remeter a aims at the same time to discuss and institute civilization in uma Europa que havia já avan ç ado consideravelmente Brazil. Our goal is, based on the theses, to identify and em diferenciação funcional autonomizando, mesmo understand some of the tensions that involve the different relativamente, o estético/erótico, o mágico-religioso, o Global Journal of Human Social Science ways in which smells and perfumes were thought in the period. econômico etc. em singulares esferas da vida. A Keywords: perfumes; medicine theses; civilization; xix historicidade das significações e dos gostos, contudo, century; brazil. precisa ser compreendida em suas continuidades e descontinuidades. Para tanto, devemos identificar e dar Author: Universidade Federal do Recôncavo da Bahia (UFRB). e-mail: [email protected] conta compreensivamente também dos atritos e
1 disputas inerentes ao processo a partir das figurações Este artigo é uma versão revista do trabalho apresentado no 18º Congresso Brasileiro de Sociologia (2017) e disponível no endereço: sociais, isto é, das redes relacionais em jogo. Deste < www.adaltech.com.br/anais/sociologia2017/resumos/PDF-eposter- modo, tom aremos um momento específico desta vasta trab-aceito-1349-1.pdf>.
©2020 Global Journals The Defense of Brazilian Civilization from the Criticism to the use of Perfumes: Doctors in Medicine in Bahia of the XIX Century
história e que diz respeitoao papel da medicina título de doutor em medicina, é decorrência das profissional, atrav és da atuação de seus representantes transformações em curso, ao tempo em que (os médicos diplomados que apresentaram teses na simultaneamente se constituiu como fator que ajudou a área), na efetiva ção de deslocamentos nos modos de catapultar a própria construção do “Brasil moderno” na significaçã o dos cheiros e das fragrâncias no Brasil, medida em que tal ordem de profissionais se colocou num momento de cruciais transformações no modo de como um dos avatares que operacionalizariam com vida dos habitantes do país: o final do século XIX. suas medidas higiênicas a construção da civilização Os médicos, nessa virada de sé culo, se brasileira. colocarão contra o uso dos perfumes, o que Frente à envergadura de tal intento, o tema poderíamos compreender a partir de argumentos perfume enquanto objeto de teses médicas parece um referidos às condições e possibilidades de contra-senso. De fato, não encontrei teses voltadas saúde/doença dos povos. Contudo, os argumentos exclusivamente às fragrâncias, que as colocasse como pinçados por estes profissionais articulam questões único objeto de atenção, mas o debate sobre cheiros e morais, e seus interlocutores são funcionalmente perfumes apareceu em algumas delas (no plural) variados, assumindo com estes relações de afinidade e conferindo destaque a eles, o que reforça a pertinência 2020 tensão. O debate foi parcialmente objetivado inclusive das questões levantadas. Aquilo que está posto de
ear em algumas teses médicas redigidas por esses pronto é que se trata de um debate a respeito de corpo, Y profissionais como resultado de suas suas reflex ões e comportamentos e civilização, ou seja, que incide no
18 estudos na Faculdade de Medicina. Desta forma, cruzamento entre biológico, psicológico e sócio- podemos perguntar: como compreender que mé dicos simbólico. eruditos do século XIX tenham voltado sua atenção ao Para entender o franco ataque dos profissionais debate sobre o uso de perfumes como parte de suas de medicina aos perfumes, tomarei como elemento teses de medicina? O que eram os cheiros e as articulador da discussão as teses de medicina fragrâ ncias nesse contexto e qual a ordem de redigidas no século XIX por tais profissionais na deslocamentos nos significados dos odores e do Faculdade de Medicina da Bahia e adicionalmente perfumar-se que tais profissionais tencionavam operar? textos jornalísticos da época. Inicialmente, mesmo Mais especificamente, desejamos, a partir das teses de ultrapassando um pouco a referência ao XIX, considerei medicina da Faculdade Medicina da Bahia, redigidas como universo os 2.502 trabalhos produzidos no na segunda metade do sé culo XIX e in ício de sé culo XX, período de 1840 a 1928. Deste, cujo acesso inicial foi identificar e compreender os significados atribuídos a apenas aos títulos das obras, devido ao acervo não cheiros, perfumes e seus usos por parte desses estar em sua grande maioria digitalizado, fiz uma )
D profissionais tendo como horizonte o desejo de dar seleção de 38 (trinta e oito) teses, cujos títulos
(
Volume XX Issue IV Version I conta do gosto e consumo de perfumes no Brasil, remontavam diretamente a questões de especificamente no nordeste, do hoje - horizonte este comportamento e/ou faziam referência direta ao tema cuja discussão se dará em trabalhos futuros. Assim, da civilização. Deste material pré-selecionado, algumas não se trata de uma análise das teses, mas de tom á-las poucas teses não foram encontradas nas estantes ou como material que contribui à compreens ão da relação estavam em estado muito precário de conservação,
- estabelecida pelas pessoas no Brasil com os perfumes. inviabilizando seu manuseio. Ainda assim, o material se No que toca ao recorte espec ífico que mostrou rico quanto a seu potencial de instigar circunscreve este trabalho, precisamos sublinhar que o perguntas e possibilitar hipotéticas respostas sobre o século XIX foi marcador de alterações de grande monta modo como o perfume, enquanto tema, não pode ser quanto aos modos de vida levados a cabo no Brasil por relegado à condição de “mera perfumaria”.Isso porque suas diferentes gentes: vinda da corte portuguesa; a fala desses médicos está em relação de abertura dos portos às “Na ções amigas”; interdependência com as atuações de outras Independ ência; abolição da escravatura; proclama ção pessoas/grupos que compunham as redes relacionais da República … Estes eventos, funcionalmente no XIX e que são acionadas direta ou indiretamente por articulados entre si, conformaram a base para o esses profissionais, a exemplo da Igreja, da
Global Journal of Human Social Science desenvolvimento do projeto de transformar o Brasil aristocracia, da família brasileira e dos diferentes outros numa civilização, rompendo seus laços com um recente curadores, lembrando que os médicos estavam passado colonial que prolongava suas raízes no mais preocupados com a nascente família burguesa subterrâneo da vida dos habitantes do lugar. A abertura brasileira, e é a ela que eles voltam o seu discurso e das escolas de medicina na Bahia e no Rio de Janeiro, suas práticas. bem como sua posterior transforma ção em Faculdade II. Teses e as Teses Sobre os Cheiros de Medicina em 1832 nas duas localidades, a formar não mais cirurgi õ es e sim mé dicos com a possibilidade O debate sobre os cheiros e as fragrâncias é de apresenta rem teses na área e, deste modo, obter o direcionado às mulheres, na condição de suas
