Compendium of Scottish Silver volume 1
by Rodney R. Dietert, Ph. D. Janice M. Dietert, M.A.S.S. Main Cover Photo: (left) A 1695ca miniature Thistle Mug by John Seatoun (Edinburgh, maker’s mark only) is illustrated next to a fully marked full size Thistle Mug from 1701/02 Edinburgh. The latter is by Edward Penman with James Penman, his father, as the assay master (right). Photograph by Janice Dietert.
Published by The Internet-First University Press ©2006 Cornell University. To order additional copies of book please e-mail [email protected]. Compendium of Scottish Silver volume 1
by Rodney R. Dietert, Ph. D. Janice M. Dietert, M.A.S.S. The Internet-First University Press Ithaca NY 14853
Copyright © 2006 by Rodney R. Dietert, Ph.D. and Janice M. Dietert, M.A.S.S.
Printed in the United States of America ii Compendium of Scottish Silver
ACKNOWLEDGEMENTS
Disclaimer: Any errors within the book are solely the responsibility of the authors and in no way reflect on the individuals or institutions who were supportive of this endeavor.
The authors are deeply indebted to Henry Steuart Fothringham, Historian of the Incorporation of
Goldsmiths for Edinburgh, and George Dalgleish, Curator, National Museums of Scotland for their encouragement, sharing of notes, devotion of time, and direct assistance in the collection of data for this book. This book would not have been possible without their generous help. Mary
Grotrian of The Incorporation of Goldsmiths, City of Edinburgh, Irene Mackay of the National
Museums of Scotland and Robert Barker, researcher, also provided much appreciated support.
We express appreciation to Stephen Clarke and Jeanne Sloane of Christie’s and Peter Waldron and John Culme of Sotheby’s for allowing us access to a century of auction house records, lot descriptions and archival photographs. At Colonial Williamsburg, USA, John Hyman (Associate
Curator) and John Davis, Head Curator, came to our assistance at key times. Anonymous collectors in Canada, Scotland and the U.S. were instrumental in this project by providing both details of their collections as well as photographs for use. Numerous silver dealers provided exceptional aid including John H. Bourdon-Smith and his family, James McConnaughy and Bard
Langstaff of S.J. Shrubsole, Inc, Ben Goodwin (Goodwin’s Antiques, Edinburgh), Edward
Munves (James Robinson, Inc., NY), Nicholas Shaw, Alastair Dickenson, Brand Inglis and
George Schrager, (Shredds Antiques, London). We particularly thank Professor Emeritus J.
Robert Cooke, former Dean of Faculty of Cornell University and a steward of our university silver (Cornell University Mace Bearer) for his vision of free-access publishing and for the opportunity to contribute to this endeavor.
i Compendium of Scottish Silver
ii Compendium of Scottish Silver
TABLE OF CONTENTS
Volume 1
Guide to the Compendium...... v Abbreviations...... vii Timeline of Earliest Form Appearance ...... viii List of Plates ...... xvii Baskets ...... 1 Beakers...... 9 Bowls ...... 13 Punch ...... 15 Slop...... 23 Strawberry ...... 25 Sugar...... 27 Boxes...... 51 Brooches, Medals and Badges ...... 59 Candlesticks ...... 67 Casters...... 81 Casters ...... 82 Dredgers...... 94 Pepper Pots ...... 95 Church Silver ...... 99 Communion Cups and Beakers ...... 101 Flagons...... 124 Lavers ...... 124 Patens...... 127 Church Plates...... 129 Coffeepots and Chocolate Pots ...... 131 Cream and Milk Containers...... 141 Cruets ...... 165 Cups ...... 169 Coconut Cups ...... 170 Mazers ...... 170 Tumbler Cups ...... 171 Two-Handled Cups...... 175
iii Compendium of Scottish Silver
Dinnerware...... 183 Dish Crosses and Dish Rings...... 185 Entrée Dishes...... 187 Epergnes ...... 188 Jugs ...... 188 Plates...... 191 Dinner/Table ...... 192 Serving and Other Dishes...... 192 Tureens ...... 193 Flatware...... 195 Fish Slices and Servers...... 197 Forks ...... 201 Knives...... 209 Ladles...... 213 Marrow Spoons and Scoops ...... 227 Skewers...... 233 Spoons ...... 235 Sugar Tongs ...... 285 Ink Pots and Stands...... 289 Brief Glossary and Explanations ...... xxiii Works Cited...... xxxv
iv Compendium of Scottish Silver
Guide to the Compendium
This collection of more than 5,000 listings of extant Scottish silver was compiled over a period of two decades via the resources of the Cornell University library system and through the generous assistance of numerous silver dealers, historians, collectors, museum curators and other experts. While the focus was placed initially on Edinburgh silver, there are many important provincial silver examples included among the listings. Despite obvious limitations, we believe this compendium is one of the most comprehensive inventories of extant Scottish silver compiled
LQRQHUHVRXUFH:LWKWKHHDV\DFFHVVRIWKLVERRNYLDWKH,QWHUQHWDQG&RUQHOO¶V'VSDFHZH hope it will prove to be a useful guide for researchers, dealers and collectors as well as an inspiration for those who appreciate the Scottish goldsmiths and marvel at their wares.
Silver items are listed by category (e.g. bowls) and subcategory (e.g. sugar bowls) in chronological order. For categories with only a few listings, they are likely to be found within
WKH³0LVFHOODQHRXV´VHFWLRQ,QPRVWFDVHVWKHOLVWLQJLVDYHUEDWLPH[WUDFWIURPWKHPXVHXP catalog, auction record or magazine advertisement, etc. However, in several cases, the maker designation has been altered from an auction listing to reflect more recent advances in
DWWULEXWLRQV HJ-DPHV0LWFKHOOVXEVWLWXWHGIRUWKH(GLQEXUJKPDUN,0ILJXUHEHWZHHQDQG
-DPHV0LWFKHOVRQVXEVWLWXWHGIRUDWWULEXWLRQVWR-RKQ0DLQ RUPRUHUHFHQWFRQFHUQRYHU
SUHYLRXVPDUNDWWULEXWLRQV HJGLVWLQJXLVKLQJEHWZHHQ:LOOLDP'HPSVWHU¶VDQG:LOOLDP
'DYLH¶VYDULRXVSXQFKHV ,QPDQ\FDVHVWKHUHZDVQRGHVFULSWLRQRIDQLWHPEH\RQGDPDNHU year, and category. However, for some items (e.g. those currently in museums), the source listing itself may be used to obtain greater detail about a specific piece of interest.
v Compendium of Scottish Silver
When the same silver item was found in multiple sources, the sources were combined under one
listing (e.g. multiple shops in sequence, or auctions and then museums, etc.). In cases where two
or more items listed in different sources cannot be distinguished with certainty between them and
may be the same piece, the first listing appears in normal text while the subsequent similar
listings appear in italics. These may or may not be separate pieces and the user should be
cautious. This is particularly a problem for Scottish provincial pieces that have incomplete
descriptions and lack an annual date letter. Reference texts used in the compendium are
abbreviated in the listing. Full bibliographic information follows at the end of the book for these
sources. Journals and auctions are listed with as much information as was available. Even
though the citations are as complete as possible, some may inevitably prove problematic (via
errors in original transcription) or be difficult to pursue. We apologize in advance where this
may be the case.
vi Compendium of Scottish Silver
Abbreviations Used:
# in an auction catalog = lot
# in a book = the plate designation
³ LQFKHV appx = appendix ca = approximate di = diameter d = pennyweights (20 per troy ounce) g or gm = grams ht = height
PP PDNHU¶VPDUN oz = troy ounces p = page vol = volume (of a journal or multi-volume text)
vii Compendium of Scottish Silver
TIME-LINE OF SCOTTISH SILVER FORMS: EARLIEST APPEARANCES
This time-line is offered solely as a guide based on current surviving pieces found in the database. These pieces are not necessarily the earliest actually produced. In a few cases entries are included and specified for pieces known to have existed in the past based on detailed records (e.g. patron accounts, etc.) even when the continued existence of the piece is uncertain. Certainly, earlier pieces may come to light in coming years. We hope this timeline will encourage a continued examination of Scottish silver style development and innovation. We have attempted to provide both Edinburgh and provincial examples whenever possible.
Pre-1500
0D]HU²VFD---The Bute Mazer
Probable Scottish Mace--- Faculty of Arts, University of St Andrews
16th Century
&XSZLWK0DNHU¶V0DUNVFD7KH0HWKXQH&XSSRVVLEOHE\-RKQ9DLWFK
0DUNHG 0D]HU 7KH :DWVRQ 0D]HU SRVVLEO\ $GDP /HLV VV7KH6W 0DU\¶V0D]HU$OH[DQGHU$XFKLQOHFNIROORZHGE\WKH7XOORFKDQG*DOORZD\0D]HUV -DPHV*UD\&DQRQJDWH
6FRWWLVK&URZQUHZRUNLQJE\-RKQ0RVPDQDQG$GDP/HLVRIDQHDUOLHUFURZQ
6FRWWLVK6FHSWUHUHFDVWDQGDXJPHQWHGE\$GDP/HLV(GLQEXUJK
0DUNHG&RPPXQLRQ&XS+HQU\7KRPVRQH(GLQEXUJK RULJLQDOO\DVHFXODUYHVVHO
(ZHU-DPHV&RN,(GLQEXUJK
6HDOWRS6SRRQ ³7KH&XQQLQJKDP´ FD:LOOLDP&RN(GLQEXUJK
'LVFHQG6SRRQV*HRUJH+HULRW,,(GLQEXUJK
%DSWLVPDO%DVLQ-DPHV&UDZIRUG(GLQEXUJK RULJLQDOO\DVHFXODUYHVVHO
viii Compendium of Scottish Silver
1600s and 1610s
Slip-top Spoon --- 1609-10ca, Gilbert Kirkwood, Edinburgh.
The Heriot Cup (Nautilus cup) --- 1611-13 Robert Dennistoun, Edinburgh.
Horse Racing Prize---1617ca The Lanark Bell maker Hugh Lindsay, deacon Robert Dennistoun
All-Silver Mazer (bowl-type)---1619ca Thomas Cleghorne I, Deacon James Dennistoun, Edinburgh. (Documentary evidence shows that all-silver mazers existed at least as HDUO\ DV 7KH RWKHU H[WDQW H[DPSOH LV WKH 6W /HRQDUG¶V 0D]HU th-century, standing-type), University of St. Andrews.
City Mace (Edinburgh)---1617ca George Robertson I
1620s and 1630s
Wine Cup---1630ca Thomas Cleghorne, Edinburgh
Coronation Items---1633ca Gold Ampulla, used at the Scottish Coronation of Charles I, unmarked.
Bread Plates (Trinity Church) --- 1633ca Thomas Kirkwood, Edinburgh.
Coconut Cup --- 1637-39 Andrew Dennistoun, Edinburgh.
1640s and 1650s
:LQH)XQQHO²FD$GDP/DPEPDNHU¶VPDUNRQO\
6ZHHWPHDW'LVKRU:LQH7DVWHU7KRPDV&OHJKRUQH(GLQEXUJK
3XULWDQ6SRRQFD$OH[DQGHU6FRWW ZLWKVSRRQRIRIXQGHVLJQDWHGIRUP
Puritan Spoon --- 1651-53 or 1657-59 George Cleghorne, Edinburgh.
&RXUWRI6HVVLRQ0DFH GDWHG ²(GZDUG&OHJKRUQH $QGUHZ%XUUHOO'HDFRQ
1660s-1670s
7DQNDUG SHJ E\(GZDUG&OHJKRUQH,
4XDLFK IXOO\PDUNHG ²(GZDUG&OHJKRUQH,
ix Compendium of Scottish Silver
Set of Trefid spoons---1665-80 marks of Edward Cleghorne I and Alexander Reid (one maker, one deacon).
7UXPSHWV²FDE\7KRPDV0RQFXU*ODVJRZ$QGFD5REHUW%URFN
TazzasV:LOOLDP/DZPDNHU$OH[DQGHU5HLGGHDFRQ V$OH[DQGHU5HLGPDNHUDQGDOVRDVGHDFRQV$OH[DQGHU6FRWW
&DSVWDQ6DOWFD3DWULFN*DLUG\QH6W$QGUHZV
'LQQHU3ODWHVFD(GLQEXUJKE\$OH[DQGHU6FRWWGHDFRQ(GZDUG&OHJKRUQH WKLV EDVHGRQGRFXPHQWDU\HYLGHQFHRQO\WKHSUHVHQWZKHUHDERXWVRIWKHVHSODWHVKDYHQRW EHHQWUDFHG
,QNKRUQRU:ULWLQJHTXLSDJHFD7KRPDV&OHJKRUQH(GLQEXUJK
7ZR+DQGOHG3RUULQJHU:LOOLDP/DZ PDNHUDQGGeacon)
1680s
*RXUG&XSFD7KRPDV&OHJKRUQH,,(GLQEXUJK
7ZRKDQGOHG&XSDQG&RYHU$OH[DQGHU5HLG(GLQEXUJK
&DVWHU7KRPDV )ODJRQ-RKQ/DZ(GLQEXUJK 7HD&DGGLHFD-DPHV&RFNEXUQ(GLQEXUJK 3DWFK%R[5REHUW%URFN*ODVJRZ 7REDFFR%R[E\5REHUW%URFN*ODVJRZ 3DLURI7DQNDUGV³7KH/\RQ7DQNDUGV´-DPHV&RFNEXUQ(GLQEXUJK 6DQFWXV%HOO²=DFFKDULXV0HOOLQXV(GLQEXUJK 7XPEOHU&XS²V7KRPDV0RQFXU *ODVJRZ 5REHUW*DLUG\QH 3HUWK 7XPEOHU&XS-DPHV3HQPDQ(GLQEXUJK 7XPEOHU&XS-DPHV/XNH*ODVJRZ %HDNHU GDWHG E\ -DPHV 3HQPDQ 3DLU 7KLVWOH VKDSHGWZRRWKHUSURYLQFLDO EHDNHUVOLNHO\HDUOLHU0DGHDV&RPPXQLRQ&XSVRI/HVOLH &KDOLFH³7KH)RUV\WK´FD=DFFKDULDV0HOOLQXV(GLQEXUJK x Compendium of Scottish Silver Saucepan --- 1688/89 George Scott, Edinburgh. Bleeding Bowl ---1689/90 by James Penman, Edinburgh. Circular bowl, trefoil handle pierced with clovers. 1690s Table Knives --- 1690ca, JS, Edinburgh. &RQGLPHQWRU&KLOG¶V6SRRQFD*HRUJH 3XQFK%RZO³7KH%UXFH%RZO´5REHUW%UXFH(GLQEXUJK &KDPEHUVWLFNV-DPHV3HQPDQ(GLQEXUJK &DVWHUV VHWRIWKUHH $QGUHZ/DZ(GLQEXUJK 7KLVWOH0XJV SDLU E\-DPHV&RFNEXUQ 7KLVWOH0XJ$QGUHZ/DZ 'LVK5LQJ-DPHV&RFNEXUQ ,QGLYLGXDO6DOW FLUFXODU 5REHUW%URFN*ODVJRZ $OVR,QGLYLGXDO6DOW:LOOLDP*HG(GLQEXUJK 7ZRKDQGOHG7KLVWOH&XS(GZDUG3HQPDQ(GLQEXUJK 7DEOHVWLFNV SDLU -DPHV3HQPDQ(GLQEXUJK 7DEOHIRUNV² $OH[DQGHU .LQFDLG VDPH \HDU 5REHUW %UXFH(GLQEXUJK 7UHILGV ERWK originally large sets, and one by Thomas Cleghorne in the National Museums of Scotland. :DOO6FRQFHV-DPHV3HQPDQ 3DLU Monteith --- 1698/99 Colin McKenzie, Edinburgh. 'RJQRVH VSRRQ (GLQEXUJK QR PDNHU¶V PDUN SUREDEO\ *HRUJH 1700s 7RW&XSFD$OH[DQGHU)RUEHV(GLQEXUJK 0DUURZ6SRRQ$OH[DQGHU.LQFDLG 6LOYHUPRXQWHG0LUURUSUREDEO\-DPHV3HQPDQ(GLQEXUJK +DQRYHULDQ6SRRQV&ROLQ0F.HQ]LH(GLQEXUJK xi Compendium of Scottish Silver Hanoverian Forks----1702/03 Colin McKenzie, Edinburgh Jug --- 1701/02 Thomas Ker, Edinburgh. %DUEHU¶V%RZODQG(ZHU7KRPDV.HU(GLQEXUJK &KLOG¶V5DWWOHFD5REHUW,QJOLV(GLQEXUJK 7RLOHW6HUYLFH³7KH.HLU´&ROLQ0F.HQ]LH(GLQEXUJK &DVNHWFD7KRPDV.HU(GLQEXUJK +DVK6SRRQ-RKQ/XNH-U*ODVJRZ 2IILFHU¶V%DGJH ,QFRUSRUDWLRQRI6XUJHRQV FD$OH[DQGHU.LQFDLG(GLQEXUJK 6SRXW&XS:DOWHU6FRWW(GLQEXUJK 6HDO%R[E\-RKQ/XNH,,*ODVJRZ 6DOYHUVPDNHUQRWVWDWHG(GLQEXUJK RULJLQDOO\+RSHWRXQFROOHFWLRQ 1710s 3LQFXVKLRQVLOYHUPRXQWHGFD5REHUW%UXFH(GLQEXUJK &RIIHHSRW&ROLQ0F.HQ]LH SDUWRIVHW +RWPLON-XJ&ROLQ0F.HQ]LH(GLQEXUJK $OVR0XQJR 7HDSRW &ROLQ 0F.HQ]LH DQG &ROLQ &DPSEHOO ERWK DSSUHQWLFHV RI -DPHV 3HQPDQ 7HD&DGG\FD-RKDQ*RWKHOI%LOVLQJV*ODVJRZ 7HDSRWDSSOHVKDSHG&ROLQ0F.HQ]LH 6LOYHU6ZRUG+LOWFD+HQU\%HWKXQH(GLQEXUJK )ODVNFD$OH[DQGHU.LQFDLG(GLQEXUJK 7HDSRWVWDQG-DPHV0LWFKHOVRQ(GLQEXUJK 6XJDU%R[:LOOLDP$\WRXQ$QRWKHUE\+HQU\%HWKXQH &RYHUHG6XJDU%RZO-RKQ6HDWRXQ 6WUDZEHUU\'LVK+HQU\%HWKXQH(GLQEXUJK$QGVHHFD xii Compendium of Scottish Silver Snuffer Stand---1719/20 Henry Bethune Egg or Barrel-Shaped Teapot---1719/20 Henry Bethune (egg) and Colin McKenzie (barrel) (both James Penman apprentices). 1720s Chocolate Pot --- 1720/21 Patrick Murray, Edinburgh. Octagonal Teapot --- 1723/24 William Aytoun, Edinburgh. Desert Spoons --- 1722/23 Kenneth McKenzie, Edinburgh. Use of Wavy Border, Molded Edge, Bowls and Stands---1721/22 James Mitchelson-Private Collection UK, then 1723/24 James Ker; then 1725/26 James Ker (James Penman lineage). Spirit Burner --- 1724/25 James Mitchelson, Edinburgh. Strawberry Dish ---1725ca, by Robert Luke, Glasgow. (Edinburgh 1718-19) Snuff Box --- Glasgow, 1725ca, Johan Got-helf-Bilsings, Glasgow. Tea Kettle, Lamp and Stand---1725/26 James Mitchelson. Snake-Handled Tea Urn---1723/24 William Aytoun, Edinburgh Use of Curved Spout---1725/26 James Mitchelson (kettle) and Edward Penman (teapot) (apprentice of James Penman); 1726/27 James Tait Three-Footed Sugar Bowl---1726/27 James Ker, Edinburgh Pair of Branches for Candlesticks --- 1728/29 James Ker, Edinburgh. Dry Mustard Pot --- 1729/30 William Aytoun, Edinburgh. 6TXDUH6DOYHUPDNHU¶VPDUNXQFOHDU(GLQEXUJK 1730s Dessert Knives --- 1730ca, unmarked, Edinburgh. Bun Pepper --- 1730/31 William Aytoun, Edinburgh. Double-Lipped Sauce Boats --- 1730/31 James Mitchelson, Edinburgh. xiii Compendium of Scottish Silver Punch Ladle --- 1733/34 William Aytoun, Edinburgh. Cream boats---1733/34 James Ker and Ebenezer Oliphant, 1735/36 William Aytoun (YHUWHG5LP&KDVHG6XJDU%RZOV²-DPHV.HU IRXUIRRWHGSDUWRIVHW QRWHDOVR D-DPHV7DLWERZOWKUHHIRRWHGULPIODWHYHUWHGVKDSHGEXWXQGHFRUDWHG Urn Stand --- 1735/36 James Ker, Edinburgh. 7HDVSRRQV6FRWVILGGOHSDWWHUQFD -RKQ5ROOR(GLQEXUJK .HWWOH6HW(TXLSSHGIRU6LOYHU7DEOH-DPHV0LWFKHOVRQ Taperstick --- 1736/37 James Ker, Edinburgh. Gold Teapot --- 1736 James Ker, Edinburgh. &UXHW)UDPH:LOOLDP0DUVKDOO,(GLQEXUJK1RWHWKLVPDNHUKDGDQXQWLPHO\ death shorten his career. 6QXIIHU7UD\/DXUHQFH2OLSKDQW(GLQEXUJK Burgess-Ticket Box --- 1736/37 John Rollo, Edinburgh. *UDY\%RDWFDPDNHU¶VPDUN5& possibly Edinburgh. Cake Basket---1739/40 James Ker; also 1740/41 by James Ker and 1740ca by James Ker Punch Strainer --- probably late 1730s William Aytoun, Edinburgh. 1740s /LEUDU\ /DPS :LOOLDP $\WRXQ (GLQEXUJK DVVD\PDVWHU 'DYLG 0LWFKHOO )HE 6HSW Traveling Canteen --- 1740/41 Ebenezer Oliphant. Edinburgh. ,QNVWDQG5REHUW*RUGRQ 8VHRI'ROSKLQ +DQGOH:' :LOOLDP 'HPSVWHURU:LOOLDP'DYLH RQDFUHDP boat. 8VHRI$UWLFKRNH)LQDO:LOOLDP$\WRXQFD-DPHV*OHQ *ODVJRZ 8VHRI%LUG6SRXWFD-DPHV*OHQ *ODVJRZ WHDSRW &KLOG V5DWWOHFE\-DPHV*OHQ*ODVJRZ HDUOLHVWSURYLQFLDO 0DULQH7KHPHG+ROORZZDUH²:' SUREDEO\:LOOLDP'HPSVWHU Cakebasket. xiv Compendium of Scottish Silver 1750s Tea Vases (pair) --- 1750ca James Glen Glasgow. Use of Bird Finial---1753/54 Lothian & Robertson (kettle) and Robert Gordon (teapot). Square Teapot---1753/54 Lothian & Robertson (Robertson trained by Edward Lothian). 1760s Pointed Old English Spoons --- 1763/64 Lothian & Robertson Soup Tureen---1763/64 Alexander Gairdner (apprenticed to William Aytoun). Sugar Tongs---1760/61 by Alexander Aitchison I 1770s Bannock or Toast Rack---1773/74 Patrick Robertson. Servers/Fish Slices---1778/79 Peter Mathie server, 1780/81 WD probably William Davie Fish Slice 2QVORZ 3DWWHUQ² .HU 'HPSVWHU DOVR :' VFULSW SUREDEO\ IRU William Davie or William Dempster, also one 1783-84 Alexander Gardner. 1780s Wine Coaster---1781/82 WD for William Davie or William Dempster. Wine Funnel Stand---1782/83 WD for either William Davie or William Dempster ditto --- 1783-4 by W. & P. Cunningham. Vase Shaped Sugar---1783/84 WD for William Davie or William Dempster. xv Compendium of Scottish Silver xvi Compendium of Scottish Silver LIST OF PLATES Front Cover Two thistle mugs. The left is a miniature 1695ca Edinburgh by John Seatoun, PDNHU¶VPDUNRQO\7KHULJKWLVDIXOOVL]HGPXJE\(GZDUG3HQPDQ(GLQEXUJK assayed by his father, James Penman. Courtesy of The Phoenix Collection. Photograph by Janice M. Dietert PLATES %DVNHWV$FDNHEDVNHWE\: VWDU 'SUREDEO\:LOOLDP'HPSVWHU(GLQEXUJK Courtesy of a private collector, photograph by Janice M. Dietert. %HDNHUV3DLURIEHDNHUVE\3DWULFN5REHUWVRQ(GLQEXUJK3KRWRJUDSKFRXUWHV\RI The Maple Swan Collection. %RZOV7ZRGLVWLQFWO\GLIIHUHQWERZOVWKUHHIRRWHGOLRQ¶VPDVNVXJDUERZOE\ -DPHV.HU(GLQEXUJK OHIW DQGFDFRYHUHGVXJDUERZOE\0LOQH &DPSEHOO*ODVJRZ ULJKW &RXUWHV\RI7KH3KRHQL[&ROOHFWLRQ3KRWRJUDSKE\-DQLFH0'LHWHUW 3XQFK%RZOV$3UHVHQWDWLRQ3XQFK%RZOE\-DPHV0F.D\(GLQEXUJK Photograph courtesy of J. H. Bourdon-Smith, London. 6ORS%RZOV$WKUHHIRRWHGVKDOORZ6ORS RU6XJDU %RZOE\-DPHV7DLW Edinburgh. Courtesy of The Phoenix Collection. Photograph by Janice M. Dietert. 6WUDZEHUU\%RZOV$6WUDZEHUU\%RZO'LVKFDE\*HRUJH&RRSHU$EHUGHHQ Photograph courtesy of The Maple Swan Collection. 6XJDU%RZOV$6XJDU%RZOE\-DPHV0LWFKHOO(GLQEXUJK&RXUWHV\RI7KH Phoenix Collection. Photograph by Janice M Dietert. %R[HV$3UHVHQWDWLRQ6QXII%R[E\$OH[DQGHU*DLUGQHU(GLQEXUJK WRSDQGERWWRP Courtesy of The Phoenix Collection. Photograph by Janice M. Dietert. %URDFKHV%DGJHVDQG0HGDOV$6FKRRO0HGDOE\3HWHU$LNHQ*ODVJRZ IURQWDQG EDFN &RXUWHV\RI7KH3KRHQL[&ROOHFWLRQ3KRWRJUDSKE\-DQLFH0'LHWHUW &DQGOHVWLFNV$SDLURI7DEOHVWLFNVE\-DPHV.HU(GLQEXUJK&RXUWHV\RI7KH Phoenix Collection. Photograph by Janice M. Dietert. &DVWHUV$Q2FWDJRQDO&DVWHUPDGH)DOORIE\-DPHV.HU (GZDUG3HQPDQDVVD\HU Edinburgh. Courtesy of The Phoenix Collection. Photograph by Janice M. Dietert. &KXUFK6LOYHU$&RPPXQLRQ&XS VFD E\:LOOLDP/LQGVD\IRUWKH&KXUFKRI Montrose. Photograph courtesy of The Maple Swan Collection. &RPPXQLRQ&XSV$&RPPXQLRQ&XSFDE\(GZDUG&OHJKRUQH,(GLQEXUJKIRU6W /HRQDUG¶V&KXUFK6W$QGUHZV3KRWRJUDSKFRXUWHV\RI7KH0DSOH6ZDQ&ROOHFWLRQ xvii Compendium of Scottish Silver 14. Patens. A Communion Paten 1650ca by Edward Cleghorne I, Edinburgh. Photograph courtesy of The Maple Swan Collection. 15. Plates. The Cruden Communion Bread Plate. Inscribed/dated 1691 for the church at Cruden Bay by GW, Aberdeen. Photograph courtesy of The Maple Swan Collection. 16. Coffeepots. An Edinburgh example 1759/60 by William Taylor. Courtesy of J.H. Bourdon- Smith, London. 17. Cream and Milk Containers. Group of three Edinburgh Cream Boats of different styles, 1744/45 Edward Lothian (left), 1752/53 Robert Gordon (center), 1741/42 James Weems (right). Courtesy of The Phoenix Collection. Photograph by Janice M. Dietert. 18. Cruets. A Cruet 1760ca by Milne and Campbell, Glasgow. Photograph courtesy of The Maple Swan Collection. 19. Cups. A Tumbler Cup 1717-19ca Edinburgh by Henry Bethune. Courtesy of The Phoenix Collection. Photograph by Janice M. Dietert. 20. Dinnerware. One of two Covered Entrée Dishes 1829/30 Marshall and Son, Edinburgh. Courtesy of a private collector. Photograph by Janice M. Dietert 21. Dish Crosses and Dish Rings. A Dish Cross 1767/68 by WD probably William Dempster, Edinburgh. Courtesy of The Phoenix Collection. Photograph by Janice M. Dietert 22. Plates. One of a pair of Ashets (meat dishes) 1821/22 by George McHattie, Edinburgh. Courtesy of a private collector. Photograph by Janice M. Dietert. 23. Flatware. A Scots Fiddle Pattern Tea Straining Spoon 1730ca by William Aytoun, Edinburgh. Courtesy of a private collector. Photograph by Janice M. Dietert 24. Fish Slices. A Fish Slice 1807/08 by James Douglas, Edinburgh. Courtesy of The Phoenix Collection. Photograph by Janice M. Dietert. 25. Forks. A pair of Trefid Tableforks 1698/99 by Alexander Kincaid, Edinburgh. Courtesy of The Phoenix Collection. Photograph by Janice M. Dietert. 26. Knives. Two from a set of twelve 1786-90 Dessert Knives by Patrick Robertson, Edinburgh. Courtesy of a private collector. Photograph by Janice M. Dietert 27. Ladles. A pair of Dundee Sauce Ladles 1790ca by James Douglas. Courtesy of The Phoenix Collection. Photograph by Janice M. Dietert. 28. Marrow Spoons and Scoops. Four Marrow Scoops. 1747/48 by Dougal Ged, Edinburgh (top), 1840/41 Bone Marrow Club by WC, Edinburgh, made for Andrew Rutherford (2nd from the top), a twisted stem example 1815/16 by George McHattie, Edinburgh retailed by Heron (next to bottom), and a 1811/12 bulbous connection example by John Ziegler, Edinburgh (bottom). Courtesy of a private collector. Photograph by Janice M. Dietert. xviii Compendium of Scottish Silver 29. Skewers. Top - A long skewer from a set of four 1820/21 by George Fenwick Center - a tiny skewer 1800 ca Inverness by Robert Naughton. Bottom - a leaf-decorated Skewer 1828/29 by Heron, Greenock, Glasgow assay. Courtesy of a private collector. Photograph by Janice M. Dietert 30. Spoons. A pair of Decorated Trefid Spoons 1682ca probably by Marion Cleghorne (Edward &OHJKRUQH,¶VZLGRZ (GLQEXUJK&RXUWHV\RI7KH3KRHQL[&ROOHFWLRQ3KRWRJUDSKE\ Janice M. Dietert. 7RQJV7KUHH6XJDU7RQJV/HIW±FDE\3HWHU0DWKLH(GLQEXUJK&HQWHUFD -DPHV(UVNLQH$EHUGHHQ5LJKWFDE\3+3DLVOH\&RXUWHV\RI7KH3KRHQL[ Collection. Photograph by Janice M. Dietert. 