©2020 Global Journals The Defense of Brazilian Civilization from the Criticism to the use of Perfumes: Doctors in Medicine in Bahia of the XIX Century principais usuárias, no caso do perfume, e por conta de desestabilizaria, uma vez que a disseminação dos uma alegada condição de maior vulnerabilidade modos de vida da corte se dava junto e ao interior da orgânica. No caso das teses de medicina, tratam-se de construção de um sentido de nacionalidade e dele mulheres de uma burguesia ainda nascente em solo faziam parte. Para conviver com a corte e, mais nacional. Conforme, por exemplo, Antônio Dias Coelho, propriamente, se parecer com ela, era preciso viver na tese Algumas Proposições sobre Temperamentos como ela, ou seja, aprender uma série de novos (1853), as mulheres têm predisposição ao esquemas de relacionamento antagônicosao modo de temperamento sanguíneo, o que as torna volúveis, vida das mulheres no Brasil. Estas deveriam ser inconstantes e suscetíveis a inflamações e reeducadas a partir dos princípios que norteavam o hemorragias1. O médico sugere que as mulheres mundo aristocrático. Ora, os médicos serão contra a evitem tudo aquilo que possa acionar sua participação das mulheres nas formas de sociabilidade “susceptibilidade nervosa”, inclusive “o exercício mundanas trazidas pela corte: apurado das faculdades intellectuaes". No entanto, a [Moça educada à moderna, criada no meio da vinda da família real portuguesa para o Brasil no início athmosphera dos salões de bailes, onde respiram as do século havia apresentado e promovido o exercício infecções dos tumulos de envolta com particulas odoriferas 2020 de um novo modo de sociabilidade, o cortesão, que se de variadas essencias, onde ouvem à cada passo phrases tão lisongeiras, quanto aleivosas e perfidas,] Moças da laia contrapunha frontalmente à concepção de preservação ear Y da mulher nos termos apresentados por Coelho. A corte desta, cá em nossa humilde opinião, darão sempre mais trouxe e ajudou a disseminar um modo de vida pública valor e apreço ao esplendor do ouro, ao brilho das pedras 19 preciosas, que lhe asseguram entrada franca nas altas marcada por bailes, saraus e apresentações de teatro, sociedades - mundo luxurioso e eivado de immoralidade e ligada à excitação dos sentidos, que obrigava as seducções -, do que a um coração nobre e generoso. - mulheres a introjetar modos de relacionamento com os Mulheres assim formadas sacrificam sempre á belleza quais elas não estavam acostumadas e não haviam physica o bello moral; os deveres conjugaes, o amor sido preparadas, uma vez que os cuidados com as materno, e os interesses da familia são esquecidos pelos mulheres no período colonial eram postos em prática a desejos de agradar, de prender as attenções, de pizar partir da estratégia do confinamento doméstico, que as triunphalmente sobre o macio tapete dos dourados salões, relegava a uma vida reclusa, de saída às ruas quase n’esse mundo aristocratico e corruptor - perfeita antithese da verdadeira civilisação (Mello, 1851, nota 1, p. 06). exclusivamente para ir às missas, e em que eram proibidas, inclusive, de espreitar as janelas para Diferente de interpretações que serão correntes observar os transeuntes; sua educação sendo restrita a no período e que se amparavam numa espécie de parcos conhecimentos ministrados na própria casa ou determinismo geográfico a fim de dar conta dos costumes brasileiros, como nos lembra Renato Ortiz ) nos conventos (ARAÚJO, 2001, REIS, 2000). D
(1999a, 1999b), o médico assevera: “A influencia dos ( A premissa básica estava fundada na imagem Volume XX Issue IV Version I da mulher como Eva pecadora que deveria ser climas sobre os costumes, as crenças, o gráo de controlada para que se tornasse Maria. Os sacrifícios civilisação, finalmente sobre a vida moral e intellectual na vida passavam por uma leitura religiosa, de uma dos povos é muito secundaria ou quasi nulla” (p. 18). O moralidade cristã, enquanto etapa necessária à problema se centrava num tipo de comportamento, redenção. Enquanto costume instituído, era visto e explicitamente aquele adjetivado como aristocrático, - vivido como normalidade. Assim, a narrativa simbólica que desviava especificamente as mulheres de suas acerca do que era ou o que deveria ser mulher não importantes funções, ligadas à maternidade e cuidados passava por questionamentos e era esquecida em sua com a família, ao pô-las em contato com luxos e arbitrariedade, ajudando a constituir uma ordem na qual licenciosidade, seduzindo-as a sacrificar o belo moral à o modo de vida cortesão, pelo status que a corte evanescente beleza física. Se a corte desempenhou detinha enquanto referência de “mundo civilizado”, papel de peso na construção de um modo de vida distintivo em relação ao colonial, agora, ao final do século, tensionamentos acentuados vão se dando para 1 Tal classificação está alinhada à teoria dos humores, na a construção do Brasil republicano burguês e moderno. reformulação que Galeno, no segundo século da era cristã, da
medicina hipocrática. Esta teoria, que teve ampla aceitação até A vulnerabilidade feminina aos encantos de um mundo Global Journal of Human Social Science meados do século XIX, foi a base da teoria dos temperamentos, das superficialidades constituía ameaça à família e, divididos em: sanguíneo; colérico ou bilioso; fleumático ou pituitoso; e assim, à própria civilização, que ainda se apresentava melancólico ou atrabiliário. Tais humores estariam sob a ação de quatro forças naturais, a saber: a atrativa; retentiva; alterativa e apenas como um projeto a ser levado a cabo. E, expulsiva. Nesta última estaria concentrado a possibilidade de cura, ambivalentemente, tal resistência à “liberação” do pela ação da natureza ou pela intervenção médica, através dos corpo feminino acabava por aproximá-los (os médicos) comum recurso aos vomitórios, purgantes, sangrias, suadouros, de certas premissas preconizadas como modelo para fumigações etc. (FERREIRA, 2009, LIMA, 1996). Concepção de cura pautada na expulsão do mal natural que obtinha franca as mulheres do período colonial. Do mesmo modo que correspondência com as práticas de expulsão do mal sobrenatural se afirma ser o mundo aristocrático aquele das causador de adoecimentos nas cosmologias africana e indígena. aparências, afirma-se que ele apenas aparenta ser
©2020 Global Journals The Defense of Brazilian Civilization from the Criticism to the use of Perfumes: Doctors in Medicine in Bahia of the XIX Century