0LVFHOODQHRXV7RSOHIWDSDLURI%XFNOHV'XQGHHFDE\:LOOLDP6FRWW&HQWHUOHIW±D &KLOG¶V5DWWOHFDE\-DPHV*OHQRI*ODVJRZ%RWWRPOHIWDSDLURI6SXUV (GLQEXUJKE\-DPHV0F.D\5LJKWFDVWWRS XQPDUNHGEXW/RQGRQPDGH RIWKH*UHHQ Rod of Scotland. This top was made specifically for the Scottish coronation of George IV in 1821. All courtesy of a private collector. Photographs by Janice M. Dietert. 0XJV$(GLQEXUJKH[DPSOHE\3DWULFN0XUUD\,,&RXUWHV\RI7KH3KRHQL[ Collection. Photograph by Janice M Dietert. 0XJV*HQHUDO$Q(GLQEXUJKH[DPSOHE\'RXJDO*HG&RXUWHV\RI7KH3KRHQL[ Collection. Photograph by Janice M. Dietert. 0XJV7KLVWOH$Q$EHUGHHQH[DPSOHFDE\*HRUJH5REHUWVRQ3KRWRJUDSKFRXUWHV\RI The Maple Swan Collection. 0XVWDUG3RWV7KH(GLQEXUJKH[DPSOHLVE\)UDQFLV+RZGHQ3KRWRJUDSKFRXUWHV\ of The Maple Swan Collection. 4XDLFKV$Q(GLQEXUJKH[DPSOHE\0DWWKHZ&UDZ&RXUWHV\RI7KH3KRHQL[ Collection. Photograph by Janice M. Dietert. 3RUULQJHUVDQG%OHHGLQJ%RZOV$%OHHGLQJ%RZOE\'RXJDO*HG(GLQEXUJK &RXUWHV\RI7KH3KRHQL[&ROOHFWLRQ3KRWRJUDSKE\-DQLFH0'LHWHUW 6DOWV7ZRIURPDVHWRIIRXU(GLQEXUJKKXPDQPDVN SRVVLEO\-DFRELWH VDOWVE\(EHQH]HU 2OLSKDQW &RXUWHV\RIDSULYDWHFROOHFWRU3KRWRJUDSKE\-DQLFH0'LHWHUW 6DOYHUV7KH*ODVJRZH[DPSOHRIFDLVE\5REHUW/XNH&RXUWHV\RI7KH3KRHQL[ Collection. Photograph by Janice M. Dietert 6DXFHERDWV7KH(GLQEXUJKH[DPSOHLVE\$OH[DQGHU*DLUGQHU&RXUWHV\RI7KH 3KRHQL[&ROOHFWLRQ3KRWRJUDSKE\-DQLFH0'LHWHUW 6WUDLQHUVDQG6TXHH]HUV$QRYDO2UDQJH6WUDLQHUFDE\$GDP*UDKDPRI*ODVJRZ Photograph courtesy of The Maple Swan Collection. Compendium of Scottish Silver 43. Tankards. An Edinburgh example of 1695/96 by Alexander Forbes. Photograph courtesy of S.J. Shrubsole, NY. 44. Tazzas. An Edinburgh example of 1698/99 by John Yorstoun. Courtesy of The Phoenix Collection. Photograph by Janice M. Dietert 45. Tea. Some components used in serving tea. A Sugar Bowl 1731/32 by Archibald Ure, a 1740/41 Cream Boat by James Mitchell, a 1739/40 Salver by James Mitchelson and examples of Scots Fiddle teaspoons by Ebenezer Oliphant, James Hewitt and WM. Courtesy of The Phoenix Collection. Photograph by Janice M. Dietert 46. Tea Caddies. The Edinburgh example is 1792/93 by William Robertson. Courtesy of a private collector. Photograph by Janice M. Dietert. 47. Tea Kettles, Stands and Trays. The Kettle and Stand is 1758/59 by WD probably William Dempster, Edinburgh. Courtesy of a private collector. Photograph by Janice M. Dietert. 48. Teapots. An Edinburgh example of 1735/36 by James Ker. Photograph courtesy of Asprey, Ltd. London. 49. Tea Service. An assembled Edinburgh Tea Service. Sugar 1730/31, Cream Boat 1735/36, and Salver 1740/41 all by William Aytoun, the teapot is 1734/35 by Hugh Penman. Courtesy of The Phoenix Collection. Photograph by Janice M. Dietert. 7RDVWDQG%DQQRFN5DFNV$Q(GLQEXUJKH[DPSOHPDNHU¶VPDUNREVFXUHG Courtesy of the Phoenix Collection. Photograph by Janice M. Dietert. 51. Urns. An Ovoid Shaped Urn with Snake Handles 1738/39 by James Weems, Edinburgh. Courtesy of a private collector. Photograph by Janice M. Dietert. :LQH$:LQH/DEHOE\-+(GLQEXUJK:LQH)XQQHOQRPDNHU¶VPDUN:LQH Funnel Stand, 1810ca James McKay, Edinburgh. All courtesy of The Phoenix Collection. Photographs by Janice M. Dietert. 53. Wine Cups and Goblets. A Goblet 1807/08 by Robert Gray and Son, Glasgow (Edinburgh assay). Courtesy of J.H. Bourdon-Smith, London. Back Cover Photograph of the authors by Janice M. Dietert. Baskets BasketsBASKETS Plate 1. A 1761/62 Cakebasket by W * D, probably William Dempster, Edinburgh. Courtesy of a private collector. Photograph by Janice M Dietert 1 Compendium of Scottish Silver te p184- te X Sothebys London November #71 1987, #24 17, 1946 July Christies #194 1984 28, March Christies #71 Christies October 23 1991 #94 #94 1991 23 October Christies 1990s early London Koopman, 185 #102 185 #102 1983, March Glasgow Christies #80 1992, March London Christies #193 Collection Shaw Scotland of Museums National 1988 McKissick University South of USA SC Columbia Carolina, 444 1963, p Life Country #161 1963 21, March Sothebys #81 1991 Finlay #121 24, 1918 July Christies Scotland, of Museums National 1963.34 Christies June 15, 1977 #118 1977 15, June Christies H RIWKH(DUORI.LQWRU´ORQJR] *HHV&ODUN$UW,QVWLW BASKETS handle with vacant cartouche, oval, pierced sides, applied rim with scrolls, scrolls, with rim applied sides, pierced oval, cartouche, vacant with handle 13d long, 75oz " ¼ 15 feet, claw masks, female and spurme foliage, shell, scroll and female mask border, the foliage, mask and scroll scroll and mask foliage, the border, mask female and scroll shell, foliage, pierced with crosses and scrolls, molded border with foliate scrolls and and scrolls foliate with border molded scrolls, and crosses with pierced scroll foliate and mask female with handle swing shaped masks, grotesque terminals, base engraved with coat arms of in cartouche,handle engraved ZLWKDFLSKHUDQG(DUO¶VFRURQHWZLWKLQDFDUWRXFKH$UPVRI+RS oz 61 long, 13" (Hopetoun), oz 58 catalog, from known sale earliest ornamentand with castand applied shell caryatid scroll from and mask border,rising center handle swing foliage, and fruit of border with chased oz 66 long, ¼" 13 (Hopetoun), Hope of Arms figures, Edinburgh Edinburgh with crosses, and scrolls with pierced feet, claw 4 on oval, basket, Cake Edinburgh Edinburgh 59 oz long, ¾" 12 repaired, possibly basket, Cake 1991 London Phillips, S. J. Edinburgh Edinburgh body scrolls, foliate with pierced foot spreading on oval, shaped basket, Cake Edinburgh Cake basket, oval on piercedrim foot, everted sides piercedwith formal Assayer Hugh Hugh Assayer CAKE assayer-David Mitchell Assayer Dougal Ged Assayer-Dougal Ged 1739/40 James Ker 1739/40 James 1747/48 Robert Gordon Gordon 1747/48 Robert YEAR MAKER DESCRIPTION LOCATION SOURCE 1740/41 James Ker 1740/41 James 1745/46 James Ker 1745/46 James 1745 ca Ker James 1747/48 Edinburgh Dempster William letter Edinburgh no date , basket Cake handle, seahorse and feet dolphin with seashell scalloped , Large basket Cake 1747/48 Gordon Robert Edinburgh swing Marchmount, of Earls for and others Hume of , Arms basket Cake #333 catalog Collection Baruch 5REHUW*RUGRQ (GLQEXUJK &DNHEDVNHWHQJUDYHGZLWKDUPV 2 Baskets 1965, p96 73, vol 97 p2 73, vol Magazine 1949, Antiques Magazine p 926, # 1236 # 926, p National Museums of Scotland National Museums Apollo January 19 Bell advertisement #41 1939 7, Christies June Los Angeles County Museum Angeles Los loan collection, Early silver in # 222 California, Collection vol 123, p44 advertisement Finlay 1991 #94 Finlay 1991 Christies June 15, 1977 # 115 of Scotland National Museums MEQ 1204 Jackson 2 volumes 1234 fig. p 924, Sothebys March 20,#85 1970, long, 37oz 12d Sothebys March 6, 1969 #113 ells, 13 ¾" long, ells, s of diaper work, border and shells, 15 ½” long, 76oz and shells, le, center engraved with “H” beneath an with “H” beneath engraved le, center zof Edinburgh 1937 #111 How lid handle, contemporary Arms, 14 ¾" long, Arms, contemporary handle, lid feet, border-chased sh body, pierced in 4 panel pierced body, ll handle, 4 shell-footed legs with masks above with masks legs 4 shell-footed ll handle, Earl of Hopetoun, initial "H", under coronet, Hopetoun, of Earl nd details Connoisseur earliest recorded owner, Mackay and Chisholm owner, earliest recorded 151 p Cripps, no details Private Collection le with further applied scrolls le with further e basket, pierced sides, Arms of Dundas, 13 ¾" Arms basket, pierced sides, e with shells and scrolls, swing hand with shells and of Hopetoun earl’s coronet for the Earl 51oz 15d scroll, diaper and scrolls, flange with shell and vintage mounts, 14" long mounts, vintage with shell and flange and scrolls, diaper scroll, 15 ½” long, 66oz 15 ½” long, 50oz 13d Cake basket, mask and shell basket, mask Cake rgh Cake basket, no details rgh50.3o basket, well marked, Cake rghbasket, for the 2 Cake Edinburgh Cake basket, ertson Edinburgh Cake basket , no Gordon Edinburgh hand 1761/621764/65 Dempster William 1766/67 Robert Clarke1767/68 Patrick Robertson Edinbu Ker William Edinburghbasket, Cake Edinburgh Cak 1760/61Available Not long 13 ½" shell at each end, basket, rim, Cake gadrooned 2 volumes Jackson 1759/60 Robertson & Lothian Edinburghoval shaped basket, Cake 1755/56 Lothian & Rob 1755/561757/58 Dougal Ged Dempster William Edinbu Edinbu 1758/59 Dempster William Edinburgh 1754/55 Patrick Robertson Edinburgh ba basket , Cake scrolled 1752/53Dempster Ker & Edinburgh body, so , Pierced basket Cake 3 Compendium of Scottish Silver Nicholas Shaw Catalog 2004 2004 Catalog Shaw Nicholas p103 Scottish Art Review 1954 vol V V 1954 vol Review Art Scottish p50 #1 #64 122 p I, vol 1911 Exhibition MEQ 662 Lyle Silver Review 1982 p 8 1982 p Review Silver Lyle House Hopetoun Sothebys #69 1979 12, November MEQ 662 1964, vol. 136 p1388 p1388 136 vol. 1964, advertisement ORQJR] , no details details no , Scotland of Museums National 14" long, 28.6 oz oz 28.6 14" long, oblong base, 2 upturned handles handles upturned 2 base, oblong ZLWKWUDLOLQJIORZHUVDQGIROLDJHURSHULPVZLQJKDQGOH´ 1797/98 1801/02 Robertson William Edinburgh Cunningham P & W Edinburgh details no basket, Cake no details basket, Cake Collection Swan Maple The #130 1966 15, June Christies 1794/95 Cunningham P & W 1794/95 Edinburgh Robertson William no details basket, Cake 1796/97 Edinburgh Cunningham P & W details no basket, Cake Edinburgh Richardson, of Arms foliage, scrolling with pierced form, oval basket, Cake Glasgow Sons & Edward Scotland of Museums National 1783/84 ca ca 1783/84 Ker William ca 1785/86 Scott William 1789/90 Edinburgh Cunningham P & W Dundee Edinburgh details no basket, Cake plain on shells, with interrupted border gadroon with oblong basket, Cake details no basket, Cake 97 vol 1970, Magazine Antiques #112 1991 Finlay 1775/76 1775/76 Davie William 1778/79 Davie William Edinburgh Gairdner Alexander Edinburgh 15d 32oz wide, ½" 13 Edinburgh basket, Cake details inside no the on basket, Cake overlaid bars work wire curved by formed sides basket, Cake #267 1984 14, June Sothebys Museum Albert & Victoria YEAR MAKER DESCRIPTION 1769/70 LOCATION Welsh John Edinburgh oz 43 long, 13" basket, Cake SOURCE 16, November Life, Country 1770/71 1771/72 Clark Robert 1771/72 Davie William Edinburgh Robertson Patrick Edinburgh details no Edinburgh basket, Cake oz 25 wide, ½" 13 sides, pierced basket, Cake basket Cake #169 1977 21, July Sothebys Scotland of Museums National 4 Baskets , Winter , Winter g 2005, g 2005, ecember + Nicholas Shaw Catalog, Winter Winter Catalog, Shaw Nicholas p75 2000, 1994 VA Alexandria, DE 2000 p 75 2000 p p101 MEQ 1341 1341 MEQ 1992 in Newtown Bee 1/8/93 Bee in Newtown 1992 Lyon & Turnbull August Collection Murray The #173 2003, 20, Sothebys Gleneagles August 31, 31, August Gleneagles Sothebys 1992 #147 Collection Private QJR] 1LFKRODV6KDZFDWDORJ tails, 10 ¼" long long ¼" 10 tails, Scotland of Museums National No details details No Collection Swan Maple The IORZHUVGLR] paneled sides with bright cut border, engraved with crest of McLean, on on McLean, of crest with engraved border, cut bright with sides paneled HORQJDWHGRFWDJRQDOIRRWò´ORQJR] of a service a service of Cake basket, no details details no basket, Cake Scotland of Museums National JK &DNHEDVNHWLQVFULEHG)URP-RKQ3DWWHUVRQ(VT«ôOR Edinburgh Cake basket,no details The Scarlett Fox-Thieves Market Edinburgh Edinburgh handle, bale angular rim,threaded wavy form, octagonal oval Sugar basket, Edinburgh Sugar basket, boat shaped outline withreeded edge,reeded swinghandle, part DESSERT Edmonstoun Edmonstoun SUGAR William Robertson or or Robertson William Rynd William 1826/27 Alexander 1826/27 Alexander Edinburgh Inches 1899/1900 & Aitchison James 1902/03 Hamilton Edinburgh de no basket, Cake 1819/20 Gray Robert Glasgow with chased and chased body foot, spreading on circular basket, Cake 1805/06 Howden Frances Edinburgh engraved basket, Cake D Auction Eldredge 1812/13 George McHattie Edinbur McHattie 1812/13 George 1858/59 Sons & Marshall Edinburgh Blythswood of Campbell of Arms flowers, interwoven gilt, basket, Dessert Catalo Shaw Nicholas YEAR MAKER DESCRIPTION 1802/03 LOCATION Dempster William Edinburgh details no oval, basket, Cake SOURCE Scotland of Museums National 1786/87 Available Not Edinburgh basket, Sugar 1790/91 Cunningham P & W 1790/91 WR 1790/91 WR 5 Compendium of Scottish Silver atalog 2004 2004 atalog Antiques 2004 Antiques Nicholas Shaw Catalog Winter Winter Catalog Shaw Nicholas p85 2002/03 J Bourdon-Smith Catalog Catalog Bourdon-Smith J Collection Private Sothebys Scone April 19, 1977 1977 19, April Scone Sothebys #54 #91 p103 Nicholas Shaw Catalog Winter Winter Catalog Shaw Nicholas 2000 p73 Sothebys Gleneagles August 29, 29, August Gleneagles Sothebys 1983 #494 Sothebys Scone Palace April 23, 1979 #46 1961.559 1961.559 1943.265 1943.265 LQFDUWRXFKH IRUPHGRIDOWHUQDWLQJOHDYHVDQGRYDOVHQJUDYHGLQLWLDOV³&.´ 6 ¾" wide, 12oz 16d 16d 12oz ¾" wide, 6 below thereeded rim, swinghandle, with creamer, 6" wide vacant cartouche,¼" 6 long, 8.9 oz ribbon tiedroundels between leafy sprays and cornucopias, a further band of foliate sprays enclosing vacant cartouches below a band of foliage at the lip, lip, the at foliage of a band below cartouches vacant enclosing sprays foliate outline, in conforming base pedestal on handle, swing ò´R] Edinburgh Edinburgh details no basket, Sweetmeat Scotland of Museums National Edinburgh Edinburgh details no basket, Sweetmeat Scotland of Museums National SWEETMEAT 1798/99 Cunningham P & W Edinburgh oz 8.5 wide, 6 5/8" ht, ¼" 7 decorated cut, bright shaped, boat Sugar basket, Shaw Nicholas 1796/97 Cunningham P & W 1796/97 Edinburgh Bendy Charles set basket Sugar 1797/98 Howden Francis Edinburgh oz 9.9 di, ½" 6 Hutton, of motto and crest foot, pedestal on oval basket, Sugar Edinburgh C Shaw Nicholas rim, below decoration engraved of band handle, swing oval, Sugar basket, 1973 29, November Sothebys 1792/93 1795/96 Swan Robert GB Edinburgh handle swing a with oval basket, Sugar Edinburgh vines grape of a band with engraved cut bright body, oval Sugar basket, Collection Private 1795/96 Cunningham P & W Edinburgh vacant with engraved cut bright fluted, shaped, boat basket, Sweetmeat YEAR MAKER DESCRIPTION 1792/93 LOCATION Gairdner Alexander Edinburgh handle, swing engraving, cut bright foot, oval on shaped boat Sugar basket, SOURCE .HU 'HPSVWHU .HU 'HPSVWHU 1767/68 1794/95 YR Howden Francis Edinburgh crossed with engraved cut bright body, bowl-shaped fluted basket, Sweetmeat Edinburgh no details unattributed, and unclear mm basket, Sweetmeat notes p549 Marks Jackson 6 Baskets SHGHVWDOIRRW´ZLGH 9.1oz 9.1oz FRQWLQXHG IROLDJHDQGSDWHUDHDWWKHULPUHHGHGVZLQJKDQGOH YEAR MAKER DESCRIPTION LOCATION SOURCE 7 Compendium of Scottish Silver 8 Beakers BeakersBEAKERS Plate 2. A pair of 1768/69 Beakers by Patrick Robertson, Edinburgh. Courtesy of The Maple Swan Collection. 9 Compendium of Scottish Silver 0XVHXPVRI6FRWODQG LSSV%RRNS &OD\WRQ&KULVWLHV3LFWRULDO +LVWRU\S &KULVWLHV0DUFK 6RWKHE\V1<86$2FWREHU 1996 #264 $XJXVWS 6RWKHE\V6HSWHPEHU #195 6RWKHE\V*OHQHDJOHV$XJXVW &KULVWLHV2FWREHU &KULVWLHV$SULO . &KULVWLHV$SULO Christies November 24, 1919 #74 1919 24, November Christies &KULVWLHV0DUFK ³0DMRU-RKQ ´KWR]ERWK PXQFOHDU QJOLSHQJUDYHGZLWKLQVFULSWLRQ LPODWHIRUWKLVPDNHUKWR] -%RXUGRQ6PLWK&DWDORJ QJUDYHGZLWKWKH$UPVRI+D\0DUTXHVV UHGOLSHQJUDYHGZLWKFUHVWDQGPRWWR OHDYHVPLGULEJLUGOHIODULQJOLSEDVH DNHUQRKDQGOHPLGULEJLUGOHR]GERWK LEO\ EDQGRIVWUDSZRUNWKLVWOHVIORZHUVHWF FDOVKDSHHQJUDYHGZLWKEDQGRIJUDSHVDQG RXQGULPFUHVWPRWWR'RXJODV'RHRUGLHKW 11oz 9d 9d 11oz ZKHDWZLWKLQVKHOODQGVFUROOZRUNQHDUOLSFUHVWDQGPRWWRP ´KWR] ³&$/0´ô´KWR]G :LOVRQ%DUUHOOV5HJW´XQPDUNHG´KWR] RI7ZHHGDOHRQHZLWKDPROGHGULPWRILWLQVLGHWKHRWKHUô ³&XOORGHQ$SU´DQGODWHUFRDWRIDUPVDQGLQVFULSWLRQ HQJUDYHGZLWKODWHULQLWLDOVòKWR]G R]HD 18oz 17d 17d 18oz molded foot, 7" ht, 12oz 5d 5d 12oz ht, 7" foot, molded BEAKERS Century Century available Not &HQWXU\ 1RWDYDLODEOH Dundee ht, ¼" 6 Errol, of Earls of Arms ribs, reeded foliage, and flowers gilt Beaker, &DQRQJDWH %HDNHUVWDJ¶VKHDGPDUN SRVV th th -DPHV.HU (GLQEXUJK %HDNHUSODLQHQJUDYHG*EHORZU 3DWULFN5REHUWVRQ (GLQEXUJK %HDNHUVSDLUGHFRUDWHGDU 5REHUW*RUGRQ 'RXJDO*HG (GLQEXUJK %HDNHUGDWHG$XOGHDUQ (GLQEXUJK %HDNHUVOLJKWO\EXOERXVERG\IOD &U 1RWDYDLODEOH (GLQEXUJK %HDNHUSDLUWDSHULQJF\OLQGUL -DPHV.HU (GLQEXUJK %HDNHUVSDLUQRGHWDLOV 1DWLRQDO -DPHV.HUFD 1RWDYDLODEOH (GLQEXUJK %HDNHUVSDLUWDSHUHGRYDOIRUPH %HDNHUVPDOOF\OLQGULFDOVOLJKWO\IODUL -RKQ6HDWRXQ (GLQEXUJK %HDNHUWKLVWOHVKDSHGHYHUWHG 17 -DPHV3HQPDQ (GLQEXUJK %HDNHUVSDLUWKLVWOHVKDSHGEH 16 YEAR MAKER DESCRIPTION LOCATION SOURCE 10 Beakers er 19, er 19, E 1LFKRODV6KDZ&DWDORJ:LQWHU 72 2000 p Sale Scottish the Bonhams #21 2003 21, August 1987 #297 1991 #28 1991 #28 Sothebys Gleneagles August 29, 29, August Gleneagles Sothebys 1978 #435 #113 1991 Finlay 1LFKRODV6KDZ&DWDORJ$XWXPQ 55 1999 p 0(4 Christies August 8, 1940 #39 #39 1940 8, August Christies 1982 30, September Christies #130 Sothebys Scone Palace April 19, 1977 #85 Christies July 6, 1988 #115 #115 6, 1988 July Christies LOWRQ FUHVW±DERDU¶V ¼" ht, 11oz 1d wt both both wt 1d 11oz ht, ¼" HQJUDYHG³«7R:LOOLDP)DLUZHDWKHU VQRGHWDLOV 1DWLRQDO0XVHXPVRI6FRWODQG DSHGJLOWLQWHULRU´KWR] &KULVWLHV*HQHYD1RYHP narrow band of foliage, 3 3 foliage, of band narrow R] ôKWR]ERWK ´ ³:%01´ô´KWR]ERWK (5oz 5 ea) ea) 5 (5oz KHDGEHQHDWKDPRWWR³1210(782´LQDULEDQGSUREDEO\IRU+DP ´KWR] WKHWRSWKHQVWUDLJKWHQLQJRXWDWWKHULPHDFKHQJUDYHGZLWKD wheat ears and flowers,¼"ht, 3 14oz %HDNHUVGRXEOHEDUUHOVK Edinburgh Beaker, pair, with 2 bands of vine engravingand script "AD" monogram, :LOOLDP'HPSVWHU 1793/94 1793/94 Gairdner Alexander Edinburgh :LOOLDP5REHUWVRQ no details Beaker, (GLQEXUJK August Gleneagles Sotheby's :LOOLDP'DYLHRU -DPHV*LOOLODQG1790/91 (GLQEXUJK Howden Francis %HDNHUVSDLURIVPDOOEHDNHU Edinburgh ht, 1/8" 4 cartouche, oval an in "CB" engraved form, cylindrical Beaker, FD -DPHV'RXJODV 'XQGHH %HDNHUWDSHULQJF\OLQGULFDOVKDSH 1780ca 1780ca McEwan James 1798/99 Glasgow Howden Francis 15d 4oz Glory," or "Death motto engraved plain, Beaker, Edinburgh initials with engraved form, cylindrical tapering plain pair, Beakers, 536 1983 p Annual Review Lyle 1774/75 Robertson Patrick Edinburgh plain, pair, Beakers 1768/69 1773/74 Robertson Patrick Hewitt James Edinburgh no details pair, Beakers, Edinburgh towards tapering slightly shaped, tulip cups, tumbler tall like pair, Beakers, Collection Swan Maple The YEAR MAKER DESCRIPTION 1768/69 LOCATION Robertson Patrick Edinburgh of band with engraved rims consulto," et "Promote crest/motto, pair, Beakers, SOURCE 11 Compendium of Scottish Silver Christies London October 1988 1988 October London Christies #90 p 98 1988 #476 1992 London Bourdon-Smith, J James Robinson's, NY 1992 1976.29-30 1182-83 MEQ 77 2001 p p85 2000, MEQ 1605 1605 MEQ akers pair, leaf engraving engraving leaf pair, akers Scotland of Museums National 14oz both (7oz each) each) (7oz both 14oz 1895/96 M. W. 1920/21 Craik & Medlock Inverness Edinburgh ht 5/8" 3 horn beaker, silver-mounted Beaker, oz ht, 3.5 ½" 2 beakers, whiskey thistle-shaped, pair, Beakers, Winter Catalog Shaw Nicholas Winter Catalog Shaw Nicholas 1807/08 McKay James 1827/28 Be Edinburgh Inches S & F Edinburgh & oz 4.6 ht, ½" 3 monogram, and crest with 1834/35 straight-sided Beaker, 1871/72 Hamilton Marshall Williams Edinburgh Edinburgh 2005 Catalog Shaw Nicholas Weems of motto crests, 2 form, cylindrical tapering plain, pair, Beakers, details no pair, Beakers, August Gleneagles Sotheby's Collection Swan Maple The 1805/06 Howden Francis Edinburgh ht, ¼" 4 crest, engraving, later form, cylindrical tapering, plain, pair, Beakers, YEAR MAKER DESCRIPTION 1796/97 LOCATION 1799/1800 Dempster William Fenwick & McHattie Edinburgh Edinburgh motto and crest with 3, of set Beakers, form barrel pair, Beakers, SOURCE 1994 London Bourdon-Smith, J Scotland of Museums National 12 Bowls BowlsBOWLS Plate 3. Left – 1726/27 3 footed lion’s mask Sugar Bowl by James Ker, Edinburgh. Right – 1765ca covered Sugar Bowl by Milne & Campbell, Glasgow Courtesy of The Phoenix Collection. Photograph by Janice M Dietert 13 Compendium of Scottish Silver 14 Punch Bowls PunchPUNCH BOWLSBowls Plate 4. A presentation Punch Bowl 1820/21 by James McKay, Edinburgh. Courtesy of J H Bourdon-Smith, London. 15 Compendium of Scottish Silver p289 #413 , 1969 #134 Monteiths 1978 #200 Christies NY USA October 5, October Christies NY USA 1983 #185 of Scotland National Museums MEQ 1572 Christies June 22, 1966 #175 #63 Finlay 1991 of Scotland National Museums MEQ 841 Monteiths 1978 #161 G E & R A Lee British Silver G E & Monteith Bowls 1978 #126 Ltd Crichton Bros Christies July 25 #57 Finlay 1991 Shrubsole Huntley House Museum Burlington Magazine 1937, Burlington Magazine pp 278-31 vol 71 p 10-12 1938 July Apollo Clayton Dictionary How of Edinburgh 27, 1957 Christies November Private Collection with shield shaped e, 14 1/8”, 73.1oze, 14 UK Collection Private htly spreading rim foot, rim htly spreading rim, also gadrooned with a rooster a gadrooned with also rim, d of cut card foliage surrounding the surrounding foliage card of cut d s and drop ring handles, 13 ¼ " di, 13 ¼ " handles, ring s and drop tches with plain scalloped edge, plain edge, scalloped tches with plain ng Rocheid, decorated of George Johnson of Westerhall, of George Johnson des, narrow molded rim, engraved with engraved rim, narrow molded des, wl, plain, circular on slig circular plain, wl, detailsp544 Jackson Marks early a twin of the Huntley House exampl Huntley of the early a twin ith, bowl with oval lobed panels, central panel with a coat of arms, of a coat panel with central panels, lobed oval bowl with ith, bowl, on gadrooned foot, everted foot, everted on gadrooned bowl, crest and motto above “VIRTUTE ET LABORE”, 13 ½” di LABORE”, ET “VIRTUTE above crest and motto plain, deep bowl on gadrooned foot, ban plain, deep and masks lions’ of rim, points high on 8 shells foot, the joins it where bowl handles, crest and motto drop ring 12 ½" di, 73oz background stippled, rim with 9 no 9 with stippled, rim background foot and reeded domed lobes, rim with 8 notches, 2 lion’s mask with 8 notches, lobes, rim oz 70 bowl almost straight, tucked in si straight, tucked bowl almost 43.8oz 11” di, OMNIA BONA”, “BONIS crest and motto arms, BOWLS rghdetails no Monteith, Lee British Silver A G E & R rghdetails no Monteith, Lee British Silver A G E & R inburgh impali Kinloch of Arms Monteith, dinburghn Monteith, rn Edinburgh(patched), defective of Cumberland, Duke of the shells, Arms Monteith, zie Edinburghno Punch bowl, PUNCH 1705/06 George Main Edinbu 1702/03 Robert Inglis1702/03 II Cleghorne Thomas Edinbu Edinburgh Punch 1702/03 Cockbu James 1698/991700/01 Colin McKenzie1700/01 Colin McKen E McKenzie Colin Edinburgh Monte 1698/99 Colin McKenzie Ed YEAR MAKER1692/93 Bruce Robert LOCATION DESCRIPTION Edinburgh Bo The Bruce Punch bowl, SOURCE 16 Punch Bowls November 27, November ly 1968 #159 Apollo July 1968 vol 88 p 79 vol 88 1968 July Apollo #63 Finlay 1991 Phillips Edinburgh 2000 Catalog J Bourdon-Smith Sothebys March 16, 1937 #17 Peter Guille Antiques NY USA p104 Wees, Clarke Art Institute #46 Shaw Collection 1983, March Christies Glasgow #70 17, 1988 November Sothebys #100 G E & R A Lee British Silver A G E & R Monteiths 1978 #236 pl 1.42 Christies January or February 25, or Christies January 1970 #24 Shrubsole Private Collection Apollo 1933 vol 18 p156 crest and motto, di, 174ozdi, 1977 #126 15, June Christies een’s bodyguard in Scotlandeen’s bodyguard Cripps p150 , fitted with detachable rim with 9 rim detachable , fitted with handles, later applied similarly domed finial, crest and motto of finial, crest and motto domed similarly tto Sothebys Ju bowl#104 Finlay 1991 di Christies London 1992 #97 di, 50.5oz di, s, crest, motto, coronet of Hope, 15 ¼" Hope, of coronet s, crest, motto, circular on rim foot, flat chased below rim with shells and rim below flat chased foot, rim on circular unch bowl, plain, bowl chased all over with vertical flutes, rim with 8 flutes, rim with vertical over chased all bowl plain, unch bowl, scrolls, crest and motto, “Deum time”of Blackbarony, “Deum for Murray scrolls, crest and motto, Peebleshire, 9” di, 28oz Rutherford, 9” points, 9" di, 19oz di, 9" points, plain reeded undulations, bowl engraved with a cipher, rim engraved with a engraved rim with a cipher, bowl engraved undulations, reeded plain PREST” JOUR “TOUR motto ribanded 14 ¾" di, 78 oz notches, lion mask and drop ring and notches, lion mask Punch bowl, octagonal octagonal Punch bowl, h everted rim with bowl shallow Monteith, hQu of Archers, Punch bowl, Royal Company rgh Punch bowl, crest and mo rgh 7 ½" rim, Monteith, inburghwith cover domed Punch bowl, Edinburgh Punch bowl, Assayer David Mitchell Patrick Inglis Canongate th 1719/20 Ged William Early 18 Edinburg 1718/19 Colin Campbell Edinbu 1739/40 Dougal Ged 1733/34 Aytoun William Edinbu 1709/10 Charles Duncan Ed 1731/32 Kenneth McKenzie Edinburgh Punch bowl, shaped, reeded applied molding,2 crests, everted,12 scalloped, 1728/29 Ker James Edinburgh P YEAR1708/09 MAKER Kincaid Alexander Edinburg LOCATION DESCRIPTION SOURCE 1727/28 Henry Bethune Edinburgh arm Monteith, 17 Compendium of Scottish Silver Sothebys Gleneagles/London #157 1995 August Shaw Collection Collection Shaw 29, March Glasgow Christies 1983 #89 Bowls, Monteith Silver British #310 1978 Lee, E. Georgina by IX 1966 Vol Review Art Scottish cover #3 back advertisement How Ltd Willson Walter Aberdeen Museumsand Art Galleries Phillips December 16, 1977 J Bourdon-Smith London 1994 Autumn H.1995.111 Autumn 2000 2000 Autumn 2001 March Apollo J Bourdon-Smith advertisement Wees, Clark Art Institute p106- Institute Art Clark Wees, 107 #49 FK0U ±´GL HWR5REW ]G LQJIROLDJHDQG DGLQJEDVHPDUNVRQEDVH± WLRQURXQGWKHULPSUHVHQWDWLRQERZO³7KH late, rococo cartouche with 3 masted sailing ship in difficulties, difficulties, in ship sailing masted 3 with cartouche rococo late, bowl, everted chased rim, inscribed inscribed rim, chased everted bowl, Scotland of Museums National (DUORI+RSHWRXQ ´GLR] nd GRXEOHKHDGHGHDJOHRI3HUWKDQFKRU6PP-:±´GLR DUPVRI0DF'RQHOORI*OHQJDUU\òGLR]G Campbell of Dunie forhis service in saving and protecting that ship when forced into Loch Castlein Distress in Novr 1767his Beg Acceptance this of piece of p PDUNVEHQHDWKWKHIRRW±PPWRZQPDUN³2´LQVTXDUHSXQFK ZKL +HQU\6WHXDUW)RWKULQJKDPDQG-DFNVRQNQRZQRWWKHPHDQLQJRI 2ZQHUVRIWKHVKLS+HFWRURI*ODVJRZLQD7HVWLPRQ\RIJUDWLWXG R] ´GL´KWR] beneath the detachable shaped rim, rim with applied plain molding to the the to molding plain applied with rim rim, shaped detachable the beneath ERUGHUHQJUDYHGZLWKDFLSKHUDQG(DUO¶VFRURQHWZLWKLQVFUROO trellis work baroque cartouche, later monogram, cipher and coronet for John, John, for coronet and cipher monogram, later cartouche, baroque work trellis 2 Z 3XQFKERZOIODWFKDVHGGHFRUD Edinburgh Monteith,plain, circular, on domed spreading foot,reeded with a ribapplied Edinburgh Edinburgh di ½" 12 II, George Punch bowl, p 17 1982, Review Silver Lyle illiam Davie or or Davie illiam (continued) (continued) Assayer Hugh Gordon William Dempster Dempster William FD -: 3HUWK 3XQFKERZOFLUFXODUIOXWHGRQVOLJKWO\VSUH 1770 ca 1770 ca Campbell & Milne 1771/72 Glasgow Aitcheson Alexander Edinburgh Punch feet, spreading swags, flower, and scrolls hemispherical almost Punch bowl, YEAR MAKER DESCRIPTION LOCATION SOURCE 1746/47 James Ker 1746/47 James 1750 ca 1750 ca W FD 0LOQH &DPSEHOO *ODVJR 1754/55 Robertson & Lothian Edinburgh body, hemispherical raised with plain, perfectly Punch bowl, 18 Punch Bowls 4 #115 4 75 #40 110 p 74 110 p O HV0DJD]LQHS WLRQDO0XVHXPVRI6FRWODQG -%RXUGRQ6PLWK&DWDORJ 57 p 2001 Autumn 0(4/ -DPHV&KDUOHVDGYHUWLVHPHQW &KULVWLHV-XO\ &KULVWLHV-XO\ 6RWKHE\V-XQH 7KH0DSOH6ZDQ&ROOHFWLRQ 6KUHYHDGYHUWLVHPHQW 6KUXEVROHDGYHUWLVHPHQW Neal's Auction, Nottingham #52 2004, March 29, August Gleneagles Sothebys 1977 #195 /\OH6LOYHU5HYLHZS :LOOLDP(OOLRW(VTRI+DUZRRGòGL RI7UDGHVRI(GLQEXUJK 1DWLRQDO0XVHXPVRI6FRWODQG IUHZVKLUHYROXQWHHUVGLR]G 6RWKHE\V)HEUXDU\ DQGPRWWRDQGODWHU$UPVôGLR] &KULVWLHV-XO\ UDYHGGHFRUDWHGGLR]ERWK R]HD $SROORYR DPHV5RVHRI*HGGHVóGL $QWLTXHV0DJD]LQH)HEUXDU\ R] VSUHDGLQJFLUFXODUEDVHò´GLR] %RJHVE\WKH)LYHV&OXEDW+DPLOWRQòGLR] *ODVJRZ 3XQFKERZOòGL +ROODQG%RRNS (GLQEXUJK 3XQFKERZOó´GLR] $QWLTXHV0DJD]LQHS Edinburgh Punch bowl, perfectly plain bowl, on spreadingrim foot, presentedto John Assayed Edinburgh Simpson Simpson :LOOLDP'HPSVWHU -RKQ=LHJOHU 5REHUW*UD\ 6RQ (GLQEXUJK 3XQFKERZORIWKH,QFRUSRUDWLRQ -DPHV0F.D\ (GLQEXUJK 3XQFKERZOSUHVHQWHGWR&DSWDLQ &XQQLQJKDP -) (GLQEXUJK 3XQFKERZOPPXQDWWULEXWHGGL $QWLTX *HRUJH)HQZLFN (GLQEXUJK 3XQFKERZOLQVFULEHGIURP5HQ 0F+DWWLH )HQZLFN (GLQEXUJK 3XQFKERZOSDLUEDQGHQJ :LOOLDP'DYLHRU : 3&XQQLQJKDP (GLQEXUJK 3XQFKERZO´KWR] 1D -RKQ0F'RQDOG (GLQEXUJK 3XQFKERZOSODLQ$UPVFUHVW 0F+DWWLH )HQZLFN (GLQEXUJK 3XQFKERZOLQVFULEHGWR- YEAR MAKER DESCRIPTION 1773/74 LOCATION Robertson Patrick Edinburgh rim, gadrooned shaped bowl, lobed spirally half III, George Punch bowl, SOURCE 19 Compendium of Scottish Silver 216 Book p ational Museums of Scotland Scotland of Museums ational J Bourdon-Smith London 2006 London Bourdon-Smith J advertisement Bell 1593 MEQ 2000 p76 Bonham's Sale #10914, Lot #14 Lot #10914, Sale Bonham's p93 2005 Catalog Shaw Nicholas MEQ 38 J Bourdon-Smith Catalog Catalog Bourdon-Smith J p53 #38 1996 Autumn J Trace advertisement p 531 advertisement Wilson SODLQFDUWRXFKHGLR] 1LFKRODV6KDZ&DWDORJ:LQWHU LRQ³)URPWKH+LJKODQG6RFLHW\RI6FRWODQG ghland Society of Scotland to Mr. George Bagrie, Bagrie, George Mr. to Scotland of Society ghland foot N WR0U6DPXHO0RUWRQ/HLWK:DONIRUKLVLQYHQWLRQGDWHG´ engraved "Voted the By Highland Society of Scotlandto Mr. Samuel Morton, Leith Walk, forhaving invented a Revolving Brake Harrow foundto be effectual for the exterpation for weeds and pulverizing the ground 1816,"ò´KWóGLR] 9 ¾" di, 36oz 36oz ¾" di, 9 Edinburgh Edinburgh details no bowl, Punch Scotland of Museums National Glasgow Glasgow di ½" 11 Punch bowl, p113 1982 Magazine Antiques Howden W & P Cunningham Cunningham P & W Edinburgh no details Punch bowl, 1992 Magazine Antiques Assayed Edinburgh 1821/22 McKay James 1825/26 or RH CB Edinburgh 1825/26 1825/26 10" di bowl, Punch Grierson Phillip Edinburgh Winter Edinburgh ) 6 on pedestal Punch bowl, pictured not bowl, Punch Edinburgh no details Punch bowl, (GLQEXUJK 3XQFKERZOFKDVHGZLWKFKHUXEVDERYHD 292 p 1999 Magazine Antiques Holland 288 p Clayton 1819/20 William & James -DPHV0F.D\ (GLQEXUJK 3XQFKERZOSUHVHQWDWLRQLQVFULSW 1816/17 McKay James Edinburgh bowl, circular rim, plain dentil foot, circular III, George Punch bowl, YEAR MAKER DESCRIPTION 1811 (or 1815) LOCATION SOURCE 1812/13 McKay James 1813/14 Edinburgh Son & Gray Robert di ¾" 11 pair, Punch bowls, 18 vol 1930 Magazine Antiques 1815/16 McKay James Edinburgh Hi from prize bowl, Punch 20 Punch Bowls Dallas TX TX Dallas Sale 600 May 2004 #18022 2004 May 600 Sale 2004 Catalog Shaw Nicholas p105 Nicholas Shaw Catalog Winter Winter Catalog Shaw Nicholas 2000 p92 Bonham's Sale 10914 lot #13 lot 10914 Sale Bonham's MEQ 747 National Museums of Scotland Scotland of Museums National K.2004.57 Sothebys 1990 #81 #19 foot, foot, ed with flowers, half fluted on pedestal pedestal on fluted half flowers, with ed details details Scotland of Museums National est and motto "Patrentia Vincrit" 9" di, 5 ½" ht, 25 oz oz 25 ht, ½" 5 di, 9" Vincrit" "Patrentia motto and est Galleries, Heritage $UPVRI6LU:LOOLDP2JLOY\±'DOJOHLVKôGLR] 9 1/8" di, 26.5oz 26.5oz di, 1/8" 9 oval cartouches, one depicting a crest beneath which is "John Scott Finnart, Finnart, Scott "John is which beneath crest a depicting one cartouches, oval his for gratitude in Scott, John Mr. to "Presented engraved other the 1837", spirited exertions in saving the Cargo the of Jean & Peggy, stranded 1785, ó´GLR] (VT6XUJHRQ« 1897/98 Crichton David Edinburgh a domed on handles loop and spatulate two with circular Punch bowl, 1893/94 Inches & Hamilton Edinburgh cr bowl, Punch 1889/90 Sorley Glasgow chas circular, bowl, Punch 1835/36 Marshall W & J Edinburgh 2 and garlands floral with engraved bowl, circular foot, domed Punch bowl, 1832/33 Gray Robert 1833/34 Marshall William 1834/35 Glasgow Edinburgh McKay James 14d 36oz 10" di, Punch bowl, details no bowl, Punch Edinburgh no bowl, Punch 572 1980 p Annual Review Lyle May House Hopetoun Sothebys YEAR MAKER DESCRIPTION 1826/27 LOCATION McHattie George Edinburgh 44oz di, ½" 11 bowl, Punch SOURCE 14, 1993 July London Christies 1829/30 1831/32 McKay James 1832/33 Son & Gray Robert Edinburgh Glasgow McKay James chased Punch bowl, 10" di Punch bowl, Edinburgh Kinton, John "To engraved flowers, and leaves with chased Punch bowl, 1994 Catalog Bourdon-Smith J p86 101 1975 vol July Apollo 21 Compendium of Scottish Silver 22 Slop Bowls SlopSLOP BowlsBOWLS Plate 5. A 1734/35 3 footed shallow Slop Bowl by James Tait, Edinburgh. Courtesy of The Phoenix Collection. Photograph by Janice M Dietert 23 Compendium of Scottish Silver Sotheby's London March 6, 2004 2004 6, March London Sotheby's #254 Delieb p78-79 Delieb Sothebys November 11, 1982 1982 11, November Sothebys #16 J Bourdon-Smith London 1993 London Bourdon-Smith J Collection Phoenix The Nicholas Shaw Catalog 2004 p98 2004 Catalog Shaw Nicholas ´GL 3 paw feet, pad supports, 6" di, 29oz 29oz di, 6" supports, pad feet, 3 paw FURZQHGOHRSDUG¶VKHDGHUDVHGLQLWLDOEHORZ³$+´ó´KWó 6" di, 7oz 17d 17d 7oz di, 6" LQLWLDOV´GLR] SLOP 1735-40 Forbes Alexander Aberdeen on work, trellis and shells flowers, with flat-cased edge, scalloped bowl, Slop 1734/35 Tait James Edinburgh rubbed partially crest, feet, pad 3 on plain, lip, everted or sugar, bowl, Slop 1735 ca 1735 ca Forbes Alexander Aberdeen feet, paw and trefoil 3 on rim, scalloped everted, form, bombe bowl, Slop 1733/34 Aytoun William Edinburgh above, crown Barons Arms/Supporters, later scalloped, everted bowl, Slop 1730 ca 1730 ca Cooper George Aberdeen 4.1oz di, ¾" 3 foot, pedestal on rim upright scalloped with circular bowl, Slop Collection Noble YEAR MAKER DESCRIPTION LOCATION SOURCE 24 Strawberry Bowls StrawberrySTRAWBERRY BOWLS Bowls Plate 6. A Strawberry Bowl/Dish 1730ca by George Cooper, Aberdeen. Courtesy of The Maple Swan Collection 25 Compendium of Scottish Silver DO $QWLTXH6LOYHU &KULVWLHV(GLQEXUJK-XQH #340 6RWKHE\V1RYHPEHU #287 7KH0DSOH6ZDQ&ROOHFWLRQ YRO,S Christies South Kensington Kensington South Christies 2FWREHU YRO,S $QWLTXHV6KRZ1<& Bonham Edinburgh August 2003 2003 August Edinburgh Bonham #64 16d ] UHVWDQGPRWWRVFULSWLQLWLDOV³,&´VLGHV ZLWK/DWLQLQVFULSWLRQR] +RZRI(GLQEXUJK LQVHJPHQWV +RZ¶V1RWHVRQ$QWLTXHV6LOYHU ZLWKODWHULQLWLDOVRI6DUDK5REHUWVRQR] +RZ¶V1RWHVRQ GRQULPIRRWFHQWHUHQJUDYHGZLWKFUHVWDQG WHGRQULPIRRWIODWFKDVHGSDQHOVRI IROLDJHZLWKPROGHGVFDOORSHGULPRISRLQWVò´GLR] IOXWHGLQWRSDQHOVEHORZVKDSHGULPULQJIRRWò´GLR motto motto 00´GLR] (GLQEXUJK 6WUDZEHUU\ERZOQRGHWDLOV .RRSPDQ ,QWHUQDWLRQ $VVD\HU±(GZDUG Penman STRAWBERRY :LOOLDP$\WRXQ (GLQEXUJK 6WUDZEHUU\ERZOFLUFXODUIOX :LOOLDP$\WRXQ 'DYLG0LWFKHOO (GLQEXUJK 6WUDZEHUU\ERZO7KH+DLJ%RZO :LOOLDP$\WRXQ (GLQEXUJK 6WUDZEHUU\GLVK7KH+DLJ'LVK :LOOLDP*HG (GLQEXUJK 6WUDZEHUU\GLVKFLUFXODUIOXWHG FD *HRUJH&RRSHU $EHUGHHQ 6WUDZEHUU\ERZOHQJUDYHGZLWKF +HQU\%HWKXQH (GLQEXUJK 6WUDZEHUU\GLVKFLUFXODUIOXWH 1717/18 Yorstoun Mungo Edinburgh initials motto, and crest foot, rim on form circular fluted, bowl, Strawberry YEAR MAKER DESCRIPTION LOCATION SOURCE 26 Sugar Bowls SugarSUGAR BOWLSBowls Plate 7. A Sugar Bowl 1750/51 by James Mitchell, Edinburgh. Courtesy of The Phoenix Collection. Photograph by Janice M Dietert 27 Compendium of Scottish Silver London 1993 hebys London Picture Files Picture London hebys pollo March 1971 vol 93 p2 pollo March 1971 vol Bourdon-Smith Christies December 13, 1967 Christies December Wilson and Sharpe Noble collection Bell advertisement 1944 # 5 Christies Scotland November 11, Christies Scotland November 1987 #55 Sothebys July1968 4, #159 Walter Willson Private Collection Christies November 29, 1972 Christies November #108 Silver How’s Notes on Antique vol 4 p9 1944, SothebysOctober 22, 1970 #213 Jackson 2 vols p980 # 1329 MEQ 1346 spreading foot, a beaker, plain, circular a beaker, foot, engraved with a foot, engraved band above and below, on rim below, and band above 8oz 5d8oz on Antique Silver How's Notes foot, bird crest, engraved, 4 ½" di, 4 ½" engraved, bird crest, foot, ading bowl on with cover also with a rim foot on foot rim with a with cover also , split rim, 6" di, 10oz, split rim, A hemispherical but with everted lip, with everted but hemispherical bands of flutes, shield, 5 ¾" di 5 ¾" flutes, shield, of bands a sugar bowl, probably for a different purpose, different for a bowl, probably sugar a molded foot, rim on coverrim foot, molded Sot cked in on splayed rim rim on splayed in cked over, also sometimes called over, also sometimes , plain, circular, spre p on rim with footed (rim) top, with footed (rim) rim p on cup on rim, cover missingrim, cup on J wl, octagonal wl, of Scotland National Museums ar bowl, octagonal box/bowl, set later initials, script "SR", 4 3/8" ht, set later initials, script "SR", 4 3/8" box/bowl, octagonal ar bowl, ar bowl, plain, window ar lozenge bowl, ar bowl, plain, circular, almost almost plain, circular, ar bowl, narrow molded rim, cover with similar rim with similar cover rim, molded narrow 10oz 19d nearly straight sided body, tu sided nearly straight 6.5oz ht, 3 1/8” di, 3 ¾” crest and motto, engraved with contemporary arms of Hathorn of Over-Aries (Wigton) of Hathorn Over-Aries arms with engraved contemporary in ri Phisgill, with mottos Stewart of quartering di 7 ½” foot, top, top, 3 5/8" di, 8oz 3d 15oz 8d decorated, circular molded foot, 2 foot, decorated, circular molded hwithout its c Sugar bowl, inburgh cu Sugar bowl, inburghon rim, foot covered bowl, Sugar bowl, inburghwith lid Sugar bowl, Edinburgh Sugar bowl, SUGAR 1719/20 Henry Bethune1719/20 Not available Edinburgh1720 ca Sug Penman Edward Ed Edinburghon sugar covered bowl, Sugar 1719/20 Mitchelson James Ed 1718/19 Aytoun William Edinburg 1718/19 Campbell Colin Edinburgh Sug 1718/19 John Seatoun Ed 1718/19 John Seatoun 1717/18 Henry Bethune1718/19 Aytoun William Edinburgh Sugar bo Edinburgh Sug YEAR1695 ca MAKER Walter Scott LOCATION Aberdeen DESCRIPTION as described sometimes Bowl, SOURCE 28 Sugar Bowls p152 #3 Scottish Art Review 1964 vol IX IX 1964 vol Review Art Scottish cover #3 back Edinburgh of How Collection Shaw #73 1991 Finlay 1983 March Glasgow Christies #93 Scotland of Museums National 1983 1561 MEQ Christies Edinburgh February 1, 1, February Edinburgh Christies 1991 #245 #165 12, 1954 January Christies Lumley 1983 March Glasgow Christies #92 +RZ¶V1RWHVRQ$QWLTXHVLOYHU p9 4, vol 1944, Collection Shaw I, vol 1911 Exhibition Glasgow p108 #22 Christies May 4, 1949 #83 #83 4, 1949 May Christies 12, October London Christies 1966 Edinburgh of How Christies February 27, 1974 27, 1974 February Christies Clayton Christies Book Private Collection UK UK Collection Private WRSEDOOILQLDO´KWR] ´GLR] 6oz 3d 6oz bowl, 6 oz 3d 3d oz 6 bowl, 4 ½" di, 6oz 2d 2d 6oz ½" di, 4 Edinburgh Sugar bowl, plain on spreadrim foot, just short of hemispherical, 4½" di, Edmonstoun Edmonstoun 1723/24 Aytoun William 1723/24 Alexander Edinburgh 18d 6oz di, ¾" 4 foot, molded plain, bowl, Sugar 1723/24 Ker James 1724/25 Ker James Edinburgh #84 1954 13, October Christies creamer helmet accompanying and rim scalloped with circular, bowl, Sugar Sharp & Wilson Edinburgh domed double and cover, bowl on marked pedestal, on covered, Sugar bowl, 1723/24 Aytoun William Edinburgh gilt, "AS," initials and crest engraved, later missing, cover bowl, Sugar YEAR MAKER DESCRIPTION 1721/22 LOCATION Mitchelson James Edinburgh edge molded rim, bordered wavy everted Sugar bowl, Moffet Muirhead SOURCE 1723/24 Aytoun William 1723 ca Edinburgh available Not motto, and crest later foot, spreading on hemispherical plain, bowl, Sugar Edinburgh Edmonstoun an Alexander probably bowl, sugar circular plain, Sugar bowl, 29 Compendium of Scottish Silver 1934 #141 #141 1934 Apollo 1934 vol 20 p25 20 1934 vol Apollo advertisement Sharp & Wilson #134 1991 Finlay How's Notes on Antique Silver p23 I, 1941 vol Scotland of Museums National Christies February 27, 1971 #160 27, 1971 February Christies Art Institute of Chicago Chicago of Art Institute 15, October NY East Christies 1996 #354 1996 Shrubsole, Collection Phoenix The 1983, March Glasgow Christies #88 #81 1971 31, March Christies Art of Museum Metropolitan 1983 #133ab #81 1971 5, March Christies collection How How of Edinburgh 1937 #92 1937 Edinburgh of How UK Collection Private How Collection Collection How Collection Gardner 1934 Magazine Connoisseur 93 p347 vol Crichton Bros Bros Crichton ece set, possibly with crest everted, scalloped, part of a 4 pi a 4 of part scalloped, everted, Leyboum or Poplar,½" 8 di, 19oz 5d cover, engraved monogram, with stand to match, both body near the mouth mouth the near body both match, to stand with monogram, engraved cover, 4"di, compartments, in foliage formalized of band a have lid the and total 12d oz 12 everted corded rim, coat of arms, crest and motto of Kelsoe, approximately approximately Kelsoe, of motto and crest arms, of coat rim, corded everted 12d, 11oz wt scratch ¾" di, 5 Annandale, withan accompanying stand Edinburgh Edinburgh of motto and arrows) (3 crest edge, molded border, wavy everted bowl, Sugar Edinburgh Sugar bowl, covered sugar on spreading foot, engraved border bayonet fitting $VVD\HU±(GZDUG Penman 1727/28 Aytoun Mitchell David 1727/28 William Edinburgh (later), rim chased everted Sugar bowl, p69 vol53 1962 March Apollo 1727/28 James Tait Tait 1727/28 James 1727/28 Ker James Edinburgh foot, raised on points 12 edge, molded circular, a set, of part Sugar bowl, 1726/27 Ker James Edinburgh slightly feet, paw lion with knees mask lion on 3 bowl circular Sugar bowl, 1725/26 Aytoun William Edinburgh of Marquess Johnston, of crest with Bowl, Annandale The bowl, Sugar YEAR MAKER DESCRIPTION 1724/25 LOCATION Mitchell Thomas Edinburgh no details octagonal, Sugar basin, SOURCE notes p546 Marks Jackson 1725 ca 1725 ca Luke Robert Glasgow 10d 11oz long, 4" outline, shaped finial, baluster oval, and cover, Sugar bowl 19, March Christies 30 Sugar Bowls #69 1972 1972 YRO atalog & view 1971 vol 1971 vol view HFHPEHU H &KULVWLHV' London Koopman YROS &KULVWLH V(GLQEXUJK $SULO :LOOLDPVEXUJ S Bell advertisement advertisement Bell &KULVWLHV0D\ 6RWKHE\V2FWREHU YRO advertisement Bell 6FRWWLVK$UW5H cover #2 back XIII, advertisement Edinburgh of How -XO\ 1HJDWLY November 10, 1998 #86 #86 1998 10, November PRXWK´KW ´GLR] KDQGOH &RQQRLVVHXU0DJD]LQH WVOLJKWVSUHDGLQJVLGHVôGLR]G $SROOR0DUFK RUGHUPROGHGHGJHR]G &KULVWLHV6FRWWLVK3LFWXUH)LOHV RUGHUPROGHGHGJH´GL &KULVWLHV6RXWK.HQVLQJWRQ HUWHGULP $QWLTXHV0DJD]LQH)HEUXDU\ HGJHLQLWLDOVRQERWWRPSRLQWV +\PDQ&ROOHFWLRQ&RORQLDO RUGHUPROGHGHGJHSRLQWVGLR] 1LFKRODV6KDZ crests side by side under ribanded mottos, with a matching teapot teapot matching a with mottos, ribanded under side by side crests SRLQWVòGLR] GHWDFKDEOHFRYHUZLWKDEDOXVWHUILQLDORQVSUHDGLQJIRRWô ³$0´GHWDFKDEOHFRYHUERG\ZLWKRQHEDQGRIIROLDJHQHDUWKH Edinburgh Sugar bowl, plain, circular, on spreading foot, shapednarrow molded border, -DPHV.HU (GLQEXUJK 6XJDUERZOFXSSLQJERZOZLWKVKHOO -DPHV0LWFKHOVRQ (GLQEXUJK 6XJDUERZOFLUFXODUZDY\E 128/29 Penman Edward Edinburgh 2 with base stepped circular on cover, detachable its lacking Sugar bowl, :LOOLDP$\WRXQ -DPHV0LWFKHOVRQ (GLQEXUJK 6XJDUERZOHYHUWHGPROGHG 1RWDYDLODEOH (GLQEXUJK -DPHV.HU 6XJDUERZOVPDOOSODLQQRHY (GLQEXUJK 6XJDUERZOSODLQFLUFXODUULPIRR +HQU\%HWKXQH (GLQEXUJK 6XJDUERZOHYHUWHGULPZDY\E +HQU\%HWKXQH (GLQEXUJK 6XJDUERZOHYHUWHGULPZDY\E 1728/29 Bethune Henry Edinburgh monograms, below crested double body, spherical covered, Sugar bowl, YEAR MAKER DESCRIPTION 1727/28 LOCATION Mitchelson James Edinburgh edge molded border, wavy stand, with rim, flat shaped bowl, Sugar 1929 Exhibition Lane Park SOURCE 1727/28 Tait James Edinburgh initials the enclosing wreath a with engraved circular, covered, Sugar bowl, 31 Compendium of Scottish Silver ber 22, 22, ber R ecember 20, LVVHXU0DJD]LQH &KULVWLHV$SULO 3KLOOLSV(GLQEXUJK$XJXVW 2001 # Winter Catalog Shaw Nicholas S Sothebys September 23, 1973 #3 1973 23, September Sothebys &KULVWLHV-XQH / vol 135 p 90 p 90 135 vol Asprey (London) 1992 (London) Asprey Collection Phoenix The Christies London D London Christies 1972 #179 J Bourdon-Smith