civilizado, quando seria, ao retirar sua maquiagem, a apropriação de uma discussão ligada a uma “perfeita antithese da verdadeira civilisação”. Ora, o concepção europeia de progresso e de Nação na argumento de fundo que une diferentes teses médicas correlação com o Zeitgeist, esses arautos da civilização defendidas ao longo da segunda metade do século brasileira estão longe de tentar um imediato transplante será a necessidade de se construir nas terras brasileiras de um modelo civilizador europeu (SCHWARCZ, 2015, a verdadeira civilização, e isto significava se contrapor ORTIZ, 1999b). Ao contrário, ainda que sejam ao mundo aristocrático, que sacrificava a moral em declaradas explicitamente quais seriam as civilizações nome da valorização das aparências. Em outros de referência (a saber, França, Inglaterra e Estados termos, a sociabilidade cortesã impulsionava certas Unidos), as teses apresentam críticas ao modo de condutas de informalização, em seus momentos de efetivação desses modelos de civilização a partir de prazer, que estariam na contramão dos refreamentos argumentos que interpenetram saúde e moral. A exigidos pela civilização2. civilização levaria ao aumento das afecções nervosas. Ao mesmo tempo, tais críticas feitas pelos Quanto maior a civilização, mais suicídios e mais profissionais da medicina, é importante destacar, não alienados (FREIRE, 1888). Em outras palavras, a podem ser lidas como elogio a um modo de vida de questão crucial aos profissionais da medicina respeita 2020 referência colonial e, portanto, ligado ao “Brasil do aos mecanismos que permitiriam construir a civilização
ear atraso”. A perspectiva assumida pelos médicos no Brasil evitando ou diminuindo seus efeitos colaterais, Y reivindicava transformações nas condutas que as que incidiriam diretamente na saúde moral e física da
20 aproximavam da sociabilidade de corte, mas apenas população: nos apelos à saída das pessoas às ruas, para uma vida Se na raça africana [prossegue Freire] a população louca é pública, com o intuito de saúde (para que se produzida por causas physicas, nos centros civilisados as beneficiassem do ar menos viciado de fora das causas moraes ajuntando-se a estas fornecem numero insalubres casas geminadas), de educação formal (as mais crescido. mulheres precisavam ser melhor instruídas para, em De modo que o progresso de um povo é medido pelo consequência, melhor instruir os futuros cidadãos) e esforço organico e moral, que elle oppõe ás causas que educação dos sentimentos (o exercício da vida pública tendem a atrophial-o (1888, p. 46-7). levaria ao aprendizado do trato com o outro a partir das A civilização seria algo inexorável no processo dinâmicas de autocontrole que fariam com que a evolutivo humano, por isso não seria fato e sim mulher se autovigiasse e, assim, tivesse internalizados encadeamento de fatos e ideias que levariam ao os modos de conduta moral e socialmente exigidos). “estado philosophico da positividade social”, continua o Por isso, as reformas indicadas pelos médicos autor, ao citar Benjamin Constant e Arthur Gobineau. )
D higienistas tinham também por foco a educação formal Contudo, a efetivação da mais evoluída civilização
(
Volume XX Issue IV Version I feminina. careceria de um esforço em direção à necessária No entanto, de que esses médicos estavam correção moral ao qual estes doutores em medicina falando ao acionar a noção de civilização, uma vez que apelam a partir do filtro religioso do cristianismo. Do não se tratava dos comportamentos da família real mesmo modo que ocorre em sua relação com uma portuguesa no Brasil? Citando um discurso do cônego ideia de sociabilidade mundana ao estilo aristocrático, o
- Pinto de Campos, no Rio de Janeiro, Cid Emiliano posicionamento dos médicos em relação à religião é Cardozo (1857) afirma que a civilização mal entendida é marcado por simultânea afinidade e tensão, como aquela vinculada a progressos meramente materiais, termos ambivalentes. Como lembra ainda Guarino que funcionariam como mero adorno e, portanto, ilusão Freire, a educação religiosa guarda uma série de (novamente a concepção de falseamento e engano inconvenientes: os seminários; os conventos; certas sendo ressaltadas). A verdadeira civilização consistiria, práticas, como a do jejum, que seriam prejudiciais. afirma o médico, no desenvolvimento intelectual e moral Alguns médicos, a exemplo de João Pinheiro de Lemos do povo fazendo com que a inteligência se (1851), chegam a argumentar contra o celibato sobrepujasse à matéria. Trata-se de um discurso de enquanto uma violência contra o corpo, a saúde, as leis apelo a uma forma de racionalidade, a científica, da da natureza e a própria obra de Deus, ocasionando
Global Journal of Human Social Science qual os profissionais da medicina, certamente, se dores e histeria. Mais uma vez, o alvo do discurso são percebiam como expressão, e que seria a mais as mulheres, que não deveriam ser privadas do ajustada à construção do espírito nacional. Quanto a casamento, ou seja, de uma vida sexual moralmente isso é interessante notar que, se há um modo de legitimada. Some-se a isto o apelo a novas formas de educação, marcadas por uma simbiose entre a 2 O autor Norbert Elias (1992, 1993, 1994), no entanto, percebe os formação racional-científica e moral-religiosa, para momentos de relaxamento na forma dos lazeres numa relação termos uma melhor ideia do tipo de relação, ora ambivalente e diretamente proporcional às exigências de autocontrole
nos sentimentos e comportamentos, cuja formalização teria chegado primando pela aproximação e ora pelo distanciamento,
a cume no século XIX, e não como antítese e ameaça à conduta quanto ao controle religioso-católico dos chamada civilizada. comportamentos femininos.
©2020 Global Journals The Defense of Brazilian Civilization from the Criticism to the use of Perfumes: Doctors in Medicine in Bahia of the XIX Century
A França e a Inglaterra, que são os emporios das lettras, e certos animais eram parte do cotidiano do Brasil. O ar das artes e das sciencias, não offerecem o quadro de uma precisava ser limpo a fim de evitar as doenças no corpo civilisação perfeita: aquela por suas devassidões, quasi (SANT’ANNA, 2011) - em perfeita consonância com a tantas e tão grandes, quanto as da Italia, e da Hespanha; teoria do contágio e infecção pelo ar que constituiu esta por seo protestantismo extravagante, por sua crença comum entre povos orientais e ocidentais por aristocracia absurda e por suas miserias (…). Os Estados Unidos da America, este paiz, onde o genio da civilisação séculos e acabou por se conformar na teoria tem feito mais rapidos progressos, falto como ele é de miasmática que balizou as práticas terapêuticas unidade nas crenças religiosas, não poderá levar jamais europeias e era ainda popular no século XIX. As casas uma marcha uniforme no desenvolvimento moral (Cardozo, no Brasil continuavam sendo fumegadas, e a higiene 1857, p. 20). corporal continuava atrelada a práticas de cura e Pergunta ainda: Estas “escolas de desmoralização”, crenças no sobrenatural. Assear o corpo e aspirar rapé referindo-se à música, teatro, bailes, qualificados de poderiam ajudar na proteção quanto a odores “parto abortivo da civilisação”, levariam a quais maléficos, do mesmo modo que os defumadores consequências sobre os fenômenos nervosos? A falsa protegiam o ambiente doméstico contra doenças, mau- olhado, forças do além. Igualmente as crianças, em civilização acarretaria toda ordem de vícios reprováveis 2020 e a serem regulados racional-cientificamente e moral- especial as recém-nascidas, eram protegidas através religiosamente para o alcance da verdadeira civilização. da defumação de seu corpo com alfazema (FREYRE, ear Y E a falsa civilização é aquela que permite e estimula 2002).