London Private Collection Collection Private ò´GL ó´GLR] GLR]G &KULVWLHV-DQXDU\ foot, engraved with G HVWDOEDVHô´GLR]G 6RWKHE\V6FRQH$SULO IHHWZLQJHGFKHUXE¶VPDVNVDERYHVKDSHG SUHDGLQJULPIRRWR]G &KULVWLHV-XO\ LQZRUQPDUNV±H*&FDVWOHVR] 3KLOOLSV(GLQEXUJK2FW PROGHGULPSRLQWVVFUDWFKZWRQ LQLWLDOV³*5&)´PDUNVRQEDVH±*&WRZHUVJRWKLFH± PROGHGULPFKDVHGEHORZZLWKVKHOOVPDVNVDQGGUDSHU\IHVWRRQV R]G PROGHGULPRQFLUFXODUIRRW´GLR] bottom bottom HQJUDYHGZLWKDFUHVWò´GLR] $EHUGHHQ 6XJDUERZOSODLQFLUFXODUERZOEUDVVZLUHULPó (continued) (continued) FD 5REHUW/XNH *ODVJRZ 6XJDUERZOZDYHGUHHGHGULPRQSHG 1730 ca 1730 ca Cooper George Aberdeen spreading stepped form, circular plain Sugar bowl, FD 5REHUW/XNH *ODVJRZ 6XJDUERZORQELIXUFDWHGVFUROO 1730 ca 1730 ca Forbes Alexander 1730 ca Aberdeen Luke Robert details no basin, Sugar Glasgow shaped a coronet, below initials with engraved later circular, Sugar bowl, Scotland of Museums National FD *HRUJH&RRSHU $EHUGHHQ 6XJDUERZOZLWKFRYHUVHW &RQQR 1730 ca 1730 ca Cooper George FDFD *HRUJH&RRSHU *HRUJH&RRSHU $EHUGHHQ $EHUGHHQ 6XJDUERZOSODLQFLUFXODURQV 6XJDUERZOFRYHUFLUFXODUSOD :LOOLDP$\WRXQ (GLQEXUJK 6XJDUERZOHYHUWHGVFDOORSHG YEAR MAKER DESCRIPTION LOCATION SOURCE 1729/30 Bethune Henry Edinburgh rim, molded and border wavy everted with foot, molded on bowl, Sugar 32 Sugar Bowls 1937 #86 1937 February February #161 #161 ecember 20, Christies June 23, 1971 #72 1971 23, June Christies D Christies 1939 p107-109 1939 p107-109 Collection How Connoisseur Magazine July 1961 Magazine Connoisseur advertisement How L1980.7 MEQ 29, August Gleneagles Sothebys 1978 #396 1982 p16 Review Silver Lyle Lumley Collection Collection Lumley 1967 14, December Sothebys #107 Edinburgh of How Scotland of Museums National 1983.25 MEQ The Maple Swan Collection Sothebys January 22, 1970 #168 1970 22, January Sothebys Antiques Vander C J Magazine Antiques 1987 February advertisement Shrubsole Collection Phoenix The no details details no Scotland of Museums National rim, 5 ½" di, 6oz 6d 6d 6oz di, ½" rim, 5 8 points, 6" di, 7oz 8d 8d 7oz di, 6" 8 points, Cuique?", 4" di, 3" ht, 8oz 16d 16d 8oz ht, 3" di, 4" Cuique?", motto, 9 points points 9 motto, 4 ¾" di ¾" 4 1732/33 Aytoun William Edinburgh 10d 7oz di, 6" , border wavy rim, everted bowl, Sugar #116 20, 1935 February Christies 1732/33 Aytoun William Edinburgh 1732/33 on points 8 33-set, like foot edge, molded scalloped, everted, bowl, Sugar Aytoun William Edinburgh 8 points probably foot, cup-type on edge molded border, wavy bowl, Sugar Magazine Connoisseur 1731/32 Ker James 1731/32 Bethune Henry Edinburgh Edinburgh covered, bowl, Sugar motto, and rim, crest molded border, wavy scalloped everted Sugar bowl, 1731/32 Aytoun William Edinburgh "Suum motto, and crest edge, molded scalloped everted bowl, Sugar 1731/32 Aytoun William Edinburgh 5d 8oz crest, edge, molded border, wavy scalloped, everted bowl, Sugar 3, 1961 May Christies 1731/32 Ker James Edinburgh and crest foot, pedestal tall on rim molded and border wavy with Sugar bowl, YEAR MAKER DESCRIPTION 1731/32 LOCATION Ure Archibald Edinburgh castle, three turreted of crest not everted, rim molded plain bowl, Sugar SOURCE 33 Compendium of Scottish Silver 2 #97 HFHPEHU &RQQRLVVHXU0DJD]LQH 93 p131 vol &KULVWLHV' #73 1991 Finlay &KULVWLHV$SULO Exhibition 1994 London Asprey 6RWKHE\V-XQH Sothebys November 11, 1993 1993 11, November Sothebys %DURQ&DUEHU\ 1982 11, November Sothebys Sothebys London November 11, &RQQRLVVHXU0DJD]LQH YROS advertisement How &OD\WRQ'LFWLRQDU\S Sothebys November 11, 1993 1993 11, November Sothebys +RZ&ROOHFWLRQ &RQQRLVVHXU0DJD]LQH YROS Sothebys October 31, 1974 #82 #82 1974 31, October Sothebys foot, VLPLODU DURQ¶VFRURQHW III baron III baron SHGDQGPROGHGVFDOORSHGULP RRIIHHWLVVXLQJIURPWUHIRLOVó´GLR] HGHGJHORZEURDGIRRWòGLR] &KULVWLHV/RQGRQ-XO\ \ERUGHUPROGHGHGJHóGLR]G &KULVWLHV$SULO HDGHGHGJHSRLQWVFUHVWDQGPRWWRRI'XUKDP VFUROOVIUXLWDQGIROLDJHRQK Girdwood Tea Service, 9 points points 9 Tea Service, Girdwood 5 ¾" di ¾" di 5 stand WRJHWKHUZLWKVWDQG$UPVRI0HQ]LHVLPSDOLQJ&DPSEHOOZLWKD SRLQWVHQJUDYHGZLWKVOLJKWO\ODWHUFRDWRIDUPVDOOEHORZDE arms of Evans quartering Stafford impaling Noel for George &DUEHU\LQFDWDORJE\&KULVWLHV´GLR] UHHGHGVSUHDGLQJIRRWò´GLR] ò´GLR] :LOOLDP$\WRXQ (GLQEXUJK 6XJDUERZOFLUFXODUZLWKHYHUWHGVKD :LOOLDP$\WRXQ (GLQEXUJK 6XJDUERZOVHUUDWHGQRQHYHUW 1734/35 available Not Edinburgh with chased flat is rim everted shaped circular, compressed Sugar bowl, 1733/34 Aytoun William Edinburgh the of part edge, molded rim, scalloped everted border, wavy bowl, Sugar $OH[DQGHU.LQFDGH (GLQEXUJK 6XJDUERZOHYHUWHGZDY\E 1733/34 Aytoun William Edinburgh points, 9 edge, molded with rim scalloped border, wavy everted bowl, Sugar 1733/34 1733/34 Aytoun William Edinburgh rim, on wavy everted a slightly below bowl, plain hemispherical bowl, Sugar -DPHV0LWFKHOVRQ (GLQEXUJK 6XJDUERZOHYHUWHGULPZDY YEAR MAKER DESCRIPTION 1732/33 LOCATION Aytoun William Edinburgh stepped spreading on points, 8 edge, molded border, wavy bowl, Sugar SOURCE 34 Sugar Bowls 970 #57 ecember 9, 1 Sothebys January 29, 1967 #185 1967 29, January Sothebys Antiques Bloom N #72 Negative #730829 Negative #72 Sothebys August 27-28 1970 1970 27-28 August Sothebys #110 Phillips Edinburgh May 17, 1991 1991 17, May Edinburgh Phillips #82 Christies D Christies #120 1991 Finlay 1939 Academy Art Scotland #969 Shreve advertisement Low & Crump 1940s the from probably Christies June 16, 1977 #121 1977 16, June Christies #650 p419 Dictionary Clayton Scotland of Museums National 1977.8 1209 MEQ Sothebys March 23, 1994 1994 23, March Sothebys 193? Magazine Connoisseur 98 p241 vol #99 1937 Edinburgh of How rcular, on molded feet, with everted scalloped rim, rim, scalloped everted with feet, molded on rcular, PROGHGVSUHDGLQJIRRWò´GLR] IHHW´GLR] with leaf and shell motifs on matted ground, base with initials, on molded molded on initials, with base ground, matted on motifs shell and leaf with VSUHDGLQJIRRWò´GLR]G engraved with crestand motto, 7oz cream jug, cream 5 ¼"jug, di ERZOHGJHIOXWHGVHFWLRQVLQVLGHò´GL Hope, part of a set a set of part Hope, Edinburgh Edinburgh ½" di rim, 5 on points 8 1748, as misdated bowl border, wavy Sugar bowl, 1971 23, June London Christies Glasgow Glasgow chased rim, wavy flattened plain, body, hemispherical almost bowl, Sugar Banff Banff with Duff, of motto and crest edge, molded scalloped everted bowl, Sugar $VVD\HU±$UFKLEDOG Ure Bilsings Bilsings 1735/36 William Aytoun Aytoun 1735/36 1735/36 William Ker James Edinburgh Grant Castle on feet, Sugar bowl, p150 Cripps 1735/36 Tait James Edinburgh lip, on and wavy everted quite plain, body, hemispherical almost Sugar bowl, 1735 ca 1735 ca Johan Got-helf- 1735 ca 1735 ca Gordon Patrick 1735/36 Mitchelson James Edinburgh hoof 3 on border, trellis and shell with engraved plain, circular, Sugar bowl, 1734/35 1735/36 Aytoun William Mitchelson James Edinburgh Edinburgh details no bowl, Sugar ci shaped, bowl, Sugar #90 1961 2, February Sothebys 1734/35 available Not Edinburgh on 12 points inside, fluting spiral edge, molded border, wavy Sugar bowl, YEAR MAKER DESCRIPTION 1734/35 LOCATION Ged Dougal Edinburgh 7oz ½"di, 5 chased, everted, circular, bowl, Sugar #146 1967 26, January Sothebys SOURCE 1734/35 Ker James Edinburgh of coronet motto, crest, chasing, light feet-set, pad 4 on everted Sugar bowl, 35 Compendium of Scottish Silver Christies Glasgow Sale, March Sale, March Glasgow Christies #71 1983 Lot Collection Shaw advertisement Bell MEQ 1164 1976.11 #912 1939 Exhibition Collection Milne-Davidson Christies June 18, 1969 #189 1969 18, June Christies AntiquesSimon Kaye #157 1976 2, June Christies Nicholas Shaw Catalog Winter Winter Catalog Shaw Nicholas 2000 p68 p 26 #46 2005 Autumn Noble collection collection Noble 2004 Catalog Shaw Nicholas p108 1938 Exhibition Empire Glasgow #913 Scotland of Museums National K2004.208.1 foot, evertedrim chased with a band of 10 points, 6 ¼ " di, 8oz 10d 10d 8oz di, ¼ " 6 10 points, IORZHUVVKHOOVDQGGLDSHUZRUN´GLR] on side, 4 1/8" di, 4.7oz 4.7oz di, 1/8" 4 on side, ailable ailable Edinburgh 2 crests shape, ball covered bowl, Sugar #913 Waldron (continued) (continued) 1737/38 Ure Archibald 1737/38 Ure Archibald Edinburgh 1737/38 oz 10 6" di, chasing, edge crude everted, slightly Sugar bowl, Aytoun William Edinburgh band chased with rim everted slightly bowl, Sugar Edinburgh di ½" 5 feet, 3 on flowers, and shells chased rim, everted bowl, Sugar 95 p219 vol 1982 April Apollo Academy Art Scotland Scotland of Museums National 1737/38 Ker James Edinburgh foot, spreading on edge, molded border, wavy scalloped everted Sugar bowl, 1735/36 Lothian Edward 1736/37 1737/38 Edinburgh Ged Dougal foot pedestal edge, Chippendale Ure Archibald Sugar bowl, Edinburgh Edinburgh Moray Earl of handles, capped leaf 2 with bowl, Sugar molded on circular Sugar bowl, Catalog Bourdon-Smith J #70 1991 Finlay YEAR MAKER DESCRIPTION LOCATION SOURCE 1735 ca 1735 ca 1735 ca available Not 1735 ca av Not Edinburgh Cooper George plain scroll, everted Sugar bowl, Aberdeen "CF" above "GR" script engraved foot, on pedestal bowl circular Sugar bowl, #912 Waldron 36 Sugar Bowls 1938 #32 1938 4, 1961 #153 4, 1961 ecember 14, Christies April 27, 1949 #81 1949 27, April Christies Christies D Christies Christies Scotland November 14, 14, November Scotland Christies 1985 #293 Picture Scottish London Christies in 1952 but File auction sent for returned Christies November 11, 1964 #62 1964 11, November Christies Christies March 29, 1983 #31 #31 1983 29, March Christies Christies May 26, 1971 #145 26, 1971 May Christies #75 1964 19, March Sothebys # 1985 30, April Sothebys W03765 Sale Sothebys #254 2003 6, March Olympia J Bourdon-Smith Catalog Spring Spring Catalog Bourdon-Smith J 1983 Hearst Collection Collection Hearst &$VWUXFN OV³70´ oof feet,silver R] ece set DQGPRWWR³/29(,1 HWZLWKOLRQV¶PDVNVDERYHFKDVHGZLWK HWZLWKOLRQV¶PDVNVDERYHFKDVHGZLWK oof feet, everted chasedrims, 5½" di,5oz 12d */25<´ IORZHUKHDGVDQGIROLDJHRQPDWWHGJURXQGSODLQPROGHGULPPP ;¶V´GLR] calyx to the bowl chased with flowers and similarly chasedrims, tripleleaf finial IORUDOVZDJVRQPDWWHGJURXQGPROGHGOLSHQJUDYHGZLWKLQLWLD SURYHQDQFH&KULVWLHV0DUFKò´GLR] shaped everted rim, chased with flowers, foliage and shells, engraved with with engraved shells, and foliage flowers, with chased rim, everted shaped LQLWLDOV´GLR] ground the to low VKHOODQGIROLDWHPRWLIVRQVSUHDGLQJIRRW´GLR] GHFRUDWLRQRQKRRIIHHWLVVXLQJIURPWUHIRLOV´GL $EHUGHHQ 6XJDUERZOKDQGOHGERG\ZLWKVSLUDOIOXWHVFUHVW Edinburgh Edinburgh large body 3 feet, on edges molded border, wavy rim, everted Sugar bowl, Edinburgh Sugar bowl, plain,hemispherical, everted lip, chased with flowers, diaper, Henry Bethune Henry Assayer David Mitchell 1740 ca 1740 ca Coline Allan 1740 ca available Not h 3 on each jug, cream and cover shaped, coconut Sugar bowl, FD &ROLQH$OODQ $EHUGHHQ 6XJDUERZOFLUFXODURQSDZIH 1739/40 HB conjoined conjoined 1739/40 HB 1739/40 Edward Lothian Lothian 1739/40 Edward 1739/40 1739/40 Blair Charles 1739/40 Lothian Edward Edinburgh Ker James Edinburgh 13d 8oz di, ¾" 5 chased, rim, everted circular, Sugar bowl, FD 13d 6oz crest, later with shells, and flowers rim, chased shaped Sugar bowl, 1 July Christies Edinburgh &ROLQH$OODQ pi a 4 of part feet, paw 3 on chased, everted, Sugar bowl, #73 12, 1940 July Christies $EHUGHHQ 6XJDUERZOFLUFXODURQSDZIH 1738/39 Ker James Edinburgh sides, rounded with body plain feet, hoof and 3 scroll on circular Sugar bowl, YEAR MAKER DESCRIPTION 1737/38 LOCATION Penman Hugh Edinburgh h 3 on circular bowl, Sugar SOURCE 1737/38 Aytoun William Edinburgh usual the with chased flat rim, everted bowl, hemispherical bowl, Sugar 37 Compendium of Scottish Silver 1930 #25 1930 1938 #32 1938 962 #12 ecember 17, HFHPEHU O0XVHXPVRI6FRWODQG Christies January 26, 1972 #103 #103 26, 1972 January Christies $QWLTXHV0DJD]LQHYRO Shrubsole p43 99 1974 vol January Apollo 1DWLRQDO0XVHXPVRI6FRWODQG p13 17 1933 vol Apollo advertisement How Christies July 5, 1967 #172 #172 5, 1967 July Christies Antiques Ltd Preston advertisement Christies April 12, 1967 #44 1967 12, April Christies Collection How advertisement Asprey Spink #14 1960 22, June Christies &OD\WRQ'LFWLRQDU\S Hearst Collection Collection Hearst 1957.253 Christies NY USA October 27, 27, October USA NY Christies 1986 #562 ece tea RWDQG IHHWòGLR]G &KULVWLHV' HFHVHWFUHVWHGó´GL 6RWKHE\V0DUFK ORZHUVDQGVFUROOVR]G &KULVWLHV' NHWKH0LWFKHOOERZO $SROOR0DUFKYROS ZDYHRUQDPHQWVLPLODUO\GHFRUDWHGVKDSHGULP´GLR]G Curie Curie WUHILGNQHHVR]G service GROSKLQKDQGOHG'HPSVWHURU'DYLHFUHDPERDW VKDSHGULPSDUWRIDPL[HGVHWZLWK-DPHV0LWFKHOVRQWHDS set, "AE" for the Erskine family VFUROOHGIHHWPDVNVDQGGUDSHU\òGLR]G GRPHGFRYHUEDOXVWHUILQLDOò´ORQJR] 6XJDUERZOQRGHWDLOV 1DWLRQD Edinburgh Edinburgh of motto and crest a set, of part feet, paw 3 on chased, everted, bowl, Sugar Edinburgh Sugar bowl, on 3 paw feet, trefidattachments, very broad evertedand chased (GLQEXUJK 6XJDUERZOFLUFXODUHYHUWHGULPFKDVHGRQKRRI :LOOLDP'HPSVWHU :LOOLDP'DYLH 5REHUW+RSH (GLQEXUJK 6XJDUERZOHYHUWHGULPFKDVHGI :LOOLDP'DYLHRU :LOOLDP$\WRXQ 1743 ca (GLQEXUJK Glen James 6XJDUERZOHYHUWHGFKDVHGOL Glasgow and scrolls flowers, with chased sides feet, paw 3 on circular, Sugar bowl, 1742/43 Lothian Edward Edinburgh pi a 3 of part chased, rim, everted bowl, Sugar :LOOLDP'HPSVWHURU (GZDUG/RWKLDQ (GLQEXUJK 1740/41 Hugh Penman Penman 1740/41 Hugh 1743/44 Ker James 1743/44 Ker James Edinburgh a of part feet, paw with legs cabriole 3 on chased, rim, everted Sugar bowl, Edinburgh feet, paw with legs cabriole 3 on chased, rim, everted circular, Sugar bowl, 1742/43 Clark James Edinburgh pi a 3 of part chased, foot, domed on stepped rim, everted Sugar bowl, 1740 ca 1740 ca Luke Robert Glasgow 4 truncated on rim, bowl along cherubs and masks winged, Sugar bowl, YEAR MAKER DESCRIPTION 1740 ca LOCATION Luke Robert Glasgow rim, molded foot, on spreading body, bombe oval cover, with Sugar bowl, SOURCE 38 Sugar Bowls Scottish Art Review 1966 vol IX, IX, 1966 vol Review Art Scottish cover #4 back advertisement Edinburgh of How Collection Private Sothebys February 26. 1976 #139 1976 26. February Sothebys Christies March 27, 1984 #269 #269 1984 27, March Christies Christies Glasgow March 1983, 1983, March Glasgow Christies #46 1983.26 L MEQ Sothebys March 25, 1981 #167 #167 1981 25, March Sothebys Spencer Marks Antiques F237 F237 Antiques Marks Spencer East Walpole, MA USA Sothebys March 18, 1962 #12 1962 18, March Sothebys October Magazine Connoisseur 1968 Hyman Collection - Colonial Colonial - Collection Hyman Williamsburg 1996 June Magazine Antiques pp845-856 1947.363 1947.363 G lat everted rim chased with a a with chased rim lat everted foot, everted shapedand chasedrim, script lbous body, everted chased rim, foliate and scroll flat flat scroll and foliate rim, chased everted body, lbous details details Scotland of Museums National KROGLQJDQDXWLFDOLQVWUXPHQWPRWWRVHGXOLWDWHòGLR] OHDYHVDQGVKHOOVRQIHHWKHDGHGE\WUHIRLOV´GLR]G 8 7/8" di, 14oz 14oz di, 7/8" 8 engraved with crest, shaped evertedrim engraved with flowerheads and Bogle, of crest foliage, band of foliage, flowers and wave ornament, engraved with crest and motto, motto, and crest with engraved ornament, wave and flowers foliage, of band ´GLR]G FKDVLQJFDVWDSSOLHGIHHWDVOLRQV¶SDZVò´GLR] Curle, part3 a piece of tea service LQLWLDOV³&6´XQGHUQHDWK Edinburgh Sugar Bowl, George II, flat shaped circular border chased with flowers, Edinburgh Edinburgh form, circular squat of body plain feet, paw and foliate 3 on bowl, Sugar Edinburgh Sugar bowl, plain, George II, onmolded foot, f Edinburgh Sugar bowl, everted, chased, combined witha 3 piece set, crest and motto of Assayer Hugh Gordon Assayer Hugh Gordon Assayer Hugh Gordon (or William Davie) Davie) William (or 1746/47 William Aytoun Aytoun 1746/47 William 1745/46 Ker James 1745/46 1746/47 Ker James Edinburgh Lothian Edward no bowl, Sugar Edinburgh Edinburgh hand a crest, a with rim, engraved no details , wavy boat everted cream a chased, with circular, Sugar bowl, Sugar bowl, Collection Swan Maple The 1746/47 James Ker 1746/47 James 1746/47 Edward Lothian Lothian 1746/47 Edward 1745 ca 1745 ca Glen James Glasgow Dennistoun, of Arms feet, rim molded large on chased everted, Sugar bowl, 1746 ca 1746 ca Lothian Edward 1744/45 Oliphant Ebenezer Edinburgh bu plain, bowl, Sugar YEAR MAKER DESCRIPTION 1743/44 LOCATION Welsh John Edinburgh details no bowl, Sugar SOURCE Scotland of Museums National 1743/44 II Dickson Charles Edinburgh pedestal on circular, bowl, Sugar 39 Compendium of Scottish Silver 0 SDE ecember 18, PPRQV/RQGRQ &KULVWLHV6RXWK.HQVLQJWRQ #337 1993 8, December &KULVWLHV/RQGRQ-XO\ #744575 #175 Negative #650 VT Stock J Bourdon-Smith London &KULVWLHV-XO\ &KULVWLHV-XQH Sothebys Hopetoun House, April House, Hopetoun Sothebys #69 1987 29, -%RXUGRQ6PLWK&DWDORJ6SULQJ 1987 #19 auction London Sothebys Antiques Magazine Magazine Antiques 2004 #286 2004 #286 4XHHQ¶V&ROOHFWLRQSO #433 LR]G ODWHUFKDVHG -DFN6L SHGHVWDOIRRWERG\ GRQSDZIHHW´GL 7LFKHU,ULVK6LOYHU%RRN ULP´GLR] ´GL band of flowers, wave ornament and scrolls, IM figure between mark not not mark between figure IM scrolls, and ornament wave flowers, of band DWWULEXWHGLQDG´GLR]G FDò´GLR]G DQGIROLDJHRQFODZIHHWXQGHUVLGHZLWKLQLWLDOV³5P0´´G Edinburgh Edinburgh Sugar bowl, plain circular,3 scroll on and paw feet, shapedrim chased with Edinburgh Sugar bowl, plain circular, onmolded foot, shapedrim, wrong date, should be Edinburgh scrolls with engraved lip, wavy everted body, circular shallow bowl, Sugar Edinburgh Edinburgh 10d 21oz di, ½" 5 flowers, with chased rim, flat, wavy Sugar bowl, D London Sothebys Assayer Hugh Gordon Aytoun William Assayer Archibald Ure Assayer Hugh Gordon $VVD\HU±+XJK Gordon 1748/49 James Mitchell Mitchell 1748/49 James 1748/49 *1730 Lowe 1748/49 Robert &KDUOHV'LFNVRQ,, (GLQEXUJK ,&RU,( 6XJDUERZOHYHUWHGFKDVH (GLQEXUJK 6XJDUERZOHYHUWHGULPFKDVHGRQ 1748/49 James Mitchell Mitchell 1748/49 James 1749/50 Gordon Hugh Edinburgh shaped feet, paw stylized knurled on circular, molded, tapering, bowl, Sugar 1748/49 Mitchell James Edinburgh rim, chased and everted attachments, trefid feet, paw on 3 Sugar bowl, YEAR MAKER DESCRIPTION 1746/47 LOCATION Ker James Edinburgh service 3 piece of part feet, paw 3 rim, on chased everted, bowl, Sugar 198 10-12, June NY Sothebys SOURCE 1746/47 1747/48 Aytoun William Low Robert Edinburgh 13d 7oz di, 5" feet, pad 3 on chased, everted, bowl, Sugar Edinburgh of Duchess Elizabeth Princess of crest pedestal, chased everted, Sugar bowl, #139 1976 28, February Sothebys 40 Sugar Bowls 85 1993 S S Nicholas Shaw Catalog Winter Winter Catalog Shaw Nicholas 2000 p71 Sale Scottish the Bonhams 7LFKHU,ULVK6LOYHU%RRN +ROODQG%RRN #68 1914 24, March Christies Collection Ashburton #4 advertisement Aberdeen of Bell 1961.1675 605 MEQ 1995 1934 Magazine Connoisseur 93 p347 vol Sothebys December 1, 1982 #88 1982 1, December Sothebys Christies Glasgow March 1983 1983 March Glasgow Christies #31 #116 1952 22, October Christies #96 1953 11, March Christies The Phoenix Collection Collection Phoenix The G 0DU\&RRNH&ROOHFWLRQ/RQGRQ foot, 5¼" di,8oz J Bourdon-Smith London VLPSOHULPIRRWPDUNV±WKLVWOH,0 of a set, no details details no a set, of Scotland of Museums National 0F.HQ]LHIDPLO\SURYHQDQFHó´KWR] inverted pear shaped body, stepped domed foot, 9oz 8d 8d 9oz foot, domed stepped body, shaped pear inverted NH\±ò´GLR]G front, chased onref. with lid,½" 4 di, 11oz (GLQEXUJK 6XJDUERZOLQYHUWHGSHDUVKDSHGHYHUWHGULPFKDVH 1757/58 1758/70 Welsh James Dempster William 1759/60 Edinburgh Edinburgh dates varying of service 9d 9oz a tea di, Robertson ¾" & of 4 part Lothian chased, everted, bowl, Sugar bowl, Sugar 1760/61 Edinburgh 1760 ca Mc J part bowl, Sugar 1761/62 Coline Allan Robertson & Lothian Aberdeen 1761/62 Edinburgh IV, 1953 vol Review Art Scottish feet paw 3 on gadrooning, with rim waved everted, slightly Sugar bowl, 12d 7oz di, 5 ¾" body, shaped pear inverted, rim everted, Robertson Sugar bowl, #161 & 1975 Lothian June 26, Sothebys Edinburgh #2 1987 August NY Sothebys #33 initials, 1968 with 25, June engraved Christies rim, notched everted shape, pear inverted bowl, Sugar 1753/54 Robertson & Lothian Edinburgh above, crown crest tree foot, pedestal rim, chased everted Sugar bowl, 1750 ca 1750 ca FD Coline Allan ,0 Aberdeen 19d 5oz 4" di, feet, 3 on plain, bowl, Sugar 3HWHUKHDG 6XJDUERZOFLUFXODUZLWKLQLWLDOV³-6+´ 1982 p16 Review Silver Lyle YEAR MAKER DESCRIPTION 1750/51 LOCATION Mitchell James Edinburgh pedestal chased, rim, everted bowl, Sugar SOURCE 1750 ca 1750 ca Coline Allan Aberdeen on "TM" initials mm only, above heads lions feet, paw on 3 Sugar bowl, 41 Compendium of Scottish Silver 1988 1988 ecember 19, Goodwin's Antiques November 1995 Collection Phoenix The p11 53 1951 vol Apollo advertisement Bell Christies D Christies #215 Christies January 31, 1945 #60 #60 31, 1945 January Christies Apollo April 1973 vol 97 p2 vol 1973 April Apollo advertisement Bell MEQ 1962.1026 1993 USA NY Robinson J Antiques Magazine Magazine Antiques advertisement Bell Nicholas Shaw Catalog Winter Winter Catalog Shaw Nicholas 2001 p72 MEQ 715 August 21, 2003 #22 2003 21, August OLSHQJUDYHGLQVFULSWLRQ³$SUHVHQWIURP0LVV inverted, pear shaped, chased, di4 ½" chased, pear shaped, inverted, details no #366 1991 NY Sothebys October Scotland of Museums National , , rim, chased body, on araised foot top with leaves, pineapple finial, 6" ht 6" finial, pineapple leaves, with top $UQRWV«´ Earls of Mansfield, 5 1/3" di di 1/3" 5 Mansfield, of Earls "F" below crown,¾" 4 di KDQGOHV´RYHUKDQGOHVR] band of chased flowers on body, 4 5/8" di, 7.8oz Edinburgh Edinburgh Murray of crest body, shaped pear inverted chased, everted, oval, Sugar bowl, letter) letter) (continued) (continued) 1767/68 Dempster Ker & 1767/68 Edinburgh date struck TA (over chased everted body, shaped pear inverted circular a set, of part Sugar bowl, $OH[DQGHU*DLUGQHU (GLQEXUJK 6XJDUERZOSODLQPROGHG 1765/66 1765 ca Dempster Ker & ca 1765 Graham Adam Edinburgh ca 1765 Adam Graham a set of part a pedestal, on Sugar bowl, Glasgow Adam Graham 1766/67 Glasgow 15d 6oz di, ¼" 4 foot, molded shaped, pear