A vinda da corte, com a abertura do comércio práticas de sociabilidade ligadas aos prazeres sensual- 21 que possibilitará o ingresso de uma ampla leva de mundanos: "De envolta com os sons arrebatadores da objetos ligados ao luxo, a exemplo das fragrâncias, fará musica, com o perfume inebriante das flores, estão as com que o gosto pelos “bons aromas” ganhe uma nova longas vigilias, as fadigas, os excessos, o ar quente e motivação: o valor simbólico do produto estará também impuro da sala, e centenares de circumstancias outras em seu poder de permitir a aproximação do usuário semelhantes” (p. 13) a que o autor acresce o jogo, o com o sonhado modo de vida aristocrático europeu.No onanismo, as paixões em geral, os trabalhos entanto, mesmo ao final do século, a referência ao intelectuais em excesso (no caso das mulheres, não caráter terapêutico dos perfumes permanece presente, recomenda a leitura de textos apaixonados), o tabaco, como se pode observar a seguir no texto publicitário dentre outros. Contudo, naquilo que toca as dedicado à Água de Florida de Murray e Lanman fragrâncias, elas seriam não apenas um dos elementos publicado no Jornal da Bahia (1870). que compõem a ambiência do mundo dos vícios da A razão porque devemos usar da sociabilidade aristocrática. Afirma Guarino Freire )
Agoa Florida de Murray e Lanman D peremptoriamente: (
Porque é o perfume mais deliciosos e d’uma fragrancia Volume XX Issue IV Version I Os perfumes activos produzem excitação nervosa, mais duradoura que se conhece. cephalalgia, vomitos e inappetencia. Os que tem por base a essencia de amendoas são venenosos. Os de bergamota, Porque é extrahido das viçosas e frescas flôres do campo. de limão, de heliotropo e de jasmins produzem Porque é um perfume muito mais fino e delicado, superior á cephalalgias violentissimas. melhor Agoa de Colonia franceza ou allemã.
Porque é o perfume mais precioso e ao mesmo tempo mais - Tem-se dado importancia pequena ao abuso dos barato que se offerece ao publico. perfumes, entretanto elles, em alguns individuos, excitam Porque suavisa e aformosea a pelle e as feições tornando- grande e fortemente e produzem prostração (1888, p. 31). as ainda mais formosas.
Os médicos se alarmam ao perceberem o Porque desvanece e faz desaparecer os pannos, sardas e quanto os perfumes eram utilizados como excitantes ebullições do rosto. visando à promoção ou intensificação do prazer - pelos Porque serve de immediato allivio e refrigerio ás dores de seus argumentos, a entrega de si às sensações e cabeça e desmaios. desejos representava degradação biopsiquicomoral do Porque limpa o rosto de todas as maculas que afeiam e eu e do nós, pensado este como Nação. Evidencia-se o obscurecem a formosura. teor da tensão entre tradicional e moderno, no modo Porque transmitte e transforma a pelle trigueira n’uma cor Global Journal of Human Social Science como se coloca tal questão nesse momento da história clara, macia, transparente e rosada. brasileira. Eles percebem que a relação com aromáticos Porque quando se usa no banho, vigoriza o corpo, vivifica a alma e reanima as ideias. era prática estabelecida de longa data e, portanto, a Porque diluida em agoa, torna-se o melhor de todos os civilização dos costumes se assemelharia mais a um dentrificios conhecidos. agravante, e não a causa primeira desses usos em Porque dissolvida em agoa, suavisa e aplaca a ardencia nosso contexto. Na segunda metade do século XIX, os depois que se ha feito a barba. banhos temperados com ervas aromáticas, vinagres e Porque misturada com agoa serve de agradavel lavagem colônias, bem como as defumações do ambiente para os dentes dentro da bocca, um suave aroma doméstico para limpeza, purificação e combate a traças dissipando o nauseabundo cheiro do charuto.
©2020 Global Journals The Defense of Brazilian Civilization from the Criticism to the use of Perfumes: Doctors in Medicine in Bahia of the XIX Century
Porque todas estas asserções se acham firmemente lidos também a partir de seu potencial de sedução; o apoiadas pelo testemunho do mundo elegante. que pode ser observado em certas menções como a Acha-se á venda em todas as principais lojas de que faz Cid Emiliano Cardozo a Cleópatra, “a rainha perfumarias e drogas. libidinosa e devassa” (1857, p. 11). Este elemento Haja toda a certeza que se compre a verdadeira AGOA DE curiosamente aparece de modo sutil e velado FLORIDA de Murray e Lanman. considerando-se que as mulheres (de temperamento No entanto, o médico Guarino Freire (1888) sanguíneo) comparecem simultaneamente como lista o perfume ao lado do álcool, tabaco, ópio, usuárias e principais vítimas dos perfumes. A visão morfinomania, haxixe, coca, arsênico, dentre outros. As desses médicos quanto ao uso de aromáticos está fragrâncias estariam ligadas à sempre ameaçadora alinhada às interpretações que circulavam nos meios excitação prazeirosa, do ponto de vista moral, e a burgueses europeus, que percebiam no evanescente dores, do ponto de vista orgânico. No que respeita a perfume uma expressão da falta de estabilidade que se civilização, o abuso de tais substâncias, nos termos do deveria evitar no mundo do cultivo à racionalidade autor, “degradam a especie humana, e fazem-no por (PERROT, 1996) e uma ameaça direta ao próprio meio da alienação mental e da degradação das raças” exercício da razão por conta da excitação dos instintos 2020 (p. 45). sexuais que potencialmente promoveriam determinados
ear Tratar dos perfumes assume importância em cheiros. Assim, eles poderiam contribuir sobremaneira Y conformidade com as discussões a respeito da na criação de ambientes favoráveis à licenciosidade,
22 influência do ambiente no comportamento humano, o contrária à moral burguesa do pudor e do que promoveu a problematização do efeito do ar e, em comedimento, ameaçando os comportamentos especial, do ar perfumado natural e/ou artificialmente, civilizados pautados no autocontrole ao lançar os no organismo feminino. O ar perfumado influenciaria na indivíduos novamente na primeira natureza, ou seja, em saúde a ponto de poder provocar na mulher abortos, sua condição animal que se queria negar/esquecer a esterilidade, como anuncia Baraúna (1868), ou mesmo partir da afirmação do mundo civilizado-humano como a suspensão das regras (menstruação) e a morte, aquele de exercício da razão e que teria por referência o como afirma Cardozo (1857). No caso deste último e de masculino - sendo a mulher o perigoso elo entre o Mello (1851), explicita-se de modo mais evidente que o humano e o natural, o que justificaria sua maior uso do perfume envolvia simultaneamente prazer, vulnerabilidade, e também definiria sua condição de sensualidade e vaidade, amálgama que levaria à alvo privilegiado para as ações disciplinares com fins ao condenação dos aromáticos pelos higienistas na forma seu (auto)controle e, em consequência, proteção da das fragrâncias, dos jardins perfumados instalados ao própria civilização. ) Os fortes perfumes de base animal, entendidos D pé das janelas nos palacetes dos magnatas (que
( como potentes afrodisíacos, foram substituídos, a partir Volume XX Issue IV Version I deveriam ser evitados principalmente pelas grávidas), ou mesmo dos vasos de flores colocados próximos ao do final do XVIII na França, pelos florais, mais leves e leito com seu inebriante perfume. Qualquer aroma seria em maior conformidade com o mundo natural, numa capaz de excitar os nervos femininos, afirma Cardozo, época em que ainda estava em desenvolvimento o provocando-lhes imediatamente síncopes, histeria ou conhecimento que possibilitaria efetivamente a criação
- outra afecção nervosa: de novos aromas, inexistentes na natureza. Como nos Não há muito tempo que foi publico nesta cidade o facto de lembram Elias (1992, 1993, 1994), Williams (2001) e uma infeliz moça, que recebendo, ao abrir a gaveta de seu Wouters (2012), o desenvolvimento urbano e simultâneo guarda roupa, a impressão subita do cheiro de uma afastamento da natureza acabou por permitir novos perfumaria, que ahi existia soffreo um choque nervoso tal, modos de aproximação com os ambientes naturais no que occasionou-lhe immediatamente suspensão das século XIX, mas de modo idealizado nas imagens
regras, que bem cedo atirou-a no tumulo ainda no sorrir da nostálgicas de uma natureza e vida no campo vida! (CARDOZO, 1857, p. 11). amigáveis, marcadas pela calma, pelo prazer, mas que Até o final do século XIX, a teoria miasmática, passariam a ser vividos, no entanto, de modo de contágio de doenças pelo ar, terá lugar nos debates meramente contemplativo, o que permitiu a
Global Journal of Human Social Science médicos, mas, neste momento, já posta em reelaboração da própria natureza de modo que ela questionamento pela teoria bacteriológica. O mau fosse incorporada à vida urbana, por exemplo, na forma cheiro passa a ser compreendido, ao longo do período, dos jardins tão celebrados no período. A voga dos como sinal de problema de saúde pública, ou seja, os florais expressava, pois, o desconforto com a bons aromas não conseguiriam corrigir o ar e sim artificialidade do mundo social e a insistência no uso de atuariam encobrindo um sintoma que apontaria um mal perfumes, apesar das duras críticas e desconfiança que a ser efetivamente tratado (Chernoviz, 1890a, 1890b). os cheiro perfumado promovia: em outros termos, No caso das teses de medicina analisadas, apesar das críticas, as fragrâncias não deixaram de ser mais do que servir ao falseamento dos sinais de usadas nos países europeus e tampouco no Brasil. No doença e de promover adoecimento, os perfumes eram entanto, acrescente-se aí um outro fator de peso: os
©2020 Global Journals The Defense of Brazilian Civilization from the Criticism to the use of Perfumes: Doctors in Medicine in Bahia of the XIX Century odores do corpo igualmente eram entendidos como 1547, dom João fundou o Colégio de Artes e afrodisíacos. Uma vez que não era possível apagá-los, Humanidades, tempos após, ao entender a instituição no mundo da racionalidade seria possível controlá-los como uma ameaça à sua política religiosa e cultural, o pelo uso de outros odores que poderiam sobrepô-los rei entrega a instituição aos jesuítas (PRIORE, 2001), ou, ao menos, neutralizá-los. Ao cheiro sensual dos que promoverão lá o desenvolvimento de uma corpos, põe-se em confronto o cheiro delicado das formação, acima de tudo, religioso-filosófica de caráter flores. A natureza idealizada e reencontrada é posta a teórico e que pouco preparará esses profissionais ao agir a favor do humano. enfrentamento das questões práticas do exercício É importante lembrar que, a essa época, a profissional. produção e comércio de perfumes na Europa havia A formação dos médicos licenciados era insatisfatória e avançado em dessacralização. Apesar de os aromas inadequada, para não dizer pior. Durante o século XVII e e ainda serem utilizados para fins mágico-terapêuticos, grande parte do século XVIII, o ensino médico em Coimbra havia um crescimento considerável de sua condição de foi persistentemente dominado por uma sensibilidade produto comercial devotado ao embelezamento e escolástica medieval baseada no sistema galênico sedução, a partir do século XVII. A saída dos perfumes tradicional de ensino da medicina. Mesmo no segundo 2020 das boticas para as lojas de cosméticos se deu apenas quartel do século XVIII, se não acompanhassem a evolução médica no estrangeiro, muitos médicos profissionais no final do século XIX europeu, quando a comunidade ear
formados em Coimbra não tinham simplesmente contato Y científica se volta à ação dos micróbios, por conta da com novas ideias exteriores a esta tradição obsoleta descoberta de Pasteur, e os odores passam a ser (WALKER, 2013, p. 81). 23 compreendidos não como agentes patológicos, mas A Companhia de Jesus manteve o controle sintomas, e de pouca importância (CORBIN, 1986), sobre o ensino superior em Portugal até 1759, momento fazendo recuar a teoria dos miasmas. Os agradáveis que marca o início da atuação de Pombal. aromas deixam, portanto, de ter a função de combater Medievalismo e formação pautada numa moral religiosa os desacreditados odores ruins em seu papel de católica justificavam o ingresso, que foi frequente no ataque à saúde -a crença de que os bons cheiros XVIII, desses médicos nos trabalhos remunerados da formavam uma barreira de proteção que impediria o Inquisição, ainda de acordo com Walker, na condição ataque dos odores patológicos, principais agentes de de “familiares”, isto é, de funcionários não-eclesiásticos adoecimento. É assim que os perfumes, por sua vez, do Santo Ofício que tinham por excelência a função de perdendo sua função terapêutica, passam a ser caracterizados mais efetivamente como frivolidades, denunciar indivíduos que deveriam passar por investigação. Aquilo que observa Walker, a partir de sua num desdobramento das críticas feitas pelos reformadores protestantes, e são associados às análise das atividades da Inquisição portuguesa no ) D pessoas frívolas, ou seja, no contexto de século XIX, citado século, período em que estavam em ( desaparecimento em outros países da Europa, é que se Volume XX Issue IV Version I aristocratas e mulheres. A sua artificialidade ajudaria a encobrir a natureza humana, e não a ressaltá-la. "Como acentuam as denúncias contra curadores populares. Em sua interpretação, a precária formação dos médicos os cientistas e psicólogos do século XIX e início do XX argumentaram, a supressão do sentido do olfato foi profissionais não os permitia rivalizar com os curadores, pois as fronteiras entre os dois grupos não ficavam uma das características definidoras do homem - civilizado” (CLASSEN et al, 1996, p. 101). claras em termos de concepções do processo de cura (ambas fundadas no imbricamento com o universo das Em lugar de suprimir o uso dos aromas, o século XIX regulará seus usos e impulsionará sua crenças mágico-religiosas), ao passo em que os curadores populares detinham domínio prático da comercialização para diferentes partes do mundo (CLASSEN et al, 1996, REINARZ, 2014). Na segunda atuação médico-cirúrgica e um elevado grau de reconhecimento social que faltava aos médicos de metade do século XIX, a perfumaria francesa se utilizava de matérias-primas advindas das diferentes formação erudita. O contexto, pois, é de disputa por espaço de atuação profissional e de tentativa de partes do mundo, ao passo em que exporta seus produtos também para diferentes partes do mundo. estruturação de um modo de exercício da medicina mais autonomizado quanto às crenças “supersticiosas”.