inverted, bowl, Sugar Robertson Patrick Glasgow 1767 ca bowl Sugar Edinburgh bowl Sugar Campbell & Milne #105 1965 2, March Christies everted rim, slightly on cup small bowl, Sugar Glasgow shaped body, band chased shape, pear inverted sugar, covered Sugar bowl, 69 vol 1956 Magazine Antiques USA NY Trace J 1764/65 Welsh James Edinburgh script initial foot, low a simple on missing, cover shape, plain Sugar bowl, 1761/62 Dempster William 1762/63 Edinburgh Robertson Patrick "M" script flowers, chased with bowl, Sugar Edinburgh tall capped rim, everted body, shaped pear inverted handled, 2 bowl, Sugar Scotland of Museums National YEAR MAKER DESCRIPTION LOCATION SOURCE 1761/62 Dempster William Edinburgh rim, plain notched everted foot, circular a on shape pear inverted bowl, Sugar 42 Sugar Bowls 151 Book p Gorriges Auction Lewes #1920 2006 16, March England, advertisement Bell p6 133 vol advertisement Bell 1057 MEQ Connoisseur Magazine 1941-42 1941-42 Magazine Connoisseur p136 108 vol MEQ 901 Nicholas Shaw Catalog Winter Winter Catalog Shaw Nicholas 2000 p71 1978 #432 1978 #432 1982 p16 Review Silver Lyle YROS $VSUH\/RQGRQDGYHUWLVHPHQW foot, chased fruit and flowers, OGHGULP´GLR] &RQQRLVVHXU0DJD]LQH chased decoration decoration chased Scotland of Museums National slightly everted rim, broad band of chasing with foliage decoration around the the around decoration foliage with chasing of band broad rim, everted slightly XSSHUERG\ô´GLR] initials "EJF" on side, 4 ½" di, 7.9oz Edinburgh Edinburgh "AIR" initials script engraved bowl, Sugar Scotland of Museums National William Dempster or or Dempster William Davie William 1767/68 1767 ca Robertson Patrick Edinburgh available Not 1768/69 chased bowl, Sugar 1770 ca Robertson John Edinburgh Campbell & Milne a set of part Sugar bowl, Edinburgh 1770 ca Glasgow no details Sugar bowl, Campbell & Milne set matched shape, pear inverted chased, everted, 1770/71 bowl, Sugar Glasgow 1771/72 Graham Adam covered, bowl, Sugar Welsh James Glasgow 1954 Magazine Connoisseur Edinburgh "AGAP" initials lip, engraved turned out slightly plain, circular, Sugar bowl, Private Collection Grant Castle Sugar bowl, 1993 London Bourdon-Smith J 60 vol 1951 Magazine Antiques Collection Swan Maple The Cripps 1772/73 WD Script Script 1772/73 WD 1767/68 Tait Benjamin Edinburgh foot, pedestal molded stepped on body, shaped pear inverted bowl, Sugar YEAR MAKER DESCRIPTION 1767/68 LOCATION Gairdner Alexander Edinburgh 15d 12oz di, ½" 6 foot, low on bowl, plain Sugar bowl, 29, August Gleneagles Sothebys SOURCE $OH[DQGHU*DLUGQHU (GLQEXUJK1767/68 6XJDUERZOSODLQZLWKPR Tait Benjamin Edinburgh circular on shape pear inverted Sugar bowl, 43 Compendium of Scottish Silver 7 \RU-XQH JD]LQHYROS VVHXU0DJD]LQH WU\/LIH-XO\ SROOR2FWREHUYROS YROS 3URYHQDQFH+XJKHV 3ULYDWH&ROOHFWLRQ Lyon & Turnbull 7KH0XUUD\&ROOHFWLRQ $XJXVW advertisement Bell vol 143 vol 1LFKRODV6KDZ&DWDORJ:LQWHU S Bonhams the Scottish Sale Sale Scottish the Bonhams $XJXVW Bell advertisement advertisement Bell YROS KW WZHHQD DUIRRW EHDGHGHGJHDOORYHUEULJKWFXWHQJUDYLQJ IODULQJOLSVFULSW³:&´´GL &KULVWLHV1<$SULO KDQGOH )LQOD\ RQDIRRWZLWKDWDOOSHGHVWDOSDUWRIDVHW &RXQWU\/LIH0D JDGURRQHGERUGHUVGLR]G 6RWKHE\V1RYHPEHU UHDGLQJFLUFXODUIRRWHQJUDYHGFUHVWDQGPRWWR VHHGHGURVHDQGDEXFN VKHDGóGLR]G rim, engraved with an angel, a Maltese cross in her coiffe, holding a shield shield a holding coiffe, her in cross Maltese a angel, an with engraved rim, FKDUJHGZLWKDUPV$QHQJUDLOHGEHQGFKDUJHGZLWKEXFNOHVEH ULEERQVZDJVVXSSRUWLQJEODQNFDUWRXFKHVRQDVWHSSHGFLUFXO ´GL´KWR] RI7KRPVRQLQLWLDOV0:)GLR] RQRYDOGRPHGJDGURRQHGIRRWFUHVW±NQLJKWRQKRUVHEDFNô´ Edinburgh Sugar basin, deep, ontrumpet foot, light band of decorationbelow reeded DLODEOH (GLQEXUJK 6XJDUERZOSDUWRIDVHW &RXQ 1RW$Y -DPHV0F(ZDQ *ODVJRZ 3DWULFN5REHUWVRQ 6XJDUERZOQRGHWDLOV $QWLTXHV0D 1RWDYDLODEOH (GLQEXUJK 6XJDUERZOKHPLVSKHULFDOERG\ :LOOLDP'DYLH (GLQEXUJK 6XJDUERZOERZOLVJREOHWOLNH :LOOLDP'DYLHFD (GLQEXUJK 0LOQH &DPSEHOO 6XJDUERZOVPDOOFKDVHGEDQG *ODVJRZ 6XJDUERZOFKDVHGZLWKOLG $ -DPHV+HZLWW (GLQEXUJK 6XJDUERZOFRYHUHGRYDO &RQQRL FD -RKQ5REHUWVRQ -DPHV*LOOLODQG &DQRQJDWH (GLQEXUJK 6XJDUERZOFKDVHGZLWKVZLQJ 6XJDUERZOYDVHVKDSHGRQVS :LOOLDP'DYLH (GLQEXUJK 6XJDUERZORYDOHYHUWHGULP YEAR MAKER DESCRIPTION 1773/74 LOCATION 1773/74 Welsh James Davie William Edinburgh Edinburgh rim chased everted oval, bowl, Sugar inside, the on gadrooning applied lip, everted slightly oval, plain, bowl, Sugar SOURCE 1995 London Bourdon-Smith J 44 Sugar Bowls Christies July 12, 1989 12, 1989 July Christies MEQ 877 p11 130 vol advertisement Asprey MEQ 674 93 p347 vol 13, 1964 February Life Country p31 135 vol 1940.383 136 MEQ advertisement Shreve 93 p347 vol ece set details details Scotland of Museums National part of a set a set of part Scotland of Museums National 1800 ca 1800 ca 1800 ca Keith John Heron J Banff Greenock handle swing shaped, goblet Sugar bowl, 7oz di, ¼" 5 foot, pedestal rim, on plain Sugar bowl, 1952 Magazine Connoisseur 1994 Catalog Bourdon-Smith J 1789 ca 1789 ca 1790/91 Cunningham P & W Edinburgh 1790 ca Cunningham P & W Edinburgh a set of part Sugar bowl, Jr Stewart, Alexander 1791/92 Inverness a set of part Sugar bowl, Robertson William a set of part Sugar bowl, Edinburgh 1792/93 1793/94 a set of part bowl, Sugar Swan Robert Howden Francis 1795/96 Edinburgh Edinburgh available Not 1795/96 11oz across, ½" 6 handle, swing sugar basket, oval bowl, Sugar details no bowl, Sugar 1795 ca M & G Edinburgh Keith John 1795/96 a set of part bowl, Sugar Collection Private #236 1-2, 1991 May Christies M & G 1798/99 #170 1966 2, March Christies Edinburgh Banff 1934 Magazine Connoisseur McKay James a set of part Sugar bowl, pictured not Sugar bowl, Edinburgh #98 1991 Finlay Edinburgh pi a 3 of part Sugar bowl, no bowl, Sugar Scotland of Museums National 38 p50 vol Magazine Antiques #127 12, 1989 July Christies 1934 Magazine Connoisseur YEAR MAKER DESCRIPTION 1789/90 LOCATION Robertson Patrick Edinburgh bowl, Sugar SOURCE 45 Compendium of Scottish Silver #42 Nicholas Shaw Catalog Winter Winter Catalog Shaw Nicholas p88 2002/03 Bell advertisement advertisement Bell #76 1988 26, 1989 #42 a set a set #30 1966 9, November Christies in foliate, part of of part foliate, in 4 3/8" ht, 9.1 oz oz 9.1 ht, 4 3/8" Glasgow Glasgow reeding plain handled, 2 Sugar bowl, Edinburgh 8d 18oz di, 8" Arms, with edge, beaded everted, octagonal, Sugar bowl, Edinburgh #198 1975 4, December Sothebys pictured not Sugar bowl, Edinburgh di 9" shaped, tub Sugar bowl, 1993 Inc Plus, Silver p 94 66, vol Magazine Antiques #110 1973 19, April Sothebys Assayed Edinburgh Simpson Simpson Simpson Simpson YEAR MAKER DESCRIPTION 1800/01 LOCATION 1802/03 Cunningham P & W Edinburgh 1802/03 Howden Francis a set of part bowl, Sugar Howden Francis Edinburgh a set Edinburgh of part fluted, bowl, Sugar monogram bowl, Sugar SOURCE 71 vol 1958 Magazine Antiques #23 1938 30, November Christies 1802/03 1804/05 available Not Spence Alexander 1804/05 Edinburgh Arthur & Morehead a set of part & bowl, Sugar 1807/08 Cunningham Archers of Company Royal the to given inscription a set, of part Sugar bowl, 1919 19, November Christies 1808/09 295 41 p vol Magazine Antiques 1808/09 Howden Francis McPherson & Dick Edinburgh Edinburgh a set of part Sugar bowl, engraving, cut bright feet, ball 4 on handles two with oblong Sugar bowl, 46 p120 vol Magazine Antiques 1806/07 Cunningham P & W Edinburgh & Kincraigie of Arms a set, of part Sugar bowl, 1807/08 Cunningham & 1807/08 Cunningham 1808/09 1808/09 McKay James 1808/09 McKay James Edinburgh April House Hopetoun Sothebys overstrike RK Edinburgh a set of part bowl, Sugar Perth details no bowl, Sugar a set of part Sugar bowl, p17 100, 1974 vol Apollo Collection Swan Maple The April House Hopetoun Sothebys 46 Sugar Bowls 1976 #38 1976 March 1983 1983 March Catalog Catalog MEQ 634 Christies May 11, 1938 #60 11, 1938 May Christies February Magazine Connoisseur 1939 p2 &ULFKWRQ%URWKHUVDGYHUWLVHPHQW #67 %HOODGYHUWLVHPHQW Autumn 1997 #39 p31 #39 1997 Autumn 1990 #86 advertisement Shreve Nicholas Shaw Catalog Winter Winter Catalog Shaw Nicholas 2000 p71 1991 #246 1991 #246 1945.38 1945.38 Christies Edinburgh May 1-2, May Edinburgh Christies ece set ece set Sothebys February 26, RWWRRI)XOOHUWRQRI:HVWZRRGò´GLR] -%RXUGRQ6PLWK of a service a service of Scotland of Museums National art of art of a set 85 p 1967 vol Apollo 87 , p total (15oz 6d ea) ea) 6d (15oz total Fides" and initial "F",½" 5 di, 11.5oz Edinburgh Edinburgh details no bowl, Sugar Scotland of Museums National Simpson Simpson 1817/18 McKay James Edinburgh part bowl, Sugar 1814/15 McKay James 1815/16 Fenwick George Edinburgh shape oblong body, fluted feet, ball on handled, Edinburgh 2 a set, of part bowl, Sugar 19 1934 vol Apollo 12d 30oz di, 7" pair, Sugar bowl, 1811/12 McKay James 1812/13 McKay James Edinburgh 1813/14 a set of part Sugar bowl, Fenwick George Edinburgh Edinburgh a set of part bowl, Sugar 10oz ¼" di, 5 Gordon, of motto and crest foot, rim a on plain, Sugar bowl, Glasgow Christies May House Hopetoun Sothebys 115 #328 vol Magazine Antiques 1809/10 James McKay Edinburgh Sugar bowl McKay Sugar Edinburgh 1809/10 James 1810/11 Fenwick George Edinburgh 3 pi a of part Hay, of crest "H", shape, initial bombe Sugar bowl, 1811/12 Fenwick George )UDQFLV+RZGHQ Edinburgh (GLQEXUJK a set of part Sugar bowl, 6XJDUERZOSODLQFUHVWDQGP 615 1983 p Annual Review Lyle 1809/10 McKay James Edinburgh Deo "In motto, and rim, crest around band chased with circular bowl, Sugar 1808/09 Cunningham & & YEAR MAKER DESCRIPTION 1808/09 Cunningham LOCATION SOURCE 1809/10 Fenwick George Edinburgh a 3 pi of part "H", initial Sugar bowl, 47 Compendium of Scottish Silver Christies NY June 28, 1989 28, June NY Christies MEQ 1312 1312 MEQ p106 1987 #305 Shreve advertisement advertisement Shreve Sothebys p24 130 vol 1988 #77 advertisement Bell 1991 #304 1988 #81 1988 #81 ece set rt of a set a set of rt Scotland of Museums National Greenock Greenock di 8" oval, Sugar bowl, 1983 p542 Annual Review Lyle Edinburgh Edinburgh a set of part bowl, Sugar "AE" File Picture Sothebys Edinburgh Sugar bowl, part of a set Sothebys Hopetoun House April Assay Edinburgh Edmonstoun Edmonstoun Edmonstoun 1823/24 McKay James 1824/25 McKay James Edinburgh 1825/26 a set of part Sugar bowl, Beech George Edinburgh a set of part bowl, Sugar Edinburgh pi a 3 of part Sugar bowl, 87 vol 1968 April-June Apollo August Gleneagles Sothebys YEAR MAKER DESCRIPTION 1819 ca LOCATION McDonald John Edinburgh a set of part Sugar bowl, SOURCE 76 vol 1959 Magazine Antiques 1818/19 John Heron Heron 1818/19 John 1818/19 1820/21 Alexander McKay James Edinburgh a set of part 1820 ca bowl, Sugar 1820 ca Livingston Edward Dundee McKay James a set of part bowl, Sugar Edinburgh pa bowl, Sugar 1825/26 McKay James 1825 ca available Not Edinburgh 1825 ca p29 90 vol Gleneagles Sothebys a set of part Sugar bowl, Murray Charles 1826/27 Alexander Edinburgh Perth a set of part Sugar bowl, #111 1991 Finlay creamer with bowl Sugar bowl, April House Hopetoun Sothebys p2 86 vol 1967 August Apollo 1-2, May Edinburgh Christies 1820/21 available Not a set of part Sugar bowl, 1952 Magazine Connoisseur 48 Sugar Bowls ed, th ugust 28, 1969 #86 1969 ugust 28, GRQ6PLWK&DWDORJ Christies April 23, 1983 #92 1983 23, April Christies Bonham's Sale 10914 #7 10914 Sale Bonham's p585 1988 #83 1988 #83 1977 #29 1977 #29 1988 #483 MEQ 541 1990 #101 Nicholas Shaw Catalog 2005 2005 Catalog Shaw Nicholas p105 86 p 2002/03 Autumn 1991, #34 p47 #34 1991, Autumn XWHGIRRWòGLR] 1LFKRODV6KDZ&DWDORJ:LQWHU ece coffee set ece set Sothebys A ece set Sothebys Gleneagles August ece set Sothebys Gleneagles August 27, ô´GLR] ULPòGLR] Edinburgh Sugar bowl, circular, everted wavy rim, on pedestal foot, engraved body and (GLQEXUJK 6XJDUERZO*HRUJH,,,VW\OHôGLR] -%RXU Marshall Marshall Marshall Marshall 1835/36 Urquhart Lawrence Edinburgh pictured not Sugar bowl, 27 Guide Price Warman 1835/36 Co Elder & Edinburgh pi a 4 of part Sugar bowl, 1838/39 1838/39 McKay James mm striking over AM Edinburgh Edinburgh pi a 3 of part Sugar bowl, chased larger, slightly one pair, Sugar bowl, 1994 London Bourdon-Smith J YEAR MAKER DESCRIPTION 1829/30 LOCATION McKay James Edinburgh a set of part bowl, Sugar SOURCE April House Hopetoun Sothebys 1832/33 Co Elder & Edinburgh pi a 3 of part bowl, Sugar 1832 ca 1832 ca Marshall William 1833/34 Edinburgh Sons & Marshall 1834/35 a set of part bowl, Sugar Edinburgh Co Elder & 1834/35 details no bowl, Sugar McKay James Edinburgh Edinburgh pi a 3 of part Sugar bowl, handles, scroll rim, 2 wavy everted form, circular IV, William bowl, Sugar August Gleneagles Sothebys Scotland of Museums National 1842/43 1842/43 Chisolm & Kay Mc Edinburgh William & James a set of part bowl, Sugar 1993 Annual Review Lyle -DPHV0F.D\1844/45 1847/48 McKay James (GLQEXUJK William & James 6XJDUERZOVKHOOIRUPRQZDY\IO Edinburgh a set of part Sugar bowl, 1993 Annual Review Lyle 49 Compendium of Scottish Silver 0XVHXPVRI6FRWODQG MEQ 855 MEQ 904 1968.466 1968.466 904 MEQ p89 2002/3 1977.240 1977.240 Payne & Son Ltd, Oxford 2005 2005 Oxford Ltd, Son & Payne 4/70 Ref MEQ 139 National Museums of Scotland Scotland of Museums National MEQ 955 Nicholas Shaw Catalog Winter Winter Catalog Shaw Nicholas 2001 p78 2003 Lot #9 2003 Lot &$0´GL "B" "B" Kinnear, 5 7/8" di, 10.4 oz oz 10.4 di, 7/8" 5 Kinnear, 6XJDUERZOò´GL 1DWLRQDO Edinburgh Edinburgh thistles and leaves with chased bowl, Trophy Golf bowl, Sugar Scotland of Museums National Hamilton & Inches Inches & Hamilton Edinburgh details no bowl, Sugar Scotland of Museums National & Co Co & 1899/1900 1899/1900 1900/01 Or 1875/76 McKay, Cunningham Cunningham 1875/76 McKay, 1886/87 Marshall William Edinburgh 1912/13 details no bowl, standing bowl, Sugar Weir J 0DOFROP$SSOHE\ (GLQEXUJK Glasgow oz 6.5 ¾" di, 4 hammered, hand Sugar bowl, Scotland of Museums National Winter Catalog Shaw Nicholas 1875/76 Co & Marshall W Edinburgh monogrammed decoration, bead engraved, a pedestal, on bowl, Sugar 1862/63 Crichton Edinburgh script engraved handles, on figures winged decorated, heavily Sugar bowl, YEAR MAKER DESCRIPTION 1847/48 LOCATION 1859/60 Marshall W J & Vernon E J Edinburgh circular bowl, Sugar Edinburgh 11oz di, 7" chased, handled, 2 bowl, Sugar SOURCE June Auction, Sons & Fellow 1993 Catalog Bourdon-Smith J 1860/61 Son & Marshall Edinburgh for Alit" Fortuna "Spem motto, and crest chased, heavily bowl, Sugar 50 Boxes BoxesBOXES Plate 8. A presentation Snuff Box 1798 by Alexander Gairdner, Edinburgh. Courtesy of The Phoenix Collection. Photograph by Janice M Dietert 51 Compendium of Scottish Silver K Clayton Dictionary p340 #505 p340 Dictionary Clayton National Museums of Scotland Scotland of Museums National 1983 1556 MEQ 1961 V4 AB AB 1961 V4 MEQ 1036 1036 MEQ 1983 March Glasgow Christies #103 Collection Shaw Scotland of Museums National 1963 1566 MEQ Christies Glasgow March 1983 1983 March Glasgow Christies #32 #213 1970 22, October Sothebys 1993 LH 419.1 LH UPRQRJUDP QGLQLWLDOVEORFN³,5´ )LQOD\ 3´ 6KDZ&ROOHFWLRQ \SKHUIRUWKH(DUORI+RSHWRXQô´ORQJR] +RZRI(GLQEXUJ ece coffee service, slightly unequal octagonal shape, iversity iversity Scotland of Museums National Scotland of Museums National marshaled for use in Scotland Scotland in use for marshaled of bombe form on spreading stepped and molded base, with molded molded with base, molded and stepped spreading on form bombe of KRUL]RQWDOEDQGVEHQHDWKWKHULPHQJUDYHGZLWKDVOLJKWO\ODWH ³65´VWHSSHGGRPHGFRYHUZLWKRFWDJRQDOILQLDOô´KWR] BOXES FD 5REHUW%URFN *ODVJRZ 7REDFFRER[HQJUDYHGZLWK$UPVD 1695/96 Ker Thomas Edinburgh case Seal FD1700/01 :LOOLDP&OHUN Luke John *ODVJRZ 3DWFKER[ Glasgow Un Glasgow box, Seal )LQOD\ FD 7KRPDV.HU (GLQEXUJKFD 7RLOHWFDVNHWRQEDOOIHHWF *HRUJH&RRSHU $EHUGHHQ 6QXIIPXOOPPRQO\LQLWLDOV³$ 1718/19 Aytoun William Edinburgh 1730 ca pi a 3 of part box, Sugar Cooper George Aberdeen shaped vase only, mm mull, snuff Silver Edinburgh Antiques Goodwin 1604 ca 1604 ca Cunningham George Canongate Montrose of Earl the of arms Box, Montrose The case, Seal Scotland of Museums National 1640 ca 1640 ca Kirkwood Thomas Edinburgh Britain Great of Arms the with engraved lid TK, only mm box, Seal YEAR MAKER DESCRIPTION LOCATION SOURCE 52 Boxes p 93 &KULVWLHV0DUFK Scotland of Museums National 0(4 NQ 406 1963 406 NQ 6RWKHE\V0D\ 43 1991 # &OD\WRQ'LFWLRQDU\S &KULVWLHV-XO\ p 97 NQ 454 NQ :RROOH\ :DOOLV$SULO &OD\WRQ¶V'LFWLRQDU\S 6RWKHE\V0DUFK Scotland of Museums National F (GLQEXUJK GHR] P-/EHWZHHQIOHXUGHO\V ODUJHUHOLHIòORQJR] 1LFKRODV6KDZ&DWDORJ OOLDP$\WRXQWHDFDGGLHVVTXDUHZLWK :'ZLGHR] 1LFKRODV6KDZ&DWDORJ HGJLUGOHOLGLQLWLDOHG³-0´ 6RWKHE\ V*OHQHDJOHV$XJXVW H$UPVRI6LPRQ/RUG/RYDWDQG&DVWOH'RZQH SHDUVKDSHFKDVHG 1DWLRQDO0XVHXPVRI6FRWODQG aped, engraved Arms Arms engraved aped, Scotland of Museums National straight sides and molded borders, with slightly raised stepped cover cover stepped raised slightly with borders, molded and sides straight LQQHUOLGSODWHGFD KW LQVLGHLVWKHRULJLQDO%XUJHVVWLFNHWGDWHG-XQH´ZL Edinburgh, corners engraved shell like motif and scrolling acanthus foliage, foliage, acanthus scrolling and motif like shell engraved corners Edinburgh, thread border with alternating beadsand ovolos, base plain,presented to-RKQ%DUQDUGRQWKHRFFDVLRQRIKLVEHLQJJLYHQWKHIUHHGRPRI Sir LQLWLDOVSUREDEO\³-6/&´³GLR] Edinburgh Edinburgh of city of arms with panel, oval raised central with lid Box, Ticket Burgess Edinburgh Edinburgh script later interiors, gilt form, circular plain of only, mm pair, boxes, Toilet Charles Duncan Duncan Charles FD &UDZ +LOO &DQRQJDWH 6QXIIER[FLUFXODUHQJUDYHG- -RKQ&ODUN (GLQEXUJK 6XJDUER[WRDFFRPSDQ\HDUOLHU:L FD 5$FDFD 51 'DYLG:DUQRFN *ODVJRZ ,QYHUQHVV 6QXIIPXOOEDOXVWHUIRUPDSSOL &RZULHER[ 6QXIIPXOO /XGGLQJWRQS 6RWKHE\V*OHQHDJOHV$XJXVW FD -DPHV*LOOLODQG (GLQEXUJK 6QXIIPXOOREORQJLQYHUWHG -/ *ODVJRZ 9LQDLJUHWWHER[FKDVHGERUGHUVò´ZLGHP FD -DPHV0LWFKHOVRQ (GLQEXUJK 6QXIIPXOOHQJUDYHGZLWKWK 1735 ca 1735 ca or I Dickson Charles -RKQ5ROOR FD 1RWDYDLODEOH 7DLQ &DSVWDQIRUPVQXIIPXOOFKDVHGZLWK YEAR MAKER DESCRIPTION 1730 ca LOCATION Cooper George Aberdeen sh vase mull, Snuff SOURCE 53 Compendium of Scottish Silver Sothebys Gleneagles August 29, 29, August Gleneagles Sothebys 1973 #163 Shrubsole Private Collection Collection Private 221 NQ 1990.10 H 2000 p80 H.1994 1096 H.1994 NQ 436 NQ 1993.568 H 29, August Gleneagles Sothebys 1978 #358 420 NQ ODQWKHLU ´ZLGH LQVFULEHG ULEHGZLWKWKHPRQRJUDP³/0F/´ Freedom Box Box Freedom Scotland of Museums National HQJUDYHGZLWKDGUDSHU\FDUWRXFKHHQFORVLQJLQLWLDOV³$0´DQG ³7R0UV'HUE\VKLUH´IXUWKHULQVFULEHG³*$5'(&(&,32859275( $0,(´SRVVLEO\DJLIWIURP5REHUW%XUQVWR0LVV$QQ0DVWHUVRQ EDVHLQVFULEHG³)URPWKH,QYHUDU\/RGJHWRWKH5HYG0U0DF/DK FKDSODLQ´ PRWLIVò´ORQJ Edinburgh Edinburgh details no box, Snuff Scotland of Museums National Edinburgh Snuff box, cowrie shell, silvermounts and hinged lid, borders with bright cut & Son William Dempster Dempster William 1795/96 Robertson William Edinburgh gold box, Snuff 697 p 1996 Magazine Antiques 1793/94 Alexander Gairdner Edinburgh Dumphries Dumphries Edinburgh 1790/91 Gairdner Christie George 1793/94 Alexander Edinburgh 1795 ca details no box, Snuff Robertson William 1795 ca Edinburgh Robertson William long ¾" 3 set, agate moss with shell cowrie mull, Snuff Edinburgh cut bright lid, hinged flush corners, champhered with rectangular, box, Snuff Winter Catalog Shaw Nicholas Scotland of Museums National YEAR MAKER DESCRIPTION 1770 ca LOCATION Hewitt James Edinburgh House Trinity for box Freedom SOURCE Scotland of Museums National 1774/75 Alexander Aitchison Aitchison 1774/75 Alexander 1780 ca 1780 ca Robertson Patrick 1780 ca Edinburgh ca 1780/81 available Not available Not circular gold, box, Snuff 1784/85 or Davie William 1785/86 Edinburgh Bowman Robert box Cowrie FD Edinburgh Crieff" Taitt "Adam cartouche, rococo in Arms section, ovoid box, Snuff -: details no oval, pointed, box, Snuff #77 1962 28, March Christies *ODVJRZ 6QXIIER[VWDQGLQJRYDOVHFWLRQOLGLQVF Scotland of Museums National Scotland of Museums National p87 Luddington 54 Boxes s of Scotlands ational Museums of Scotland Scotland of Museums ational Asprey Small Collectible Catalog Catalog Collectible Small Asprey cover back #191 1990 p58 1984 1583 MEQ Private Collection Collection Private 2000 p88 2001 p76 2001 p76 p 26 #34, 1991, Autumn J Bourdon-Smith Catalog 1991 1991 Catalog Bourdon-Smith J #34 p 26 MEQ 569 88 2000 p Hobart House, CT USA 1991 USA CT House, Hobart Collection Phoenix The « 1LFKRODV6KDZ&DWDORJ:LQWHU ece of Prince Charlie's Tartan N t of a Minute of the Incorporation of Goldsmiths Goldsmiths of Incorporation the of a Minute of t Museum National rose motif motif rose engraved with borders Royal the In of decoration, Capt. Esq., lid Clements border "John of delicate engraved is flowers which and within foliage date mm, with marked fully 1802", Janry 12 Leith, House, Trinity from Navy lid the inside thistle and castle mm, and base, on mark duty letter, the people of Renfrew to Mr. John Blackwood 1798", a script "B" in an oval oval an in "B" a script 1798", Blackwood Mr. John to Renfrew of people the cartouche on the front,2 3/8" long DP5LWFKLH 3HUWK &RZULHER[ZLWKWKHLQLWLDOV³-+ 1811/12 Howden Francis Edinburgh extrac an to affixed box, Seal 1813/14 McKay James Edinburgh lidded double Box, Collection Swan Maple The 1810 ca 1810 ca DS 1810 ca Law William Dundee and thistle a with engraved grille corners, rounded with oblong Vinaigrette, tolie agate inlaid with Vinaigrette Winter Catalog Shaw Nicholas 1800 ca 1800 ca Ritchie William 1801/02 Perth Cunningham P & W Edinburgh and lid base sides, without, and within gilded box, rectangular Silver-gilt "WM" initials and plough with mull Cowrie Catalog, Bourdon-Smith J 1800 ca 1800 ca C J Aberdeen pi with inscribed box patch Silver 1800 ca 1800 ca Pirie J FD -5 Aberdeen "WD" mull engraved snuff shell Cowrie &RZULHVKHOOVQXIIPXOOLQVFULEHG5REHUW+D\ Winter Catalog Nicholas Shaw 1800 ca 1800 ca 1800 ca available Not Willi Edinburgh box Presentation 81 p Guide, Price Waldron YEAR MAKER DESCRIPTION 1796/97 LOCATION 1798 ca Auld William Gairdner Alexander Edinburgh Edinburgh from gift "A presentation the with gold box, engraved and cut Presentation bright oval, box, Snuff SOURCE 49 p 95 1972 vol May Apollo 55 Compendium of Scottish Silver inter Private Collection Collection Private J Bourdon-Smith Catalog Catalog Bourdon-Smith J #34 p26 1991 Autumn p 26 1994 Bonham's Sale 10914, #27 10914, Sale Bonham's Private Collection Collection Private Private Collection Collection Private MEQ 1187 1187 MEQ 1993 #179 1993 #179 Scotland of Museums National H.1994.1096 1965.2017 457 NQ 2000 p 80 2000 p ented to David Paton Paton David to ented Scotland of Museums National details details Scotland of Museums National andlid, lid with decorated thumb-piece of andtoken a engraved As with crest Stocks and David. Mr. to Walker Wm. to "Presented inscription LQLWLDOV´ORQJ PRWWRô´ORQJR] short chain with a ring, mm only original irongrater, ring at other end, mm only Edinburgh Freedom box for Trinity House Sothebys London November 11, Haxton Haxton 1822/23 T M 1823/24 E A 1824/25 I Haxton Richard Perth Edinburgh Edinburgh base chamfered sides, concave interior, gilt silver, oblong, box, snuff Table silver box, Snuff assayed silver, box, Snuff VA, Alexandria Fox, Scarlet #34, Catalog Bourdon-Smith J 1822 ca 1822 ca TM Perth and crest with Merchant, Christie Peter for made rectangular, box, Snuff 1820/21 Fenwick George Edinburgh and crest a with engraved lid form, rectangular plain III, George box, Snuff 1820 ca 1820 ca Haxton Richard Edinburgh agate, carnelian red with set lid corners, rounded with oblong Vinaigrette, 1820 ca 1820 ca Haxton Richard Edinburgh with fitted interior agate, carnelian red with set lid oval, grater, Nutmeg YEAR MAKER DESCRIPTION 1813/14 LOCATION Richard & Hay John SOURCE 1813/14 DS 1815 ca McDonald John Edinburgh Edinburgh his grandfather" from Telfu John "To engraved shell, cowrie mull, Snuff pres oblong, silver, box, Snuff W Catalog Shaw Nicholas 1820 ca 1820 ca 1820 ca R J 1820 ca Elder George Booth George Banff Perth Aberdeen pearl of mother mounted box, Snuff no box, Seal snuff to ode inscribed with engraved shell, cowrie 3x, mm box, Snuff 1993 NY Shrubsole, 1993 NY Shrubsole, 56 Boxes I6FRWODQG #22381 1976.631 1976.631 Private Collection Collection Private Collection Private Sotheby's Edinburgh April 29, 1992 MEQ 453 Catalog Bourdon-Smith J #34 26 p 1991 Autumn 437 NQ #34 Private Collection Collection Private MEQ 1526 1982 1982 1526 MEQ QJWRQ«óORQJ 1LFKRODV6KDZ&DWDORJS 6-3KLOOLSV/RQGRQ silver, no details details no silver, Scotland of Museums National ò´ORQJ 1DWLRQDO0XVHXPVR scrolland flower thumb-piece, engraved with initials "AP", 1/8" 3 wide, oz 3 ground, center lid of and base each witha lid cartouche, of lid with crest interior a of stag'sinitials, scratched small interior, gilt vacant, latter head, VFUDWFKHGóGLR]G buildings, cover applied at later date with rose diamond set, initials "DH", "DH", initials set, diamond rose with date later at applied cover buildings, interior of lid for inscribed Respect and "Presented Gratitude of mark toa Robert as Club Steuart Lothian Esqr.East the Of Alderston, of members the by 18d 4oz 3/8", 2 X 3 3/8" 1826," Secretary, their as his service my Brother in Law the late Mr James Marr," fully marked in the lid, mm ex's ex's mm lid, the in marked fully Marr," James Mr late the Law in Brother my bottom the inside Edinburgh Edinburgh matted on foliage and scrolls of decoration all-over circular, box, Snuff 3HUWK 6QXIIPXOOFRZULHVKHOOHQJUDYHG7R5REHUW)LIH%ODLUL (continued) (continued) of Family the of interest the to Trustees the of one as attention his for Respect $*: (GLQEXUJK 6QXIIER[JROGSUHVHQWHGWR:LOOLDP+D\ 1834/35 James Nasmyth Nasmyth 1834/35 James &+) (GLQEXUJK 9LQDLJUHWWH 1828 ca 1828 ca Austin John 1836/37 Naysmith James 1828/29 Edinburgh Argo John 1832/33 no details rectangular, box, Snuff Nasmyth James Banff Edinburgh with lid interior, gilt sides, concave turned, engine oblong, plain, box, Snuff shell cowrie box, Snuff Scotland of Museums National p26 Catalog Bourdon-Smith J 1825 ca 1825 ca Naysmith James Edinburgh plain, box, Snuff 1825/26 McKay James Edinburgh classical various with chased side, bombe rectangular, gold, 18ct box, Snuff 1824/25 IG Edinburgh rectangular gold, box, Snuff Scotland of Museums National YEAR MAKER DESCRIPTION LOCATION SOURCE 57 Compendium of Scottish Silver er W Nicholas Shaw Catalog Winter Winter Catalog Shaw Nicholas 2001 p78 p 206 Nicholas Shaw Catalog Winter Winter Catalog Shaw Nicholas 2001 p78 81 2000 p Asprey Small Collectibles Collectibles Small Asprey #6 p3 1990 Catalog 0(4 1328 MEQ Bonham's Sale 10914, #30 10914, Sale Bonham's Private Collection Collection Private Autumn 1991 p26 #34 p26 1991 Autumn #362 ece, RQW 1DWLRQDO0XVHXPVRI6FRWODQG QDW\QH6WHZDUGORQJR] 1LFKRODV6KDZ&DWDORJ:LQ R] (VTòORQJR] John Douglas Sutherland Campbell, Marquis of Lorwe, 1968, silver gilt, gilt, silver 1968, Lorwe, of Marquis Campbell, Sutherland Douglas John ´;ò´;´ ´ORQJR] Miller from the workers of Pleasance Bank Mill, Dundee, 13 July 1839", 1839", July 13 Dundee, Mill, Bank Pleasance of workers the from Miller oz 4 2", X 3 3/8" Inverness Inverness Chisholm, Colin to presented citrine, with mounted silver snuff, horn Ram's Edinburgh Edinburgh feet ball 4 on box Decorative Scotland of Museums National Edinburgh Edinburgh long 7/8" 3 racing scene, with box Snuff Catalog Bourdon-Smith J amieson amieson Aberdeen ht, ¼" 2 crystal, rock with lid granite with panel agate, and silver Vinaigrette, MacBean Hutton Hutton Co Co 1893 ca 1893 ca Medlock 1899 ca & Ferguson Inverness Captain Grant by presented mounted, silver horn snuff, Ram's 2005 Catalog Shaw Nicholas 1870 ca 1870 ca Pears Jonathan '0 1880 ca J George (GLQEXUJK &DUGFDVHZLWKZRPDQ¶VSLFWXUHRQWKHIU ' &(GZDUGV *ODVJRZ 3UHVHQWDWLRQFDVNHWIRU1LQDQ%DQ 1868 ca 1868 ca Russell John Glasgow to presented Argylshire, of Campbelltown from rectangular, box, Freedom 1841/42 & Naysmith James 1848/49 Nasmyth James Edinburgh thumbpi floral turned, engine form, rectangular box, snuff Victorian YEAR MAKER DESCRIPTION 1834/35 LOCATION McKay James Edinburgh box Gold SOURCE 1988 October London Christie's 1837/38 Nasmyth James Edinburgh James Mr to "Presented engraved rectangular, Victorian, early box, Snuff 58 Brooches, Badges and Medals Brooches,BROACHES, Badges BADGES AND and MEDALS Medals Plate 9. A School Medal 1851/52 by Peter Aiken, Glasgow (front and back) Courtesy of The Phoenix Collection. Photograph by Janice M Dietert. 59 Compendium of Scottish Silver Private Collection Private Collection Private Collection Private Collection NGA 292 NGA NGA 61 NGA Royal College of Surgeons Edinburgh L1998.11 MEQ Several extant in the National extant in the Several Scotland of Museums Private Collection engraved on the engraved on the engraved on the relief, mm only, perhaps relief, mm smiths of Scotland National Museums ITUTED/1783" to "JAS. ITUTED/1783" ciety of Edinburgh, ciety of Edinburgh, ciety of Edinburgh, INSTITUTED/1783" to INSTITUTED/1783" n "ROYAL/SOCIETY/EDINBURGH, ation of Charles I, signed by Briot at the by Briot ation of Charles I, signed igures and motifs in high igures and motifs a Presentation inscription a Presentation inscription a Presentation inscription ch of Scotland National Museums details Jackson Marks p545 d, no detailsd, of Scotland National Museums details#369 1988 Christies NY October Badge of the Incorporation Badge of of Gold the Incorporation edal celebrating the Scottish coron Scottish edal celebrating the reverse side with reverse side reverse side with reverse side "ROYAL/SOCIETY/EDINBURGH, X 1 7/16", .5 1 oz 1/8" M.D./1783" HAMILTON, "ALEXANDER reverse side with reverse side INST "ROYAL/SOCIETY/EDINBURGH, 1 1/8" X 7/16", .5 oz M.D.'1783" GREGORY reverse with a Presentation inscriptio reverse 1 7/16", X 1/8" 1 M.D./1783" DUNCAN to "ANDw INSTITUTED/1783" .5oz the finest of all Edinburgh trade officer badges officer trade of all Edinburgh the finest Surgeons of Edinburgh, f of Edinburgh, Surgeons Edinburgh mint BROOCHES, BADGES AND MEDALS h So oval, for the Royal Fellowship medal, h So oval, for the Royal Fellowship medal, h So oval, for the Royal Fellowship medal, Edinburgh Plaid brooch, no Not available Edinburg Not available Edinburg Not available Edinburg Not available Edinburgh Fellowship oval, medal, for the Royal Society of Edinburgh, engraved on the 1783 dated 1783 dated 1783 dated 1783 dated 1760 ca Coline Allan Aberdeen Silver heart broo 1709/101725/26 John Seatoun Tait James 1727 ca1750 ca Not available Edinburgh Borthwick Thomas Inverness Armorial roun Brooch, no Brooch, 1705 ca Kincaid Alexander Edinburgh badge of Officer’s badge, oval Officer of cloak Incorporation of the the YEAR1633 ca MAKER Nicholas Briot LOCATION Edinburgh DESCRIPTION M SOURCE 60 Brooches, Badges and Medals Private Collection Collection Private Collection Private H.1947.94 H.1947.94 1968.499 1968.499 H.1958.1966 H.1958.1966 19882.290 19882.290 H.1986.62 H.1986.62 Private Collection Collection Private K.1999.1450 K.1999.1450 NC 381 NC h School h School Scotland of Museums National Scotland to David Call Call David to Scotland Scotland of Museums National ural Society of Scotland Scotland of Society ural Scotland of Museums National ritas" ritas" Scotland of Museums National McKay's Latin Academy Academy Latin McKay's Scotland of Museums National ilver prize medal of Mr. Scott's Writing School School Writing Scott's Mr. of medal prize ilver Scotland of Museums National reverse side with a Presentation inscription inscription a Presentation with side reverse "WILLm to INSTITUTED/1783" "ROYAL/SOCIETY/EDINBURGH, .5oz 1 7/16", X 1/8" 1 MUIR/1824" inscription a Presentation with side reverse "W.H. to INSTITUTED/1783" "ROYAL/SOCIETY/EDINBURGH, reverse side with a Presentation inscription inscription a Presentation with side reverse "Wm to INSTITUTED/1783" "ROYAL/SOCIETY/EDINBURGH, .5 oz 7/16", 1 X 1/8" 1 ESQ/F.R.S./1799", BLIZARD ROGERSON M.D./1783", 1 1/8" X 1 7/16", .5oz .5oz 7/16", 1 X 1 1/8" M.D./1783", ROGERSON Edinburgh Edinburgh the on engraved Edinburgh, of Society Royal the for oval, medal, Fellowship Not available available Not Not available available Not Edinburgh the on engraved Edinburgh, of Society Royal the for oval, medal, Fellowship Not available available Not Edinburgh the on engraved Edinburgh, of Society Royal the for oval, medal, Fellowship (continued) "JOHN to INSTITUTED/1783" "ROYAL/SOCIETY/EDINBURGH, 1824 dated 1824 dated 1821/22 M R ve "Vivant engraved Medal, 1824/25 McKay James Edinburgh Agricult and Highland Medal, 1818/19 A Mossman Mossman S Edinburgh 1818/19 A 1814/15 1817/18 Cunningham P & W Edinburgh M J Benjamin from Medal Englis Andrew's Mr. medal Silver 1811/12 McKay James Edinburgh of Society Highland from Medal 1799 dated 1796/97 Robertson William Edinburgh details no badge, Silver Scotland of Museums National 1790 ca 1790 ca Christie George Edinburgh Badge Lieutenant's Deputy Scotland of Museums National YEAR MAKER DESCRIPTION LOCATION SOURCE 61 Compendium of Scottish Silver Catalog Winter Catalog Shaw Catalog Winter Shaw Catalog 2001 p83 Private Collection NAB 67 2000 p87 2000 p87 92 NDG M.1981.59 MEQ 1514 Private Collection Private Collection Private Collection engraved on the with the words with the ng and mount, 2" di 2" ng and mount, bane of Scotland National Museums Skating Club/W. D. Skating Club/W. Young 1826 Nicholas holding a banner holding a by Thomas Dodsby Thomas of Scotland National Museums ciety of Edinburgh, ze, awarded to John Young in 1831, Young in John to ze, awarded verse showing Arms of Edinburgh of Arms showing verse 27 Nicholas Shaw tion "Edinburgh d Society to James Ross, 1831" d Society to James lander's, 3 ¾" di3 ¾" lander's, Winter Catalog Nicholas Shaw set in silver-gilt rim with ri silver-gilt rim set in obverse with a plough in a field, reverse with reverse field, plough in a with a obverse Scotland to Mr. John t to be worked from a broad ribbon, obverse ribbon, a broad from worked t to be a Presentation inscription ilt, presented to of Breadal the Marquess December 1830" December th above to Mr. John Young 18 Mr. John Young above to Highland Society of prize medal, circular, Macdonald Pri Macdonald circular, prize medal, st "Ocior Euro," reverse with inscrip reverse "Ocior Euro," Gillon, 29 engraved with winged and skated Mercury skated and with winged engraved reverse side with reverse side WOOD to "Wm INSTITUTED/1783" "ROYAL/SOCIETY/EDINBURGH, .5oz 1 1/8" x 7/16", ESQ/PRES.ROY.COLL.SURG./1824" inscription "Given by the Highlan by the inscription "Given obverse Depicting MacDonald arms, re arms, Depicting MacDonald obverse Academy in full relief, whole in full relief, Academy h So oval, for the Royal Fellowship medal, Marshall & SonsMarshall & Edinburgh McKayJames brooches Bar McKayJames EdinburghSC J & Medal, EdinburghNot available as Medal Aberdeen Edinburghbrooch Double heart attachmen Circular medal, McKayJames of Scotland National Museums MM obscured Edinburgh Brooch, silver g EdinburghHigh Sutherland Plaid brooch, of Scotland National Museums C & won Club Gymnastic Roslin Prize medal, William MarshallWilliam Edinburgh 1 James McKayJames Edinburghon the engraved Oval medal, YEAR(continued)Not available MAKER Edinburg 1 1/8" X 7/16", .5oz PLAYFIAR/1824" LOCATION DESCRIPTION 62 Brooches, Badges and Medals onal Museums of Scotland onal Museums The Phoenix Collection The Phoenix H.1986.82 M.1982.20 NAB 67 NGB 115 M.1982.18 NAB 49 NAB 39 NAB 129 NAB 130 M.1982.19 NAB 54 M.1959.935 St. Finian" on reverse "For Finian" St. mes of Scotland National Museums Games of Scotland National Museums ral Society of Scotlandral Nati chial School to G. H. Aiton", 2 ½ di H. Aiton", 2 ½ G. chial School to no details of Scotland National Museums prize medal Dalkeith Gymnastic Ga Gymnastic Dalkeith prize medal general Excellent Paro hHighland and Agricultu Medal, wWilliam Medal, engraved "from Stewart of inburgh Bar brooches of Scotland National Museums YEAR1838/39 MAKER McKay James Edinburg LOCATION DESCRIPTION SOURCE 1839/40 McKay James Edinburgh Silver 1839/40 Marshall William 1839/40 Ed Peter Aiken Glasgow Brooch, round, 1840 ca J L1840 ca W M1840 ca W M1840 ca W M1840 ca Edinburgh W M1840/41 Crowneddoublebroochheart Edinburgh medalPrize class Silver J M1840/41brooch Double heart Edinburgh W M1844/45 broochheart Crowned Edinburgh McG R 1851/52 enamel and brooch, silver Heart Peter Aiken Edinburgh broochheart Crowned Glasgo Dalkeith Gymnastic Silver medal National of Scotland Museums medal Curling of Scotland National Museums of Scotland National Museums of Scotland National Museums of Scotland National Museums of Scotland National Museums of Scotland National Museums 63 Compendium of Scottish Silver l Museums of Scotland l Museums onal Museums of Scotland onal Museums M1980.292 M.1976.220 M.1984.12-13 NC 1337 NGB 68 NGB 87 NGB 126 M.1982.116 Nicholas Shaw Catalog Winter Catalog Nicholas Shaw 2000 p87 M.1984.17 1981.118 M.1975.322 M.1976.222 National Museums of Scotland National Museums ers Societyers of Scotland National Museums side Farmers Club 1877" Club Farmers side of Scotland National Museums 1883 of Scotland National Museums High SchoolHigh of Scotland National Museums hool of Medicineof hool of Scotland National Museums School of Edinburgh School Nati er of Scotland National Museums ciety of Musicians 1904 Nationa "Central Banffshire Farmers Club 1887" Club Farmers "Central Banffshire of Scotland National Museums eart broocheart of Scotland. National Museums ooch, round of Scotland National Museums Auchengray Agricultural Society Presented to Gavin Black, Esq., Black, Gavin Auchengray Agricultural to Society Presented Crowned double heart brooch double Crowned 2 5/8" di hHigh of the Royal Medal nburghPip Scottish of the 2, Prize medals, inburgh Edinburgh So Medal, Edinburgh Scottish Twenty Club medal, Gold Edinburgh Royal Edinburgh of medal Gold Son CO 1887/88 Yale Robert 1895/96 Mackay & Chisolm1900 ca Aberdeen Edi M C1900 ca Prize medal M Rettie & Sons1900 ca Aberdeen M Rettie & Sons1900 ca Double h Aberdeen M Rettie & Sonsbr Silver Aberdeen brooch, large, silv Heart 1904/05Ld F R & Co Ed 1884/86 & Co A Mossman 1883/84 Edinburg & John Robertson 1874/75 Aitchison1877/78W J 1882/83 Edinburgh R S Sc Edinburgh Prize medal Aberdeen Fidoch Avon & "Spey Prize medal Glasgow Medal, YEAR1855/56 MAKER Naysmith & James LOCATION DESCRIPTION SOURCE 64 Brooches, Badges and Medals l Museums of Scotland l Museums onal Museums of Scotland onal Museums MEQ 1972.126 MEQ 2005 p104 NF 37 1960.2941 1980.289 Scotland 1931 Scotland of Scotland National Museums 3 ¼" di3 ¼" Winter Nicholas Shaw Catalog l Exhibition – 1908 Nationa Prize medal Highlands Agricultural Society of Society Agricultural Highlands Prize medal rghpendant Celtic cross Nati rgh Plaid and Citrine Brooch in Case, YEAR1908/09 MAKER JB & S LOCATION DESCRIPTIONNationa of Scottish medal Gold SOURCE 1918/19 Wilson & Sharp1931/32 Edinbu Kirkwood & Son Edinburgh 1912/13 Henry Tatton Edinbu 65 Compendium of Scottish Silver 66 Candlesticks CandlesticksCANDLESTICKS Plate 10. A pair of Tablesticks 1745/46 by James Ker, Edinburgh. Courtesy of The Phoenix Collection. Photograph by Janice M Dietert 67 Compendium of Scottish Silver p108 #5 Christies May 3, 1984 #57 3, 1984 May Christies Clayton Christies Book 1967 29, November Christies #144 p120 #30 Christies June 15, 1977 #135 1977 15, June Christies p60 #75 Dictionary Clayton Collection Linlithgow +RZ¶V1RWHVRQ$QWLTXH6LOYHU I p22 1941 vol Sothebys June 24, 1953 # 117 # 1953 June 24, Sothebys #53 1987 5, February Sothebys Sothebys July 24, 1980 #236 1980 24, July Sothebys #153 1953 June 25, Sothebys Finlay 1991 #54 1991 Finlay Collection Noble Scotland of Museums National 1473.1-2 MEQ VFUDWFK R] 3 3/8" sq, 13oz 3d 3d 13oz sq, 3 3/8" ULVLQJWRNQRSSHGEDOXVWHUVWHPVDQGUHHGHGVFRQFHVô´KW reeded and knopped baluster stemsrising from faceted sconces, crest, ht, 6.9" 28oz Hope, 7" ht,Hope, 69oz ZHLJKWVDQGò´KWR] NQRSSHGVWHPVDQGEDQGHGVFRQFHVVFRQFHVVWDPSHG³´DQG³´ bases, the faceted baluster stemsknopped and banded, faceted campana VKDSHGVFRQFHVZLWKGHWDFKDEOHQR]]OHVô´KWR] loop finger grips withthumb caps CANDLESTICKS CANDLESTICKS 1703/04 McKenzie Colin 1706/07 Edinburgh McKenzie Colin details no pair, Candlesticks, Edinburgh underneath, initials feet, ball 4 pans, square plain pair, Chambersticks, I, vol 1911 Exhibition Glasgow 1700/01 Kincaid Alexander 1702/03 Edinburgh 1703/04 Murray Patrick corners, cut with and welled bases stepped square the pair, Candlesticks, Forbes Alexander Edinburgh Edinburgh details no pair, Candlesticks, corners, cut with bases square on shape, baluster octagonal pair, Candlesticks, Exhibition Hutchinson 1700/01 Ker Thomas Edinburgh of motto and crest stems, baluster base, 4, gadrooned of set Candlesticks, 1698/99 Penman James 1699/70 1699/70 Inglis Robert Edinburgh Yorstoun Mungo Hopetoun of Earl originally pair, sconces, Wall Edinburgh Edinburgh pair Candlestick, triple to rising corners with cut bases welled square cast, pair, Candlesticks, #56 1991 Finlay 103 vol Magazine Antiques 1695/96 1697/98 Penman James I Murray Patrick Edinburgh Edinburgh pair Candlesticks, octagonal molded on only, mm other the marked, fully one pair, Candlesticks, UK Collection Private 1693/94 Penman James Edinburgh simple edges, gadrooned raised with bases octagonal pair, Chambersticks, YEAR MAKER DESCRIPTION LOCATION SOURCE 68 Candlesticks Christies February 16, 1960 #121 16, 1960 February Christies #42 I, p120 vol 1911, Exhibition 2000 Autumn Sothebys Gleneagles August 25, 25, August Gleneagles Sothebys 1977 #163 J Bourdon-Smith Catalog Catalog Bourdon-Smith J p12 #43 2001 Autumn #73 1959 29, October Sothebys Spink London 24, August Edinburgh Phillips 2001 #560 Christies Glasgow March 1983 1983 March Glasgow Christies #99 Collection Shaw Antiques Koopman N Bloom & Son Ltd Ltd Son & Bloom N advertisement Connoisseur Magazine 1934 1934 Magazine Connoisseur 93 p134 vol a-c 1943.279 advertisement p16 131 vol ó´KWEDVH´DFURVV $QWLTXHV0DJD]LQHYROS WKFXWFRUQHUEDVHVô´KWR] -%RXUGRQ6PLWK&DWDORJ RFWDJRQDOVWHPVRQHZLWKPPRQO\ô´KWR] VFRQHV´KWR] andhearts and the word "Remember",½" 4 di, 14oz facets, the baluster stemand vase-shaped socket also faceted, crest andmotto oz 27 ht, ½" 7 Carmichael, of 1709/10 Seaton John 3DWULFN7XUQEXOO Edinburgh (GLQEXUJK no details 4, of set Candlesticks, &DQGOHVWLFNVSDLUFDVWZL Glasgow Collection Girdwood 1709/10 Bethune Henry Edinburgh and centers circular sunk with bases, octagonal molded on pair, Candlesticks, 1709/10 McKenzie Colin Edinburgh shaped spool to leading stems baluster knopped octagonal, pair, Candlesticks, 0XQJR 69 Compendium of Scottish Silver 5 p144 #1 38 #114 38 #114 #260203 #260203 gative gative Apollo September 1972 vol 96 vol 1972 September Apollo 102 vol Magazine Antiques Christies NY USA October 1988 1988 October USA NY Christies #41 1158 MEQ Christies Picture Book April 27, 27, April Book Picture Christies 1973 #144 #93 1960 22, June Christies Ne Christies p86 2005 Catalog Shaw Nicholas Christies March 24, 1982 #75 1982 24, March Christies Christies March 24, 1982, #76 1982, 24, March Christies Finley 1991 #79 Finley #154 1953 June 25, Sothebys 1982 24, March Christies 1953 Magazine Connoisseur p200 132 vol Clayton Christies Book Sothebys November 11, 1949 1949 11, November Sothebys #98 1950 Magazine Connoisseur p 68 125 vol ´KWR]DOO VHVDQGQR]]OHVHQJUDYHGZLWK³+$)$+´ no details details no Scotland of Museums National spool sconces, bases ½"htwith crest, a 6 6 ½ " ht, ht, " ½ 6 RFWDJRQDOEDOXVWHUPDUNHGRQEDVHV´KW of Stirling, 7oz 8d 7oz Stirling, of rising scrollhandle, reeded socket with control band, crest Sterling, of 19oz bases bases with partly octagonal baluster stemsand shaped vase sockets, bases ZLWKDFDUWRXFKHFRQWDLQLQJDVXQLQVSOHQGRUDQGDPRWWR 1720/21 Mitchelson James Edinburgh stems, baluster knopped to rising bases stepped octagonal pair, Candlesticks, 1718/19 Colin McKenzie McKenzie Chamberstick, Edinburgh 1718/19 Colin (GZDUG3HQPDQ (GLQEXUJK 7DEOHVWLFNVSDLURFWDJRQDOED 1714/15 Turnbull Patrick Edinburgh knopped corner, canted with bases square stepped 4, on of