Conforme Corbin (1986), o comércio com o Oriente Global Journal of Human Social Science Se este é o cenário em Portugal, é cabível havia se invertido. O produto que chega ao Brasil, como afirmado, está desencantado, mas encontra um lembrar que no período colonial era proibida a instalação de instituições de ensino acadêmico no cotidiano mágico num mundo em disputa. Em acréscimo, a formação profissional em Brasil (ALMEIDA, 2010). Tal política da Metrópole apenas sofrerá alteração em 1808, com a vinda da Portugal e no Brasil ajudava a conformar a especificidade da vinculação entre um espírito racional- família real para estas terras. Até lá, os residentes no científico e uma moralidade católica, enquanto nos Brasil que desejassem estudar nas academias de demais países da Europa se avançava francamente na medicina eram obrigados a ir a Portugal. Mesmo direção da autonomização científica. Se, ainda em aqueles que retornavam para atuação profissional na
©2020 Global Journals The Defense of Brazilian Civilization from the Criticism to the use of Perfumes: Doctors in Medicine in Bahia of the XIX Century
colônia, número bastante restrito frente à vastidão do Souza Figueiredo debate o caso do curandeiro Faustino território, eram obrigados a se defrontar, do mesmo Ribeiro que à época atuava em Salvador (cidade do modo que em Portugal, com os curadores que, de igual estado da Bahia), já tendo passado pelo Rio de Janeiro modo, tinham o reconhecimento de sua competência e São Paulo. O curador atuava por impostação das por parte dos habitantes do Brasil. mãos e, devido à sua fama, teria em pouco tempo Em conformidade com o médico Gonçalo conseguido atrair um razoável contingente de público, Moniz (1923), foi escrita na Bahia e datada de 18 de qualificado por Figueiredo como “neuropathas e fevereiro de 1808 a carta redigida por D. Fernando José supersticiosos”. A autoridade sanitária é acionada, pois de Portugal, depois Marquês de Aguiar, dirigida a D. o charlatão, nas palavras do autor da matéria, teria João Saldanha da Gama, 6º Conde da Ponte, através infringido a lei estadual n. 112, de 14 de agosto de da qual se informava acerca da decisão do Príncipe 1895, que proíbe o exercício da arte de curar àqueles Regente de fundar na cidade de Salvador uma escola que não têm habilitação para tanto. Para além da de cirurgia, por sugestão do médico José Correia necessidade de formulação da lei, o que nos permite Picanço, pernambucano, depois Barão de Goyana. A perceber que a profissionalização da medicina teria escola teria seu funcionamento no Real Hospital Militar, apoio do Estado, é interessante observar a autodefesa 2020 instalada na casa onde antes funcionava o colégio dos feita por Faustino Ribeiro, ao ser chamado a apresentar
ear jesuítas no Terreiro de Jesus e que depois passou a sua habilitação para cura, evento narrado ainda por Y compor as Faculdades de Medicina, em que as Escolas Figueiredo: 24 de Cirurgia, da Bahia e também do Rio de Janeiro, Faustino Ribeiro declarou por escripto e depois foram transformadas em 1832, e que instituiu também verbalmente que cura por uma influencia que o povo os cursos de Farmácia e de Obstetrícia, este último experimenta e affirma, e que elle mesmo ignora; suppondo voltado às mulheres. em sua crença que trata-se de um phenomeno É apenas a partir da formação dos médicos propriamente theosofico, isto é, de uma manifestação de nas instituições brasileiras, ou seja, mais propriamente nosso Supremo Pae de infinito amor e misericordia. na segunda metade do século XIX que este profissional (…) Além do prejuizo á saude publica, a influencia moral do vai começar a se tornar uma efetiva alternativa na theosopho Faustino está a despertar a superstição e o procura dos habitantes por serviços de cura, mas ainda fanatismo, que são os elementos mais perniciosos á vida e à felicidade de um povo, e as causas mais poderosas de assim de modo singularmente tímido. Uma franca seu atraso e decadencia. disputa tomará a cena com os médicos buscando assumir o monopólio do saber a respeito da cura, mas A tolerancia deste abuso no estado actual da nossa
também da prevenção ao adoecimento a partir de civilisação seria um retrocesso ás epocas de magia e ) feitiçaria do periodo mystico ou theologico, em que os
D medidas de intervenção higienistas que incidiam sobre
( phenomenos extraordinarios se explicavam pela
Volume XX Issue IV Version I os diferentes aspectos da vida. Com uma formação intervenção divina ou diabolica, e cujos effeitos a historia marcadamente teórica e religiosa desde Portugal, o registra com horror nessas nevroses epidemicas que debate científico e reformador caminhará de braços flagellaram os povos da edade media e que felizmente os dados, também no Brasil, com os apelos morais de progressos da civilisação e da hygiene social varreram dos índole católica, conforme vimos, e terá dificuldade de se paizes cultos, impedindo que em seu sólo revivam e
- sobrepor à atuação dos curadores, benzedeiras e evoluam os germens da superstição e do fanatismo. demais práticos dos serviços de cura, que passarão a (FIGUEIREDO, 1903, p. 193-196). ser desacreditados pelos médicos a partir da alcunha No entanto, em texto publicado já em 1922, o de charlatães, recurso simbólico de atribuição de valor médico Gonçalo Moniz, ainda se refere à existência dos negativo à atuação destes que, por séculos, foram a curadores populares como coisa comum no interior e quase única possibilidade de acesso a serviços de cura na capital da Bahia e tendo por clientela pessoas dos no Brasil. Atacava-se a eficiência do serviço, do mesmo variados estratos sociais. Mesmo que tenhamos, modo que o conhecimento que lhe servia de base por inclusive, há poucas linhas atrás afirmado os laços sua relação com as superstições, categoria estreitos entre os interesses do Estado e da classe continuamente acionada para ressaltar o descrédito a médica para conformação do Brasil do progresso,
Global Journal of Human Social Science que os curadores seriam merecedores - pouco se falará somos obrigados a ressaltar que tal relação era em magia. Tal estratégia, não necessariamente ambivalente, posto que o próprio Estado punha em reflexiva, foi percebida também em Portugal por Walker, prática ações contraditórias a respeito, expondo as no deslocamento dos argumentos que antes se dificuldades entre um projeto desejado de país e os estruturavam na busca por identificar as curas como costumes fortemente cimentados. Um exemplo disso é satânicas, o que reafirmava o poder de curar, e, a situação discutida em matéria não-assinada de 15 de posteriormente, passaram a questionar a própria cura fevereiro de 1870 e publicada também na Gazeta ao afirmar a ineficiência dos procedimentos. Médica da Bahia. O título é, de pronto, digno de nota: Em matéria datada de novembro de 1903, na “Á Proposito da Promoção de um Curandeiro a Gazeta Médica da Bahia, o médico Candido Elipidio de Cirurgião-Mór da Guarda Nacional”. O autor da matéria
©2020 Global Journals The Defense of Brazilian Civilization from the Criticism to the use of Perfumes: Doctors in Medicine in Bahia of the XIX Century aponta a contradição, ao lembrar do regulamento de produção simbólica, contribuíam para a datado de 20 de setembro de 1851 proibindo a prática conformação de novas (mas nunca completamente da medicina, ou seus ramos, por aqueles que não novas) possibilidades de associações simbólicas tenham título das escolas de medicina do Brasil, ou articuladas aos produtos a serem potencialmente título reconhecido por elas. Os anos 1870 teriam partilhadas pelos leitores. No Jornal A Pátria, publicado funcionado como um marco de mudança no perfil e em Niterói (RJ) em 21 de fevereiro de 1867, vemos, por produção das escolas de medicina. Conforme exemplo, uma reportagem assinada por Dr. A. de Grand Schwarcz (2015), as recentes epidemias de cólera, Boulogne apresentada como uma reprodução de febre amarela, dentre outras, bem como a Guerra do matéria que teria sido anteriormente publicada em 30 Paraguai funcionaram como motores a uma atuação de setembro de 1865 no Jornal Le Monde, de Paris, a missionária destes profissionais, que, inclusive, respeito do cólera, doença que, por vezes, assolou o reformularam os cursos de medicina no período. Era Brasil: urgente reverter a alta mortalidade do período. Entre Os casos varião e as medicações tambem porém em geral 1897 e 1903, ou seja, já na virada do século, foram é quasi sempre útil e proveitoso o uso de infusões registrados 35.294 óbitos apenas em Salvador. Cerca aromaticas e alcoolisadas, os clysteres frios, fortemente 2020 de 20% destes foram compostos por moléstias de etherisados, as fricções energicas, seja com a lã secca, seja com tinturas aromaticas de camphora e de alfazema, notificação obrigatória junto à Inspectoria Geral de ear Y Hygiene do Estado da Bahia: cólera e moléstias enfim, entreter o calorico artificial e tudo quanto puder coleiformes, febre amarela, peste, varíola, tuberculose, reanimar a circulação e ativar o systema nervoso. 25 escarlatina, difteria, febre tifoide e desinteria (SANTOS, O fragmento acima, publicado na segunda 2013). A legitimidade do discurso e prática médica metade do século XIX, se opõe cabalmente ao oficial, que vai se assentando a partir de fins do XIX, se posicionamento dos médicos verificado nas teses dá a reboque também da punição e repressão aos publicadas em igual período na Faculdade de Medicina. cultos religiosos não-católicos num acontecer conjunto O interessante é o modo como articula um discurso à proibição das práticas de cura entendidas como não- remissível ao saber médico erudito a concepções que científicas. Tais medidas, que iniciaram ainda no marcam o modo popular de lidar com as doenças se período imperial, são institucionalizadas na República valendo daquilo que é condenado pelos médicos: nas com o código penal de 1890, que prevê punição para a teses, afirma-se apenas o caráter danoso à saúde magia, curandeirismo e prática ilegal da medicina promovido pelos aromáticos. Em publicação ainda de (SAMPAIO, 2003). Mesmo assim, vemos conviver janeiro de 1832, no jornal O Simplício, do Rio de diferentes modelos e práticas de saúde, bem como Janeiro, podemos observar o ataque frontal aos curadores, aí denominados curandeiros, termo tornado ) diferentes usos das fragrâncias por parte da população. D
sinônimo de charlatão: ( Como indicado acima, desde os tempos coloniais Volume XX Issue IV Version I acreditava-se em seu poder mágico para as questões O luxo, esse cruel inimigo, que surrateiramente tem vindo ligadas às pendências de relacionamento inter-humano da Europa, para perdição de nossa Patria, continua desde em variadas ordens, não apenas vinculadas à sedução o sumptuozo apozento do nobre, até á mais rude choupana (apesar de ser amplamente aceito o seu poder do Lavrador! afrodisíaco), e também para proteção físico-espiritual. […] Mas ainda falta o melhor da festa: os Curandeiros - Significa dizer que os cheiros não puderam ser tambem chegaram ao seu S. Miguel! facilmente interpretados fora de sua vinculação mágico- Um d’esses homens, ha mezes, nos suburbios d’esta medicamentosa herdada da colônia. Ao mesmo tempo, cidade, foi chamado para ver uma Senhora viuva, qua tais cheiros agora incorporados às narrativas médicas, apenas padecia - medo do Falso do Banco, e sentimento não poderiam ser considerados apenas dispositivo do de estar sem dentes e com os cabellos brancos; - os vezinhos censuraram por não ter sido chamado um medico mundo aristocrático a desviar o Brasil dos rumos do de fama, ao que ella respondeo, que esses Snrs. não uzam ideal de civilização defendido pelos médicos, por ter muito sentimento quando vão anjinhos para o Ceo e servirem como excitantes prejudiciais à saúde. E, velhos para a cova. Chegou com effeito o vezinho mesmo no conturbado contexto das epidemias e curandeiro[…]: se a Senhora tivesse chamado algum reformulação das teorias miasmáticas, permaneceram d’esses Snrs. theoricos, que tem muita fama, estava a ésta Global Journal of Human Social Science sendo acionados para efeitos de cura. hora com a caza cheia de barbeiros, uns a sangrar, outros Com a imprensa em desenvolvimento no país, a deitar bixas, e o boticario a cozinhar sevada e grama todo os jornais e revistas serão palco dessas disputas na este mez e o que vem: eu cá sigo outra marcha […]: reafirmação ou negação de concepções e práticas, o receitarei um cozimento preparativo, e depois passarei a dar-lhes tres ou quatro vomis do Licor Divino, chamado que se fazia acontecer em matérias assinadas vulgarmente le-Roy, e con mais 60 ou 70 purgatifs havemos (ficticiamente ou não) e nos anúncios publicitários que, deitar para fóra o inimigo: - Mas, Snr. vezinho, tenho sustos ao compor suas narrativas conferindo significados aos continuados. - Isso he muito natural em quem tem produtos, não apenas expressavam o rol das complicações sistematicas; para esse incomodo basta representações vigentes, como também, no seu papel fazer uzo do aroma da arruda, ou mesmo banhar as
©2020 Global Journals The Defense of Brazilian Civilization from the Criticism to the use of Perfumes: Doctors in Medicine in Bahia of the XIX Century
clavicolas com agoa da rainha. Póde a Snra. estar certa em inícios do século XX concepções que nos permitem que a medicina tem apenas um olho aberto! Muitas vezes afirmar a interpenetra ção dos discursos e os remedios cazeiros salvam a vida e a bolsa […] representa çõ es a respeito dos cheiros no seio das lutas E que tal, Leitores! que vos parece o Snr. Arcenico? (assim pelo poder de falar sobre e tratar as doenças no Brasil. o vou chamar) adquerio o nome de homem entendido, e faça Deos bom tempo! […] Cuidemos pois, Leitores, em III. Conclusão