set Candlesticks, 1711/12 1712/13 Mitchell David 1714/15 Forbes Alexander Edinburgh McKenzie Colin Edinburgh oz 28 ht, ¾" 6 Hamilton, of crest octagonal, pair, Candlestick, pictured not Candlesticks, Edinburgh motto and crest handle, ring capped feet, 4 bun on octagonal, Chambersticks, 1993 #11 May London Christies p 149 Cripps 1711/12 Seatoun John Edinburgh and border molded with circular mm, worn with one pair, Chambersticks, YEAR MAKER DESCRIPTION 1710/11 LOCATION McKenzie Colin Edinburgh 3d 40oz ht, ¾" 6 Farquharson, of motto and crest with pair, Tablesticks, 19 3, March Sothebys SOURCE 1710/11 McKenzie Colin Edinburgh octagonal 1728/29, Ker James by branches later 4, with of set Tablesticks, 70 Candlesticks 108 Christies March 26, 1969 #97 #97 1969 26, March Christies Clayton Christies Book p /\RQ 7XUQEXOO August Collection Murray The #198 2003 20, 0(4 #209 p 152 126 vol Sothebys December 16, 1965 16, December Sothebys Sothebys June 25, 1953 June 25, Sothebys Sothebys July 19, 1958 #130 1958 19, July Sothebys AntiquesSimon Kaye Christies June 24, 1981 #66 1981 24, June Christies #151 VHDQGSDQ´GLR]G 6RWKHE\V$SULORU dished base with re-entrant corners, crest of Earl of the Order of the Thistle Thistle the of Order the Earl of of crest corners, re-entrant with base dished ZLWK³/V´ DQGDODWHUFUHVWIRUWKH(DUORI&DUOLVOH handles, crest and motto underneath, date and assayer wrong, 36oz 36oz wrong, assayer and date underneath, motto and crest handles, sconces, flat section handles pierced with a hole for suspension, undersides undersides suspension, for hole a with pierced handles section flat sconces, ZLWKFUHVWò´KWR] but possibly made for 1728 Ker candlesticks candlesticks Ker 1728 made for possibly but bases, with re-entrant corners, crest crest corners, re-entrant with bases, Edinburgh Edinburgh no details matched, Candlesticks, 580 82 p vol Magazine Antiques James Mitchelson Mitchelson James Edinburgh details no year, each 4 8, of set Candlesticks, Dempster UK Collection Private 1734/35 Kincaid Alexander Edinburgh :LOOLDP$\WRXQ no details pair, Tapersticks, (GLQEXUJK 6LQJOHFKDPEHUVWLFNPDUNHGED Scotland of Museums National 1735/36 Rollo John Edinburgh no details 4, of set Candlesticks, 1950 Magazine Connoisseur 1733/34 Ker James Edinburgh square stem, baluster tapering square a on nozzle banded circular Candlestick, 1730/31 And 1732/33 48 1731 & and Aytoun William 1733/34 Ker James Edinburgh scroll flying capped borders, molded with 4, circular of set Chambersticks, 1728/29 Ker James Edinburgh molded octagonal rims, molded with plain circular, pair, Chambersticks, 1728/29 Ker James Edinburgh candlesticks McKenzie 1710 with presently pair, candlesticks, of Branches YEAR MAKER DESCRIPTION 1725/26 LOCATION Tait James Edinburgh 59oz ht, 7" Haig, or Haigh of motto and 4, crest of set Candlesticks, 1991 #129 Finley SOURCE 1726/27 Ker James 1728/29 Ker James Edinburgh details no pair, Chambersticks, Edinburgh octagonal and sconces molded stems, baluster fluted with pair, Candlesticks, 1965 16, November Sothebys 71 Compendium of Scottish Silver &KULVWLHV-XO\ &KULVWLHV-XQH /\RQ 7XUQEXOO)HEUXDU\ 2004 Sothebys March 14, 1996 #151 1996 14, March Sothebys 20, October USA NY Christies 1999 #313 6RWKHE\V-DQXDU\ Sussex Goldsmiths &KULVWLHV*ODVJRZ-XO\ #200 27, April Edinburgh Christies #119 1977 15, June Christies Christies June 15, 1977 #120 1977 15, June Christies p 1274 p advertisement House Hobart itted with with itted LWKDFLSKHU ò´KW KFUHVWDQG KWR]DOO ´KW FHI DWHGQR]]OHV ]DOO VXQNHQFHQWHUVZLWK LWKVKHOOVLQQHUERUGHURI /\OH$QQXDO5HYLHZS GIOXWHGEDVHULVLQJWRIDFHWHGNQRSSHG HVWLFNVRIVPDOOVL]HIOXWHGEDOXVWHUVWHPVVTXDUH VFDOHZRUNHDFKZLWKEDOXVWHUVWHPDQGVSRROVKDSHGVRFNHW´ DQG(DUO¶VFRURQHW´KWR]DOO IDFHWHGEDOXVWHUVWHPVDQGYDVHVKDSHGVRFNHWVHDFKHQJUDYHGZ ò´ URVHVIOXWHGEDOXVWHUVWHPVVSRROVKDSHGVRFNHWVVKHOOGHFRU VWHPZLWKEDQGHGVSRROIRUPVFRQFHVRQHVLGHRIHDFKEDVHZLW PRWWRIRU&RXWWVIDPLO\RI7KRPDV&RXWWVGLVWLQJXLVKHGEDQNHU 24.5oz EDVHVZLWKLQFXUYHGDQJOHVZLWKLGHQWLFDOFUHVWV´KWR VRFNHWDQGVHPLULQJIO\LQJVFUROOKDQGOHZLWKSODLQWKXPESLH VRFNHWIRUDPLVVLQJGRZVHU 17.2oz nozzles, QR]]OHZLWKLQLWLDO³+´DQGDFRURQHWSHUKDSVIRU+RSHWRXQ" 4.2oz (GLQEXUJK &DQGOHVWLFNVVHWRIRQVKDSHGVTXDUHEDVHVZLWK (GLQEXUJK &DQGOHVWLFNVSDLUFDVWVWLFNVZLWKKH[DIRLOEDVHVZ Edinburgh Edinburgh shaped spool rim, molded base, circular plain on each pair, a Chambersticks, Edinburgh detachable border, molded plain circular, plain, pair, a Chambersticks, Assayer Hugh Gordon Assayer Hugh Gordon Assayer Archibald Ure Assayer David Mitchell 1745 ca 1745 ca Ker James Edinburgh and shells scrolls, with chased and cast base, square shaped pair, Tablesticks, 1745 ca 1745 ca Ker James 1745 ca 1745 ca Dempster Ker & 1739/40 James Ker 1739/40 James Aytoun 1739/40 William FD -DPHV.HU +XJK3HQPDQ (GLQEXUJK (GLQEXUJK &KDPEHUVWLFNVFUHVWDQGPRWWRR] &DQGOHVWLFNVSDLUHDFKRQVKDSH -DPHV0LWFKHOVRQ (GLQEXUJK &DQGOHVWLFNVVHWRIFDQGO YEAR MAKER DESCRIPTION 1736/37 LOCATION Ker James Edinburgh no details Taperstick, SOURCE 127 vol Magazine Antiques 1736/37 Ker James Edinburgh detachable with stem baluster corners, incurved base, square on Taperstick, 72 Candlesticks 10, 1993 #201 1993 #201 p14 103 vol advertisement and Son Edward Lorentz Antiques Toronto 1991 Toronto Antiques Lorentz Collection Phoenix The 11, 1990 July London Christies #170 Sothebys December 3, 1964 #118 #118 1964 3, December Sothebys Sothebys June 24, 1973 #154 1973 June 24, Sothebys Shrubsole Sothebys September 1, 1998 1998 1, September Sothebys #558 J Bourdon-Smith Sothebys December 1, 1966 #173 1966 1, December Sothebys ó´KW ó´KW 8" ht DQJOHVEDOXVWHUVWHPVYDVHVKDSHGVRFNHWVGHWDFKDEOHQR]]OHV all 68oz FKDVHGDWWKHDQJOHVZLWKVKHOOPRWLIVGHWDFKDEOHQR]]OHV coronets and mottos, campana shaped sconces, flying scroll handles, molded molded handles, scroll flying sconces, shaped campana mottos, and coronets ULPVò´GLR]GERWK Earl of Nithdale, (Note: the same sticks possibly listed for Edward Lothian), Lothian), Edward for listed possibly sticks same the (Note: Nithdale, of Earl ô´KWR]DOO Torphichen, molded rims, bell shaped sconces, simple scroll handles, handles, scroll simple sconces, shaped bell rims, molded Torphichen, both 12d 16oz Edinburgh Candlesticks, 4, set of each on shaped square base, cast withshells the at Edinburgh Edinburgh bases, crested square shaped on stems, baluster fluted pairs, 2 Tablesticks, Edinburgh Edinburgh between crests same with engraved pans, circular pair, Chambersticks, Edinburgh Edinburgh Maxell, of crest coronet, and motto crest, with engraved 4, of set Tablesticks, Edinburgh Edinburgh of crest with date later at engraved pans, circular plain pair, Candlesticks, pair pair nd pair, Dempster & Ker 2 over striking John John striking over Café Assayer Hugh Gordon Assayer Hugh Gordon Assayer Hugh Gordon Assayer Hugh Hugh Assayer Gordon 1748/49 Lothian Edward 1748/49 Edinburgh 1749/50 Aytoun William corners with canted bases square pair, Candlesticks, 1 Lothian Edward Edinburgh bases 4, shaped of set Candlesticks, 1939 Magazine Connoisseur 1991 #79 Finley 1745/46 1747/48 Ker James Dempster Ker & 59 1747 & Edinburgh Dempster William oz 51 ht, 6.9" coronet, Earl's and Edinburgh 4, cypher of set Tablesticks, 101oz long, ½" 59 sticks, and branches with pair, Candlesticks, #104 1978 21, June Christies November London Christies YEAR MAKER DESCRIPTION 1745/46 LOCATION Ker James Edinburgh decoration, rococo bobeches, no bases, square shaped pair, Candlesticks, SOURCE 1749/50 William Aytoun Aytoun 1749/50 William 1749/50 Ebenezer Oliphant Oliphant 1749/50 Ebenezer 1749/50 William Aytoun Aytoun 1749/50 1749/50 William Aytoun William Edinburgh 12d 16oz di, ½" 5 coronet, and motto crest, pair, Chambersticks, #154 1973 21, June Sothebys 73 Compendium of Scottish Silver Nicholas Shaw Catalog Winter Winter Catalog Shaw Nicholas 2000 p69 75 vol Magazine Antiques p37 VII vol Review Art Scottish #2 %HOORI$EHUGHHQDGYHUWLVHPHQW 1957.364 a 1957.364 #205 Nicholas Shaw Catalog Winter Winter Catalog Shaw Nicholas p69 2000, 1935 #70 1935 #70 1961.556-57 1961.556-57 Sothebys Gleneagles September September Gleneagles Sothebys 1, 1998 #558 Sothebys Gleneagles August 29, 29, August Gleneagles Sothebys 1983 #505 ò´KWR] ó´KW R]DOO 7KH%UHDGDOEDQH&ROOHFWLRQ6DOH 7KH0DSOH6ZDQ&ROOHFWLRQ FUHVWDQGPRWWRò´KWR] &KULVWLHV1<86$2FWREHU HGVTXDUHEDVHVWKHFRUQHUVZLWKILJXUDOSRUWUDLWV SHGVTXDUHEDVHVZLWKGHWDFKDEOHQR]]OHVFUHVWDQG no details details no Scotland of Museums National pair, no details details no pair, Scotland of Museums National DSSOLHGZLWKFDUWRXFKHVIOXWHGDQGFRXQWHUIOXWHGFROXPQV motto of Robertson, 7 7/8" ht, 33.2oz 33.2oz ht, 7/8" 7 Robertson, of motto crest and motto of Moore, Muir and Mure, 9 ¼" ht, 43.1oz 43.1oz ht, ¼" 9 Mure, and Muir Moore, of motto and crest &KDPEHUVWLFNVSDLUQRGHWDLOV knopped baluster stems rising to sconces, the sconces with central applied applied central with sconces the sconces, to rising stems baluster knopped William of motto and crest coronet, nozzles, multifoil late possible with rib, for listed possibly sticks same the (Note: Nithdale, of Earl Maxwell, Oliphant), Ebenezer the knopped flared stems and banded spool shaped sconces, with possible late late possible with sconces, shaped spool banded and stems flared knopped the PXOWLIRLOQR]]OHVFUHVWDQGPRWWRRI-RKQ+RUEXUJKRIWKDW,ON 36.5oz 1756/57 Dempster Ker & Edinburgh corners faceted sides, concave with bases square shaped pair, Candlesticks, 5REHUW*RUGRQ $OH[DQGHU*DLUGQHU (GLQEXUJK (GLQEXUJK 7DEOHVWLFNVSDLURQVKD 1753/54 1754/55 Robertson & Lothian Edinburgh Robertson & Lothian Edinburgh 14d 16oz di, ½" 5 circular, plain, pair, Chambersticks, Candlesticks, Collection Private -DPHV0LWFKHOO (GLQEXUJK &DQGOHVWLFNVSDLUEUDVVIRUP (EHQH]HU2OLSKDQW (GLQEXUJK 7DEOHVWLFNVSDLURQVKDS 'RXJDO*HG (GLQEXUJK &DQGOHVWLFNVVHWRIô´KW 1750 ca 1750 ca 1750/51 Coline Allan Ged Dougal Aberdeen Edinburgh pair Candlesticks, pair, Candlesticks, #109 1991 Finlay 1749/50 Lothian Edward Edinburgh shaped corners, and shells with bases square shaped 4, of set Candlesticks, YEAR MAKER DESCRIPTION 1749/50 LOCATION Lothian Edward Edinburgh below motto, and crest a with bases square shaped stepped pair, Candlesticks, SOURCE 74 Candlesticks \ Finlay 1991 #94 1991 Finlay 89 p2 vol 1969 March Apollo MEQ 1060-61 1971.282-283 Private Collection Collection Private #201 1994 Canada Sothebys at Blair Castle Castle at Blair Sothebys #100 1980 September p567 1982 Review Silver Lyle National Museums of Scotland Scotland of Museums National 679-80 MEQ 2005 Sothebys Scone April 1979 #95 1979 April Scone Sothebys FUHVW &KULVWLHV1RYHPEHU LOZLWKRULJLQDOQR]]OHVKW PHDVXUHGZLWKRXWWKH FRUQHUVJDGURRQHGFROODUULPVVZLUOHGIOXWLQJòKW QR]]OHV R]G counter fluted columns, false Corinthian capitals, detachable nozzles, gadroon gadroon nozzles, detachable capitals, Corinthian false columns, fluted counter ERUGHUVFUHVWDQGPRWWRòKWR]G EDVHVFUHVW±OLRQUDPSDQWIDFLQJGH[WHUóKWR]G Edinburgh Edinburgh nozzles original with hexafoil cast pair, Candlesticks, 102 vol Magazine Antiques Edinburgh Edinburgh bases square shaped on design, rococo pair, Tablesticks, #24400 London, of Phillips J S Edinburgh Edinburgh design rococo 4, of set Candlesticks, Edinburgh square shaped crested domed with stems, columnar 4, of set Candlesticks, Edinburgh details no 4, of set Candlesticks, #104 1968 April Sothebys Collection Swan Maple The (GLQEXUJK &DQGOHVWLFNVVHWRIKWR]G 6RWKHE\V-XO William Dempster Dempster William William Dempster Dempster William William Dempster Dempster William Dempster William William Dempster Dempster William William Dempster Dempster William 1759/60 Robertson & Lothian Edinburgh pair columnar, Candlesticks, Scotland of Museums National :LOOLDP'HPSVWHU (GLQEXUJK &DQGOHVWLFNVVHHHQWU\ 1759/60 Gordon Robert 1759/60 Robertson & Lothian Edinburgh Edinburgh pair Candlesticks, cut flat sides, concave with sticks bases, square shaped pair, Candlesticks, Toronto Antiques Lorentz 1758/59 1758/59 Gordon Robert Dempster William Edinburgh Edinburgh pair Chambersticks, hexafo pair, Candlesticks, Collection Swan Maple The YEAR MAKER DESCRIPTION 1757/58 LOCATION or Davie William SOURCE 1757/58 or Davie William 1758/59 or Davie William 1758/59 or Davie William 1758/59 or Davie William 1758/59 Gordon Robert Edinburgh and fluted knopped shaped to rising bases octagonal pair, Candlesticks, 1758/59 or Davie William 75 Compendium of Scottish Silver , 1979 #214 #214 1979 , DF #108 1966 26, April Christies Exhibition 1911, vol I, p120 #41 #41 p120 I, vol 1911, Exhibition 1977 #98 1979 #81 Sothebys Gleneagles August 31, 31, August Gleneagles Sothebys 1992 #160 Sothebys Gleneagles August 29, 29, August Gleneagles Sothebys 1978 #391 Sothebys Scone Palace April April Palace Scone Sothebys 1977 #99 Sothebys Hopetoun House House Hopetoun Sothebys #71 1978 13, November Private Collection Collection Private of nd xafoil with original nozzles, each stick and nozzle nozzle and stick each nozzles, original with xafoil columnar stems, stiff leaf sconces and detachable gadroon borderednozzles, ORDGHGô´KW detachable nozzles, decorated with shell motifs, one nozzle by William Cafe, Cafe, William by nozzle one motifs, shell with decorated nozzles, detachable /RQGRQWKHUHPDLQGHUXQPDUNHG´KWR] with crest and motto, knopped hexagonal stems banded capripana shaped shaped capripana banded stems hexagonal knopped motto, and crest with of set with suite en edges, on borders gadroon nozzles, detachable and sconce 1762/63 Gordon Robert 4 by Corinthian capitals, ovolo borders, detachablenozzles, 12 ½"ht Hallgreen or for his near kinsman Alexander Coutts, Usher of the White Rod, Rod, White the of Usher Coutts, Alexander kinsman near his for or Hallgreen 8 ¾" ht, 10d 75oz engraved with contemporary crest Coutts, of either for James Coutts, 2 1763/64 Gairdner Alexander Edinburgh 80oz ht, ¾" 9 motto, and 4, crest of set Candlesticks, 1967 January Magazine Antiques 1762/63 1762/63 Gordon Robert Gordon Robert 1762/63 Edinburgh Gordon Robert Edinburgh Dundas of 8, Crest of set Candlesticks, 1763/34 oz 104 ht, ½" 10 motto, and 4, crest of set Candlesticks, Dempster William Edinburgh Edinburgh 4 of set above the of one Candlestick, details no 4, of set Candlesticks, 19, April Palace Scone Sothebys #414 1988 October NY Christies 23, April Palace Scone Sothebys Scotland of Museums National 1761/62 Dempster William Edinburgh above as same possibly details, no pair, Candlesticks, Glasgow Sons & Edward 1761/62 Dempster William Edinburgh below and shells lobes bold with chased bases square pair, Candlesticks, 1761/62 Dempster William Edinburgh and stems faceted and knopped bases, square 4, shaped of set Candlesticks, 1761/62 Robertson & Lothian Edinburgh bases square dished slight preceding, as same possibly pair, Candlesticks, 1761/62 1761/62 Robertson & Lothian Edinburgh Robertson & Lothian Edinburgh 4d oz 50 ht, ½" 10 motto, and crest bases, square pair, Tablesticks, stems, columnar loaded, decorated, rim bases 4, square of set Tablesticks, 11 October Sothebys YEAR MAKER DESCRIPTION 1760/61 LOCATION Dempster William Edinburgh he 4, of set Candlesticks, SOURCE 76 Candlesticks LRQ #787169 Stock #241YL #241YL Stock #787169 K.1999.264 (1-4) (1-4) K.1999.264 1972 #166 1972 #166 25, August Gleneagles Sothebys 1997 #137 Autumn 1997, #39 p 58 p #39 1997, Autumn Christies London June 15, 1977 1977 15, June London Christies #101 Negative *HRIIUH\:LOOV&DQGOHVWLFNV 1974 p72 J Bourdon-Smith Catalog Catalog Bourdon-Smith J 1992 London Sothebys Blair Castle September #43 1980 12, 29, August Gleneagles Sothebys 1983 #500 Sothebys Gleneagles August 28, 28, August Gleneagles Sothebys 1975 #63a G 6RWKHE\V/RQGRQ2FWREHU (DUO¶VFRURQHWFKDVHG HGVKDSHGERUGHUDQGORRSHGKDQGOHFUHVW± OV &KULVWLHV1<86$ , no details details no , Scotland of Museums National severe stepped base with 2 courses of gadroon molding gadroon of 2 courses with base stepped severe across, 92oz 92oz across, ERDU¶VKHDGDQGPRWWR³)25:$5'2856´IRU6HDWRXQRI7RXFKò´ angles, tripleknopped stems scored with verticallines, spool shaped sconces, GHWDFKDEOHQR]]OHV´KWR] bands of shell motifs loading, by above the covered gadroon sticks 2 on borders,marks nozzles, columnar stems, detachable open capitals, work Corinthian ò´KW (GLQEXUJK 7DEOHVWLFNVSDLUPLGFHQWXU\IRUPóKWR] Edinburgh Edinburgh 36oz ht, 9" set, previous the of part Dundas, of crest cast, pair, Candlesticks, Catalog Bourdon-Smith J Edinburgh Edinburgh 111oz bases, gadrooned square on 6, columnar, of set Candlestick, Collection Linlithgow (GLQEXUJK &DQGOHVWLFNVSDLUQRGHWDLOV 7KH0DSOH6ZDQ&ROOHFW Edinburgh Edinburgh the at shells with decorated bases square shaped 4, of set Candlesticks, (GLQEXUJK &DQGOHVWLFNVVHWRIVTXDUHEDVHVFUHVWEHORZRQ :LOOLDP'HPSVWHU William Dempster Dempster William :LOOLDP'HPSVWHU :LOOLDP'HPSVWHU :LOOLDP'DYLHRU 1771/72 or Davie William 1772/73 available Not 3DWULFN5REHUWVRQ Edinburgh no details 8, of set Candlesticks, 50 p202 vol Magazine Antiques :LOOLDP'DYLHRU 1770 ca Campbell & Milne Glasgow pair Candelabra, -DPHV*LOOLODQG :LOOLDP'DYLHRU (GLQEXUJK1768/69 &DQGOHVWLFNVSDLUQRGHWDL Marshall David Edinburgh capital, and column Corinthian a set, or pair a part be of may Candlestick, YEAR MAKER DESCRIPTION 1764/65 LOCATION Dempster Ker & SOURCE $OH[DQGHU*DLUGQHU (GLQEXUJK &KDPEHUVWLFNZLWKJDGURRQ 77 Compendium of Scottish Silver 1977 #101 #101 1977 XHV0DJD]LQHYROS %RQKDP V6DOH 1LFKRODV6KDZ$QWLTXHV :RROOH\ :DOOLV-DQXDU\ /RW MEQ 1224 1LFKRODV6KDZ&DWDORJ:LQWHU S 1DWLRQDO0XVHXPVRI6FRWODQG . /\RQ 7XUQEXOO&ROOHFWLRQ $XJXVW 1DWLRQDO0XVHXPVRI6FRWODQG 0(4 3ULYDWH&ROOHFWLRQ J Bourdon-Smith London PRWWR IOXWHGVKRXOGHUV FDQGOH )LQOD\ RRQHGFLUFXODUEDVHSURYLVLRQWRWDNHDVWRUP ZLWKJDGURRQHGERUGHUVVQXIIHUODFNLQJ HUJXVRQRI3LWWRXUDOVRPDUNHG*)7REDJR LDQZLWKFDVHKW 6RWKHE\V2FWREHU LR] /\OH6LOYHU5HYLHZS DUIRUPYDVHVKDSHGVFRQFHVZLWKWKUHDGHGULQJV V /\OH6LOYHU5HYLHZS KDQGOHGGDPDJHG´KWô´GLR] FUHVWDQGPRWWR9LUXWDWHòKWR] VKDGHDQGFRQLFDOVQXIIHUFUHVWHGHQJUDYHGZLWKDQRUGHUDQG +RQHVWDH*ORULD)D[0HQWHVôGLR] FUHVWFRQLFDOVQXIIHUVZLWKVDPHFUHVWGLVKHGFLUFXODUEDVH threaded rim rim threaded *ODVJRZ &KDPEHUVWLFNQRGHWDLOV 6RWKHE\V*OHQHDJOHV$XJXVW 3URYLQFLDO &KDPEHUVWLFNSODLQJDOOHULHGSDQVKRUWVRFNHWIRU $VVD\±(GLQEXUJK $VVD\HG(GLQEXUJK (continued) (continued) FD $OH[DQGHU0F/HRG ,QYHUQHVV -DPHV0F.D\ 7DEOHVWLFNVSDLUQRGHWDLO (GLQEXUJK 7DSHUVWLFN*HRUJH,,,FLUFXODU 1801/02 McDonald John Edinburgh 5*UD\ 6RQ details no Chamberstick, Scotland of Museums National 1RWDYDLODEOH *HRUJH)HQZLFN (GLQEXUJK &ROXPQVWLFNVSDLU$UPVRI) &DQGOHVWLFNVVHWRIQRGHWDLOV $QWLT 1789/90 I B B 1789/90 I -RKQ0F'RQDOG (GLQEXUJK &KDPEHUVWLFNV*HRUJH,,,JDGU YEAR MAKER DESCRIPTION LOCATION SOURCE 1786/87 Robertson Patrick 3DWULFN5REHUWVRQ Edinburgh 'DYLG0DUVKDOO (GLQEXUJK 111 oz ht, 6" "H", initial coronet, base, 6, square of set Tablesticks, :LOOLDP5REHUWVRQ &KDPEHUVWLFNVSDLUò´G (GLQEXUJK (GLQEXUJK 15, June Christies 7DEOHVWLFNVVHWRI&RULQWK &KDPEHUVWLFNVSDLUFLUFXO 78 Candlesticks MEQ 947-948 1969.683-84 1969.683-84 947-948 MEQ Autumn 1997 #39 p58 #39 1997 Autumn MEQ 1066 1972.259 1972.259 1066 MEQ #162 no details details no Scotland of Museums National candlesticks Adam-style of pair Candlesticks, Scotland of Museums National 1900/01 Hamilton & Inches Edinburgh Inches & 1900/01 Hamilton 1825 ca 1825 ca 1835/36 Cameron Alexander Dundee Co Elder & 1876/77 no details pair, Tablesticks, Inches & Hamilton Edinburgh Edinburgh 25oz ht, 1d 38oz ½" 7 Chambersticks, bases, quatrefoil with pair Candlesticks, Catalog Bourdon-Smith J #112 1991 Finlay 1973 8, November Sothebys YEAR MAKER DESCRIPTION 1818/19 LOCATION Son & Gray Robert Glasgow Chamberstick, SOURCE 79 Compendium of Scottish Silver 80 Casters, Dredgers and Pepper Pots CastersCASTERS Plate 11. An octagonal Caster wrought Fall of 1729 by James Ker, Edinburgh. Courtesy of The Phoenix Collection. Photograph by Janice M Dietert 81 Compendium of Scottish Silver XO\ &KULVWLHV$SULO &KULVWLHV0D\ Finlay 1991 #51 1991 Finlay 6FRWWLVK$UW$FDGHP\([KLELW 1939 #938 -&DWKFDUW:KLWH&ROOHFWLRQ 1DWLRQDO0XVHXPVRI6FRWODQG (DUORI6WUDWKPRUH&ROOHFWLRQ 6RWKHE\V'HFHPEHURU &KULVWLHV-XQH p Holland 34 &OD\WRQ'LFWLRQDU\S $SROOR'HFHPEHUS 6FRWWLVK$UW$FDGHP\([KLELW 1939 #938 -&DWKFDUW:KLWH&ROOHFWLRQ 1DWLRQDO0XVHXPVRI6FRWODQG Glasgow Empire Exhibition 1938 1938 Exhibition Empire Glasgow #24 #11, 6RWKHE\V$SULO QJDQRWKHU FRYHUDQGERUGHUKW 3DUN/DQH([KLELW WRSJDGURRQHGIRRWòKWR]G &KULVWLHV-XQH GLHVILQHO\HQJUDYHGDERYHUHHGHGJLUGOHV RRWFRYHURYHUODSSLQJVOHHYHôKW IRRWFXWFDUGZRUNIOXWHGILQLDOJLOW UGZRUNGRPHGFRYHUSOXPHHQJUDYHGZLWK UJDGURRQHGIRRWFUHVWDQGPRWWRKWR]G &KULVWLHV- PHFRYHUED\RQHWMRLQWVSUHDGLQJEDVH R]G R]G KW OLJKWKRXVHIRUPô KWR] IROLDWHFXWFDUGZRUNRQVSUHDGLQJEDVHV$UPVRI5DPVH\LPSDOL 06KW ³--$0´GDWHOHWWHUQHHGVYHULILFDWLRQ CASTERS, DREDGERS AND PEPPER POTS POTS AND PEPPER DREDGERS CASTERS, CASTERS &ROLQ0F.HQ]LH (GLQEXUJK &DVWHUULEDURXQGWKHFHQWH 5REHUW%UXFH (GLQEXUJK &DVWHUF\OLQGULFDOJDGURRQHGI -RKQ6HDWRXQ &ROLQ0F.HQ]LH (GLQEXUJK (GLQEXUJK &DVWHUEXOERXVEDVHJDGURRQHG &DVWHUSHDUVKDSHGJDGURRQHG *HRUJH 82 Casters, Dredgers and Pepper Pots 948 #131 #39 1928 ecember 8, 1 ecember 18, Christies November 26, 1908 #32 1908 26, November Christies Finlay 1991 #79 1991 Finlay #63 1942 22, April Sothebys #332 1953 3, December Sothebys #326 1921 June Christies Collection Lockett Brand Inglis, Ltd 1987 Ltd Inglis, Brand Alcorn, Fine Boston Museum of #25 Art pp327-328 D Christies Exhibit Academy Art Scottish 1939 #918 Exhibit 1929 House Seaford #551 #254 1929 Exhibit Lane Park 1949 Magazine Connoisseur p 66 123 vol 1987 5-10, February Christies #55 Collection Noble p85 2005 Catalog Shaw Nicholas 10, 1976 May Dublin Christies #445 April House Hopetoun Sothebys 1988 #62 Spring Catalog Bourdon-Smith J 1998 Connoisseur Magazine 1951 1951 Magazine Connoisseur p131 128 vol VVLEO\IRU R´KW RXOGHUVWKHWDOOHVWE\³,+´ foot, 6oz RU³7+´WKHRWKHUVE\-RKQ6HDWRXQ 16.2oz 16.2oz SLHUFHGWRSDUPRULDOVRI7KRPVRQRI&KDUOHVWRQFUHVWDQGPRWW 13d 30oz ht, ½" 6 ht, ¼" 8 initials "WG" above "JL", 8" ht, ht,initials above 5 31oz "WG" 7/8" cover with moldedand gadroonedribs, cover pierced with trefoils and scrolls, RQHFRYHUZLWKLQQHUVOHHYHFUHVWDQGPRWWR³-(5(1-(3/86´SR (UVNLQHò´KWR] Edinburgh Set of 3 casters, gadrooned base, bulbous