educar os nossos pequeninos para saberem livrar se dos O que podemos perceber é o século XIX como Arcenicos do tempo. palco das disputas pela diferenciação da atividade
- He muito sensivel ao homem pensador ver uma belleza, profissional médica (erudita) em rela ção às diferentes victima de hediondas superstições, temendo bruxas, formas de prática mé dica popular, em conformidade feiticeiras, lobishomens e cazas mal assombradas , com o processo de racionalização no modo descrito
entretanto que o Luxo dezordenado, unico terrivel feiticeiro por Max Weber (1982). Tal processo inicia com as merece cada vez mais sua constante adoração! tentativas oficiais de classificaçã o das atividades de Tal texto, de 1832, foi publicado, portanto, no cura, buscando demarcar formas de atuaçã o que, no ano em que as escolas de cirurgia são tornadas fazer, continuamente se atravessavam (parteiras,
2020 Faculdades de Medicina. Ou seja, estamos tratando do barbeiros, sangradores, cirurgiões, boticários…) e,
ear início do percurso de formação dos médicos. Aquilo simultaneamente, hierarquizando -os valorativamente. Y que chama a atenção é que já se trata de um contexto Constituía-se uma homologia entre o posicionamento
de disputas envolvendo os licenciados (a exemplo dos 26 social dos agentes de cura (se eram brancos, citados barbeiros e boticários) e os curandeiros, tal qual indígenas, mulatos ou negros, libertos ou escravos, a nomenclatura empregada no texto. A denúncia feita homens ou mul heres) e o tipo de interven ção na matéria explicita que os leigos faziam uso de promovida (por exemplo, ser barbeiro ou sangrador era elementos de um discurso médico profissional inferior a ser boticá rio ou cirurgi ão), uma vez que se articulado a práticas que respeitariam ao modo popular, trata de uma única estrutura composta por diferentes mas que foi valorado como enganoso no modo de lidar fun ções articuladas. Tal processo de estabelecimento com o adoecimento. A base do engano seria: a relação de clivagens classificatórias se prolonga com as a ções de cuidado e afeto contraposta emocionalmente à mais de implementa ção das institui ções de ensino em fria relação com os profissionais licenciados (que não medicina, que passaram a ser permitidas no Brasil em demonstrariam muito sentimento com a morte de funçã o da vinda da corte, desejosa de atendimento crianças e de velhos); o apelo a Deus e a remédios mais especializado, e, após a independ ência do Brasil, ligados a crenças mágicas (a palavra feiticeiro aparece como marco para a construção do novo país, que
) em destaque no texto) e superstições, mas que poriam tentava romper seus laços coloniais, a partir do D
( em risco a vida dos indivíduos (não à toa o destaque na incentivo a práticas intelectualizadas e legitimadas de Volume XX Issue IV Version I expressão homem entendido, como modo de cientificidade e que, portanto, estariam na
evidenciar possivelmente uma ironia). Mas quais seriam contramedida de práticas mágicas de cura. Tais
esses remédios supersticiosos? Um cozimento instituições funcionam, pois, não apenas como mera
preparativo (os ingredientes não são mencionados), objetivação de processos em curso. Não são mera
- Licor Divino, o muito conhecido na época purgante síntese, uma vez que são recurso para o
francês Le-Roy, aroma de arruda e Água da Rainha, remodelamento de práticas. Em outros termos, não são
famoso perfume. No reinado das superstições, adverte, objetivações que meramente articulam o passado;
teme-se o mal errado: em lugar de ter medo de pretende-se que sejam antecipações do futuro
criaturas inexistentes, fruto da fantasia, deve-se temer desejado por se depositar nelas as fichas de
outra ordem de feiticeiros: os luxos em seu poder de construção de mundo, pela relação fetichizada com as
encantamento, transformação e corrupção. instituições e crença no seu poder simbólico de
Obviamente, não podemos tornar essas atuação. Como afirma Schwarcz,
afirmações um absoluto, por um lado, devido ao fato de se essa elite ilustrada não era, em sua maioria, originária
das camadas mais pobres, também não pode ser se tratarem de concepções bastante arraigadas e, por entendida como totalmente oriunda ou até mesmo porta- Global Journal of Human Social Science outro, devido ao fato de não termos acessado, no voz exclusiva dos interesses das classes dominantes. Por processo de pesquisa, o universo das 2.502 teses. De outro lado, se é certo que sua composição social os situaria qualquer modo, se mesmo a tese intitulada Sciencias como membros das camadas mais altas da sociedade, sua Medicas - Bebidas Aromaticas, escrita por Aristides atuação não pode ser exclusivamente explicada em termos
Cezar Spinola Zama em 1858, não traz, na análise do de pertinência de classe. Por fim, apesar dos estreitos laços
autor a respeito do café, do chá e do chocolate, de parentesco que atavam certos intelectuais a famílias de
qualquer consideração sobre o papel dos aromas, proprietários de terra, sua atuação se dá em contexto
podemos perceber em publicações outras vinculadas urbano, o que já os diferencia de seu grupo de origem.
especificamente à atividade profissional dos médicos já (2015, p. 35).
©2020 Global Journals The Defense of Brazilian Civilization from the Criticism to the use of Perfumes: Doctors in Medicine in Bahia of the XIX Century
Ou seja, este grupo estava agindo no sentido médicos formados em Portugal e no Brasil, que de se conformar enquanto tal, enquanto grupo estavam em descompasso ainda com as significativas particular de profissionais articulados a partir de um mudanças na área advindas das recentes descobertas modo especificado de racionalidade (a científica) a e avanços técnicos. O marco de reestruturação do delinear os contornos daquilo que Weber denominou ensino médico no Brasil se deu apenas nos anos 1870, linha de conduta, ou seja, modos de fazer informados ou seja, em fim de século. Como foi demonstrado por regras circunscritas, no caso, à atuação médica através das teses, a noção de temperamentos, como o erudita. No entanto, como ressalta ainda o autor, e o sanguíneo atribuído às mulheres, ainda era acionado, caso da diferenciação entre o religioso e o econômico é do mesmo modo que a preocupação com o ar quente exemplar disso, tais processos, que caracterizariam o ou odorizado. chamado mundo moderno, se dão na contrapartida de A alcunha de charlatães servia, neste contexto, uma série de tensões experimentadas na medida em ao propósito de fazer desacreditar a medicina popular, que as linhas de conduta ainda estão em grande numa mudança radical de argumentos se medida interpenetradas. Na forma como vimos, os compararmos ao período de atuação da Inquisição. Em anseios de autorreferencialidade do fazer médico - e, Portugal, inicialmente o discurso m