body, Arms of Earl of Strathmore, Edinburgh Casters, pair, cylindrical, on gadrooned foot, slight balustergirdle, detachable (GLQEXUJK &DVWHUVVHWRIRFWDJRQDOFXWFDUGZRUNDWWKHVK $VVD\HU±-DPHV Penman (T) H 1702/03 James Penman Penman 1702/03 James 1702/03 McKenzie Colin Edinburgh 7d 6oz finial, gadrooned work, card cut shaped, cone Caster. Bruce 1702/03 Robert D Christies 1703/04 I and Seatoun John 1702/03 McKenzie Colin Edinburgh gadrooned plain, Caster, YEAR MAKER DESCRIPTION 1700/01 LOCATION Scott Walter Edinburgh finely base, of bottom and top on work cut-card base, gadrooned caster, Sugar SOURCE 1702/03 Jr Scott George 1702/03 Edinburgh Jr Scott George 16d 32oz ht, 6" and ht ½" 3, 8 of set Caster, Edinburgh with engraved girdle, reeded base, gadrooned 3, cylindrical, of set Casters, #151 1951 18, June Christies 83 Compendium of Scottish Silver 9, 1934 #144 #144 1934 9, Christies November 9, 1949 #131 1949 9, November Christies 6-3KLOOLSV,QF 1994 London Tessier's Collection Shaw Christies or Sothebys February February or Sothebys Christies #35 1966 24, Winter Catalog Shaw Nicholas 2000 p67 November Edinburgh Christies #59 1987 11, Lumley of Provenance Sothebys April 3, 1958 #164 #164 1958 3, April Sothebys p133 1959 August Life Country #301 1993 23, April Sothebys Gardner Collection Collection Gardner p348 93 vol Sothebys July 14, 1966 #194 1966 14, July Sothebys Collection Shaw 1983 March Glasgow Christies #96 Scotland of Museums National 1983 1563 MEQ 1959 KWR] R] rdle, engraved with a monogram, 8 ½" ht, ht, ½" 8 monogram, a with engraved rdle, finial, later engraved with a crest and Bath motto within a laurel wreath wreath laurel a within motto Bath and a crest with engraved later finial, 1d 22oz ht, 1/8" 6 and ht 7/8" 7 IP", RDP/ "SD/ engraved surround, SLHUFHGFRYHUZLWKJLUGOHDFRUQILQLDO´KWDQG´KW R] GLIIHUHQWGLDSHUSDWWHUQVDFRUQILQLDOPROGHGULPIRRWô´ with slip-lock joints, pierced 2 in a diaperdesign, the third blind, acorn finials RQPROGHGULPIHHW´KWDQGô´KWR] spreading foot, domed cover withgadrooned flange,9oz ht, ½" cut-card 7 Campbell, work of ontop, crest later Edinburgh Casters, set of 3, baluster form, on domed circular foot, crest,high domed Edinburgh Caster, circular foot, molded mid-rib,½" 8 ht, 11oz tt Edinburgh gi molded with caster Baluster r Scott r Scott III $VVD\HU±-DPHV Penman 1708/09 Thomas Cleghorne Cleghorne 1708/09 Thomas 1709/10 Bruce Robert 1710/11 Bethune Henry Edinburgh 8d 11oz ht, 8" cover, pierced body, around rib shaped, pear Caster, Edinburgh acorn foot, spreading stepped on shaped, pear 3, plain, of set Sugar casters, #83 3, 1961 May Christies 1708/09 Walter Sco 1708/09 Walter 1707/08 Walte 1708/09 McKenzie Colin Edinburgh with pierced covers top, the toward tapering cylinders straight pair, Casters, 1706/07 McKenzie Colin 1706/07 Edinburgh Murray Patrick pair Caster, Edinburgh covers crest, with the girdle below engraved bodies 3, baluster of set Casters, 1934 Magazine Connoisseur 1706/07 McKenzie Colin 1706/07 Edinburgh McKenzie Colin ht ¾" 10 Caster, Edinburgh 8d 12oz ht, 7" finial, acorn fluting, of 3 bands shaped, pear pair, Caster, 1 March Christies January Magazine Connoisseur YEAR MAKER DESCRIPTION 1703/04 LOCATION Seatoun John Edinburgh gadrooned octagon, the of facet a different on mark each octagonal, Caster, SOURCE 84 Casters, Dredgers and Pepper Pots p161 #5 vol 135 p1545 advertisement advertisement p1545 135 vol Clayton Christies Book &KULVWLHV/RQGRQ-DQXDU\ 1969 vol 305 p 46 p 46 305 vol Sothebys July 4, 1968 #89 4, 1968 July Sothebys 6LPRQ.D\H$QWLTXHV 6RWKHE\V*OHQHDJOHV$XJXVW 1994 #141 0(4/ Shaw Collection Collection Shaw 29, March Glasgow Christies 1983 #102 Scotland of Museums National 1562 MEQ MEQ 1111 MEQ 1111 1974.419 Christies Glasgow March 1983 1983 March Glasgow Christies #94 #153 1957 23, October Christies Scotland of Museums National H.1994.742 \+D\/DG\ \OL]HGVSUD\V ò´KWR] UILQLDOFUHVWòKWR]G &KULVWLHV$SULO DUVKDSHG &RQQRLVVHXU0DJD]LQH WRSXQPDUNHG -%RXUGRQ6PLWK/RQGRQ R] &RXQWU\/LIH-XQH FHWHGEDOOILQLDOKWR]G &KULVWLHV0DUFK plain, octagonal octagonal plain, Scotland of Museums National GHWDFKDEOHFRYHUZLWKSODLQEURDGDSSOLHGJLUGOHDQGSLHUFHGVW IDFHWHGEDOXVWHUILQLDOFUHVWDQGPRWWR´KWR] UHHGHGVKRXOGHUJLUGOHFUHVWDQGPRWWRRIWKH(DUORI/LQGVD\ /LYHEXW'UHLGFRYHUSLHUFHGDQGOLJKWO\HQJUDYHGò´ DQGEDVHRISLHUFHGGRPHGFRYHUEDOXVWHUILQLDOHQJUDYHG³0DU 5DQGHUVWRQHHOGHU´´R] (continued) (continued) 0XQJR 85 Compendium of Scottish Silver Sothebys Hopetoun House April House Hopetoun Sothebys #71 1987 29, #44 1939 7, June Christies -%RXUGRQ6PLWK&DWDORJ p11 May House Hopetoun Sothebys 1990 +RZ¶V1RWHVRQ$QWLTXH6LOYHU 1941 p22 I, vol Autumn 2000 2000 Autumn Sothebys Gleneagles August 1988 #448 Scottish Art Review vol XIV #4 #4 XIV vol Review Art Scottish 1975 advertisement Edinburgh of How on back cover Christies June 15, 1977 #129 1977 15, June Christies 1939 #946 Collection Stirling-Maxwell ô´KWR] QLWLDO% HUILQLDO´KW IRUPò´KWR] -%RXUGRQ6PLWK&DWDORJ 10oz 10d 10d 10oz VKRXOGHUJLUGOHDQGOLSFRYHUSLHUFHGZLWKHQJUDYHGVFUROOVL ULPFRYHUVZLWKDSSOLHGJLUGOHFUHVWDQGPRWWRò´KWDQG and rim, cover pierced with stylized leaf-filled roundels, faceted vase finial, finial, vase faceted roundels, leaf-filled stylized with pierced cover rim, and ó´KWR] JLUGOHDQGULPSLHUFHGFRYHUZLWKSODLQJLUGOHIDFHWHGEDOXVW 7.3oz 7.3oz sections, faceted finial engraved with the Arms of the City of Edinburgh, 8"ht and 6 ½" ht, 30oz 30oz ht, ½" 6 and 8"ht Edinburgh, of City the of Arms the with engraved Edinburgh Casters, set of 3, octagonal form, moldedreeded foot, shoulder girdle and Edinburgh Edinburgh 2d 5oz ht, 1/3" 6 motto, and crest octagonal, Caster, #127 29, 1959 January Christies Edmonstoun I I Edmonstoun Assayer-Edward Penman 1723/24 Alexander 1723/24 Alexander 1720 ca 1720 ca available Not 1722/23 Aytoun William Edinburgh ht, ¼" 7 finial, baluster octagonal ribbing, with octagonal plain Caster, 1721/22 Kincaid Alexander Edinburgh molded reeded foot, stepped molded on form, vase octagonal, Caster, 1719/20 Campbell Colin Edinburgh girdle shoulder molded foot, domed stepped on form, vase octagonal Caster, 3DWULFN0XUUD\, (GLQEXUJK &DVWHURFWDJRQDOEDOXVWHU 1718/19 Turnbull Patrick Edinburgh shoulder, molded foot, spreading stepped on form, vase octagonal Caster, 1717/18 Penman Edward 1718/19 Edinburgh Mitchelson James ht 8" body, shaped pear octagonal, Caster, Edinburgh in pierced cover trim, shoulder base, reeded form, vase octagonal Caster, Exhibit Academy Art Scottish YEAR MAKER DESCRIPTION 1716/17 LOCATION Murray Patrick Edinburgh finial, reeded baluster rib, molded double 3, octagonal, of set Casters, SOURCE 86 Casters, Dredgers and Pepper Pots 1932 #542 #542 1932 '$* 0XVHXPVRI6FRWODQG 6RWKHE\V-XO\ 6LPRQ.D\H$QWLTXHV &KULVWLHV-XQH 1DWLRQDO0XVHXPVRI6FRWODQG Yb Ya, L410Y, 0(4 Sothebys April 12, 1945 #44 #44 1945 12, April Sothebys auction Christies &KULVWLHV-XO\ #4 1942 24, April Christies &KULVWLHV2FWREHU $QWLTXHV0DJD]LQH)HEUXDU\ advertisement Shrubsole 7KH3KRHQL[&ROOHFWLRQ 6RWKHE\V-XO\ 6RWKHE\V6FRQH3DODFH$SULO 1933.57 1933.57 J Bourdon-Smith Catalog Spring Spring Catalog Bourdon-Smith J Aberdeen Museumsand *DOOHULHV$% How Collection Collection How R] foot Art Treasures Exhibit Treasures foot Art UWRIDPL[HGVHWRIVPDOOHURQHVFUHVW WKVWLIIOHDIDJHDERYHWKHIRRWDQGVFUROOLQJ DQGPRWWR6XQ7H7HVWHKWDQGKW PL[HGVHWRIGLIIHUHQWPDNHUVFUHVWDQG QDOYDVHIRUPZRUQFUHVWRIDVWDJPRWWR ôKWDQGòKWR]G &KULVWLHV0D\ WDJRQDO 1DWLRQDO0XVHXPVRI6FRWODQG DQGPRWWR/LYHEXW'UHLGò´KW &XEXH1H3XOLVKWDQGòKWR] PRWWR.LQGKHDUWIRU'XIIRI%DQIIVKLUH´KWR] R]G IROLDJHEHORZWKHFRYHUô´KWR] motto "Live but Dreid" Dreid" but "Live motto ³3HUPDUHHWWHUUDV´SLHUFHGGRPHGOLGDFRUQILQLDOò´KW JK &DVWHUQRGHWDLOV 1DWLRQDO Edinburgh Caster, octagonal,molded reeded shoulder girdle, faceted vase finial crestand $VVD\HU±(GZDUG 3HQPDQ -DPHV0LWFKHOVRQ (GLQEXUJK &DVWHUVVHWRISODLQRF (GZDUG3HQPDQ (GLQEXUJK &DVWHUVVHWRISODLQRFWDJR -DPHV.HU (GLQEXUJK &DVWHUVSHDUVKDSHGQRJLUGOHSD -DPHV.HU -DPHV.HU :LOOLDP$\WRXQ (GLQEXUJK (GLQEXUJK &DVWHUVVHWRIRFWDJRQDOFUHVW &DVWHUVVHWRIRFWDJRQDO -DPHV7DLW (GLQEXUJK &DVWHURFWDJRQDOODWHUFKDVHGZL -DPHV0LWFKHOVRQ (GLQEXU (GZDUG3HQPDQ (GLQEXUJK &DVWHUSHDUVKDSHGODUJHVWRI 1725 ca 1725 ca Robertson George Aberdeen motto Urquhart, of crest with engraved Caster, Sugar Urquhart The Caster, YEAR MAKER DESCRIPTION 1724/25 LOCATION Mitchelson James Edinburgh collet rib, bellied plain caster, Muffineer SOURCE 87 Compendium of Scottish Silver Christies Edinburgh November November Edinburgh Christies #35 1990 21, #49 1983 29, March Christies Collection Shaw 14, November Scotland Christies 1985 #276 6RWKHE\V*OHQHDJOHV$XJXVW 6RWKHE\V'HFHPEHU &KULVWLHV0D\ 6RWKHE\V+RSHWRXQ+RXVH 1RYHPEHU $QWLTXHV0DJD]LQHYS &KULVWLHV*ODVJRZ0DUFK #79 1LFKRODV6KDZ&DWDORJ S (GLQEXUJK&RUSRUDWLRQ0XVHXP &KULVWLHV*OHQHDJOHV1RYHPEHU &KULVWLHV0DUFK 6RWKHE\V*OHQHDJOHV$XJXVW 1991 #213 PPDUNV OVò´KW PP;¶VGDWH LQLDOEDVHZLWK WKHDSSOLHGJLUGOH DWHUSLHUFHGEDQG UFRDWRIDUPVIRU)XOOHUDQG DGLQJIRRWDSSOLHGUHHGHGJLUGOH GWRSVRQWZRFUHVWDQGPRWWR /)OHWFKHU6LOYHUSLQ GEXQWRSFUHVWDQGPRWWRRI&XQQLJKDPH GRQFLUFXODUPROGHGIRRWERG\ZLWKJLUGOH PRWWRRI'LFNóKWR] 1REOH&ROOHFWLRQ OHWWHULQGLVWLQFWFRYHUXQPDUNHG´KWR]G DSSOLHGJLUGOHFUHVWDQGPRWWRRI&ROTXKRXQ7KDW,ONDQG/XVV LQLWLDO³)´KWR]G WRSHQJUDYHGZLWKFUHVWRI/DWKRPFRYHUSRVVLEO\DVVRFLDWHG 'XPEDUWRQVKLUHóKWR]G no details details no DVVRFLDWHGGRPHGGHWDFKDEOHFRYHUHQJUDYHGZLWKFUHVWRI/DWKR UXEEHGFRYHUXQPDUNHG´KWR] KWR]G RQHFRYHUSLHUFHGRQHEOLQGRQHXQPDUNHGHQJUDYHZLWKLQLWLD R] GRPHGFRYHUSLHUFHGSDQHOVRIWUHOOLVZRUNDQGIROLDJHEHOOI EDQGVRIUHHGLQJLQLWLDO³1´XQGHUQHDWKò´KWR] (GLQEXUJK &DVWHURFWDJRQDODSSOLHGJLUGOHDFRUQILQLDOODWH (GLQEXUJK &DVWHURFWDJRQDOIRUPFRYHUHQJUDYHGSDQHOVZLWKO (GLQEXUJK &DVWHUYDVHVKDSHGHQJUDYHGZLWKLQLWLDO³$5´EHORZ DLODEOH (GLQEXUJK &DVWHUVSDLUSODLQSHDUVKDSH $VVD\HU$UFKLEDOG Ure $VVD\HU±$OH[DQGHU Ure -DPHV.HU -DPHV.HU 1730 ca 1730 Luke Robert Glasgow bun band, applied reeded with foot, spreading on shaped, pear plain, Caster, 1730 ca 1730 Luke Robert Glasgow a above, same and number lot wrong the with possibly shaped, pear Caster, :LOOLDP$\WRXQFD (GLQEXUJK -DPHV.HU 'U\PXVWDUGFDVWHUFUHVWDQG (GLQEXUJK &DVWHUVVHWRIYDVLIRUPSLHUFH FD 5REHUW/XNH *ODVJRZ &DVWHUSODLQSHDUVKDSHGRQVSUH :LOOLDP$\WRXQ (GLQEXUJK 'U\PXVWDUGFDVWHUSHDUVKDSH 1RW$Y 1729/30 William Aytoun Aytoun YEAR MAKER DESCRIPTION 1729/30 William LOCATION SOURCE 88 Casters, Dredgers and Pepper Pots HV0D\ DWLRQDO0XVHXPVRI6FRWODQG 6RWKHE\V*OHQHDJOHV$XJXVW 6RWKHE\V0DUFK 6RWKHE\V$SULO 6RWKHE\V0DUFK 6RWKHE\V6FRQH3DODFH$SULO 1976 #123 1DWLRQDO0XVHXPVRI6FRWODQG 0(4 3KLOOLSV(GLQEXUJK$XJXVW Shrubsole advertisement advertisement Shrubsole p230 107 vol (GLQEXUJK++ 0(4 ´KWR] W\OL]HG EHORZEDOO OHURQHEOLQG ´KWDQG ZHUKHDGVDQG VSUHDGLQJEDVHFRYHU RQVSUHDGLQJIRRWGRPHG LWKFRQWHPSRUDU\DUPVSRVVLEO\RI EHORZWKHPROGHGJLUGOHRQVSUHDGLQJ ´KWDQGò´KW WZR +XQWOH\+RXVH0XVHXP RGLHVRQVSUHDGLQJIHHWZLWKGRPHGFRYHUV ODWHUFUHVWFKDVHGZLWKIORZHULQJIROLDJHRQD EDVHFRYHUSLHUFHGZLWKDOWHUQDWLQJSDQHOVRIGLDSHUZRUNIOR VW\OL]HGIROLDJHEHOOVKDSHGILQLDO´KWR] foliage, bell shaped finial, crest a bent arm holding a scimitar, and motto motto and scimitar, a holding arm bent a crest finial, shaped bell foliage, ³'UHDG*RG´ô´KWR] SLHUFHGDQGHQJUDYHGZLWKDOWHUQDWHSDQHOVRIGLDSHUZRUNDQGV GHFRUDWHGZLWKGLDSHUDQGVFUROOZRUNODUJHURQHSLHUFHGVPDO ò´DQGó´KWR]ERWK PDWWHGJURXQGFRYHUSLHUFHGZLWKOHDIDQGODWWLFHZRUNSDQHOVILQLDOó´KWR] OLGZLWKDOWHUQDWLQJSDQHOVRIGLDSHUZRUNDQGVFUROOZRUNò ó´KWR] +DPLOWRQKLJKGRPHGSLHUFHGFRYHUZLWKED\RQHWILWWLQJ (GLQEXUJK &DVWHUYDVHVKDSHGVKRXOGHUZLWKDSSOLHGJLUGOHRQ (GLQEXUJK &DVWHUVVHWRIRQHEOLQGSODLQYDVHVKDSHGERG\ $VVD\HU$UFKLEDOG Ure (continued) (continued) James Ker James Edinburgh Dennistoun of 3, Arms of set Casters, p26 1990 October Apollo /33 1RWDYDLODEOH -DPHV.HU -DPHV.HU (GLQEXUJK (GLQEXUJK &DVWHURQO\WKHORZHUSDUW &DVWHUEDOXVWHUOREHGDQGULEEHG &KULVWL 'RXJDO*HG (GLQEXUJK &DVWHUVSDLUSODLQYDVHVKDSHGE $UFKLEDOG8UH (GLQEXUJK &DVWHUYDVHVKDSHGERG\ZLWK 1736/37 Dougal Ged Ged 1736/37 Dougal YEAR MAKER DESCRIPTION LOCATION SOURCE 1732 1732/33 Ker James -DPHV.HU Edinburgh details no 3, of set Casters, (GLQEXUJK &DVWHUVVHWRISLHUFHGWRSVò 1941 Magazine Connoisseur -DPHV.HU (GLQEXUJK 0XVWDUGFDVWHUVSDLUQRGHWDLOV 1 FD -RKQ5ROOR (GLQEXUJK &DVWHURFWDJRQDOEDOXVWHUIRUPZ 89 Compendium of Scottish Silver LOYHU Sothebys Gleneagles August 19, 19, August Gleneagles Sothebys 1996 #125 Lyon & Turnbull August 20, 20, August Turnbull & Lyon 2003 #199 Collection Murray The advertisement Bell John Sothebys January 29, 1970 #112 1970 29, January Sothebys #196 1970 23, July Sothebys vol I, p21 1941 p21 I, vol Christies South Kensington Kensington South Christies #325 1981 3, August Christies November 23, 1983 1983 23, November Christies #143 Scotland of Museums National 1898.248 Sothebys April 4-5 1982 4-5 April Sothebys Sothebys November 20, 1958 1958 20, November Sothebys Christies September 23, 1987 #5 1987 23, September Christies KW QPDUNHG´KW HHWò´KW DOWHUQDWHO\VFUROOHQJUDYHGDQGGLDSHUSLHUFHG´KWR]G ZLWKEDOXVWHUILQLDOERG\HQJUDYHGZLWKFUHVWDQGPRWWRó´ in alternating panels, 2 pierced and one engraved to match blind, urn finials, finials, urn blind, match to engraved one and pierced 2 panels, alternating in ´KWDQG´KWR]DOO cover with alternately pierced and scroll engraved panels, mm over struck, ò´KWR]G 7oz 7oz IOXWHIROLDJHDQGGLDSHUZRUNHQJUDYHGZLWKLQLWLDOVFRYHUX spreading base, blind cover, spirally fluted between bands of flat chased chased flat of bands between fluted spirally cover, blind base, spreading VKHOOVGLDSHUDQGRWKHUPRWLIVEHOOILQLDOó´KWR]G ODWHULGHQWLFDOFUHVWVSLHUFHGFRYHUVDFRUQILQLDOVRQULPI 11d 13oz Edinburgh Casters, set of 3, plain baluster bodies, on spreading feet, covers well pierced (GLQEXUJK 6HWRIFDVWHUVQRGHWDLOV +RZ¶V1RWHVRQ$QWLTXH6 Edinburgh Caster, vase shaped, chased with bands flower of clustersand shell motifs, Assayer Hugh Gordon Assayer Hugh Gordon (continued) (continued) 1746/47 Ebenezer Oliphant Oliphant 1746/47 Ebenezer 1748/49 James Gilliland Gilliland 1748/49 James 1746/47 1746/47 available Not available Gordon Hugh 1747/48 Not Edinburgh Edinburgh no details Caster, ht ¼" 7 Caster, 1947 v70 May Apollo p2 85 1967 vol February Apollo 1746/47 Oliphant Ebenezer 1746/47 Edinburgh Gordon Hugh no details Sugar castor, Edinburgh panels 6 with cover detachable foot, on spreading body, shaped vase Caster, p227 Hayden 1748/49 Gordon Hugh Edinburgh top unmarked foot, circular spreading on shape, pear inverted Sugar caster, 1745 ca 1745 ca Glen James Glasgow with chased cover domed form, baluster mustard, dry or pepper for Caster, 1745 ca 1745 ca Glen James Glasgow initials, above shoulder at molded shaped, pear inverted II, George Caster, YEAR MAKER DESCRIPTION LOCATION SOURCE 1745 ca ca 1745 Johnston Alexander Dundee with engraved bodies, shaped vase matching, almost II, George 2 Casters, 90 Casters, Dredgers and Pepper Pots D]LQH 0(4 #344 1986 24, June Christies Sothebys June 6, 1998 #177 1998 June 6, Sothebys #137 1989 9-11, May Sothebys +RZ¶V1RWHVRQ$QWLTXH6LOYHU 1941 p21, I, vol #111 1837 Edinburgh of How Christies June 20, 1973 #12 1973 20, June Christies 1974 #112 Connoisseur Magazine 1934 1934 Magazine Connoisseur 93 p347 vol Sothebys May 15, 1969 #4 1969 15, May Sothebys foot, cover pierced with circles, with a crest, details details Scotland of Museums National ZLWKDQRWKHUVPDOOHUHQVXLWH´KWR]ERWK ´KWR] covers pierced withtrellis or scrolling leaf panels below acorn finials,FDVWHUHQJUDYHGEXWEOLQG´KWR] one beneath a coronet, 21oz 21oz a coronet, beneath ò´KWR] crests andmottos, pierced and engraved covers, urn-shaped finials, on VSUHDGLQJEDVHVô´KWR]G Edinburgh Caster, on spreading circular foot,high domed cover with baluster finial, sold Edinburgh Edinburgh bodies, shaped pear plain, I, McKenzie James by be to said pair, Casters, Edinburgh Caster, mm in plainrectangle in scriptinitials, no details Jackson Marks p548 Edinburgh Edinburgh with girdles molded applied above engraved each shaped, vase pair, Casters, an engrailed engrailed an striking another striking rectangle James McKenzie or I James Mitchelson William Dempster Dempster William (continued) (continued) Assayer Hugh Gordon 1757/58 William Taylor over over Taylor 1757/58 William 1756/57 IM in in 1756/57 IM no Gilliland Muffineer, Edinburgh 1757/58 James 5REHUW*RUGRQ (GLQEXUJK &DVWHUQRGHWDLOV $QWLTXHV0DJ 1756/57 available Not Edinburgh struck, poorly mm decoration, floral and scroll chased later baluster, Caster, 1753/54 Gordon Hugh 1754/55 or Davie William Edinburgh form baluster a cruet, of 3, part of set Casters, 29, August Gleneagles Sothebys 1755/56 Gairdner Alexander Edinburgh motto and crest anchor an with engraved each form, 3, baluster of set Casters, YEAR MAKER DESCRIPTION LOCATION SOURCE 1749/50 Not available available 1748/49 1749/50 Not Gordon Robert Edinburgh details no Caster, 1994 London Walter William 1752/53 Dempster Ker & Edinburgh circular on shaped, pear Caster, 91 Compendium of Scottish Silver DO0XVHXPVRI6FRWODQG Nicholas Shaw Catalog Winter Winter Catalog Shaw Nicholas S Phillips Edinburgh August 24, 24, August Edinburgh Phillips 2001 #551 PhillipsEdinburgh November 27, 2000 #320 Sothebys April 10-11, 1978 1978 #87 10-11, April Sothebys #183 1967 4, February 1959 3, June Christies #67 1959 11, November Christies #135 1962 12, July Sothebys 1962 8, November Sothebys #149 AntiquesSimon Kaye Sothebys June 24, 1965 #33 1965 June 24, Sothebys Christies October 29, 1975 #131 1975 29, October Christies ´KW &KULVWLHV0DUFK foot, covered piercedwith flowers and IRRWó´KWR] GZLWKIROLDJHô ver with simple foliate piercing, urn finial, molded molded finial, urn piercing, foliate simple with ver òKWR] baluster finials, crest of double headed eagle and motto of Loudon, mm only, only, mm Loudon, of motto and headed eagle double of crest finials, baluster ò´KWR] ERUGHUV´KWR] ILQLDOVSUHDGLQJIRRW´KWR] FRURQHWDQGLQLWLDOV´KWR] ´KWR] URVHWWHVDQGVFUROOVEDOXVWHUILQLDOò´KWR] IROLDWHGHVLJQXUQILQLDOPROGHGULP ULPIRRWó´KWR] VFUROOVEHOOVKDSHGILQLDOò´KWR] Edinburgh Casters, pair, pear shaped, each on moldedEdinburgh foot, pierced cover, baluster finial, Caster, plain, vase shaped, circularmolded foot, pierced cover, baluster finial, Edinburgh Caster, vase shaped, on molded foot,Edinburgh cover pierced with spiral bands of Caster, vase shaped,reeded at waist, otherwise plain, cover pierceda in William Dempster Dempster William Dempster William Dempster William Dempster William FD -RKQ:HOVK (GLQEXUJK &DVWHULQYHUWHGSHDUVKDSHFKDVH FD /RWKLDQ 5REHUWVRQ (GLQEXUJK 6DQGHUQRGHWDLOV 1DWLRQ 1760/61 1760/61 Robertson Patrick Robertson Patrick Edinburgh Edinburgh details no Sugar caster, crest finial, of Hastings, vase shaped girdle, form, molded Caster, baluster 1996 London Bourdon-Smith J 1760 ca 1760 ca Gordon Hugh Edinburgh covers, dome pierced foot, spreading form, baluster pair, matched a Casters, 1758/59 WD probably probably 1758/59 WD probably 1758/59 WD probably 1758/59 WD probably 1758/59 WD 1758/59 Gordon Hugh Edinburgh reeded finial, baluster cover, domed detachable form, baluster Caster, 1758/59 Coutts Benjamin Edinburgh acorn below panels alternating in pierced cover borders, molded Caster, 1758/59 Coutts Benjamin Edinburgh co form, baluster Caster, YEAR MAKER DESCRIPTION 1758/59 LOCATION available Not Edinburgh circular on shaped, pear plain, Caster, SOURCE 92 Casters, Dredgers and Pepper Pots 2, 1991 1991 2, 1977 1977 tland August 23, 23, tland August R ecember 14, Christies January 17, 1977 #98 #98 17, 1977 January Christies &KULVWLHV0DUFK 6RWKHE\V-XQH Christies February 7, 1983 #208 #208 7, 1983 February Christies Christies July 27, 1977 #263 27, 1977 July Christies D Christies #129 Christies October 22, 1969 #50 1969 22, October Christies vol 27 #356 27 #356 vol #139 1996 #80 1996 #80 advertisement Bell John #54 1979 12, November #e8373 YHUSLHUFHGLQSDQHOVXUQILQLDO 6RWKHE\V+RSHWRXQ+RXVH DQGIROLDWHPRWLIVZLWKFUHVW´KW foot, chased with spiral flutes, applied on GFRYHUXUQILQLDOô´KWR] 6RWKHE\V0D\ QILQLDOERG\HQJUDYHGZLWKDFUHVWó´KWR] &KULVWLHV6F óKW 6RWKHE\V1<2FWREHU HUFRYHUZLWKDFRUQILQLDOVR]DOO 3KLOOLSV/RQGRQ$XJXVW ZLWKFUHVWRI0LWFKHOVRQ pierced and engraved with swirl panels featuring floral sprays, bell-shaped bell-shaped sprays, floral featuring panels swirl with engraved and pierced ILQLDOò´KWR]G EDOXVWHUILQLDOFRYHUXQPDUNHG´KWR] shoulder with reeded band, raised cover pierced with scrolling foliage, foliage, scrolling with pierced cover raised band, reeded with shoulder EDOXVWHUILQLDO´KWR]G R] 7D\ORU (GLQEXUJK &DVWHULQLWLDOVDERYHDJLUGOHGHWDFKDEOHFR 1766/67 Robertson Patrick Edinburgh engraved fluting, spiral with chased shape, pear 3, inverted of set Casters, 1766/67 Ker William Edinburgh cover foot, spreading on shoulder, at molded shape, pear inverted Caster, 1766/67 Robertson Patrick Edinburgh cover, dome pierced flutes, swirling with chased form, baluster Caster, 1765/66 1RWDYDLODEOH Robertson Patrick (GLQEXUJK 3DWULFN5REHUWVRQ Edinburgh &DVWHUUHHGHGDWZDLVWSLHUFH (GLQEXUJK no details Caster, &DVWHUFKDVHGUHSDLUHG #330 1988 October NY Christies 1766/67 Robertson Patrick Edinburgh spreading on shaped, vase Caster, FD $GDP*UDKDP *ODVJRZ &DVWHUFRYHUSLHUFHGZLWKIORZHUV 1760 ca 1760 ca Graham Adam 1761/62 William Glasgow 1762/63 available Not ht 8" Caster, /RWKLDQ 5REHUWVRQ Edinburgh (GLQEXUJKht ½" 7 top, pierced with baluster plain, Caster, &DVWHUVVHWRIEDOXVW 2006 London Antiques I. Frank p2 86 vol 1967 August Apollo YEAR MAKER DESCRIPTION LOCATION 3DWULFN5REHUWVRQ (GLQEXUJK &DVWHUEDOXVWHUIRUPDFRU SOURCE 93 Compendium of Scottish Silver U0DJD]LQH HXU0DJD]LQH Scottish Art Review vol VIII, VIII, vol Review Art Scottish 1961 p33 #2 advertisement Moffat Muirhead vol 112 p68 112 vol Collection Milne-Davidson Sothebys Gleneagles August 29, 29, August Gleneagles Sothebys MEQ 857 vol 90 p65 90 p65 vol KW 6FRWWLVK$UW$FDGHP\([KLELW UVFUROOKDQGOHôKW 6FRWWLVK$UW$FDGHP\([KLELW UVFUROOKDQGOHKW 6FRWWLVK$UW$FDGHP\([KLELW WKUHHGHGVKRXOGHUVDQGULPVGHWDFKDEOH century style style century Scotland of Museums National th , no details details no , Scotland of Museums National baluster covers covers pierced with wavy then foliate motifs, baluster finials, spreading spreading finials, baluster motifs, foliate then wavy with pierced covers GRPHGIHHW³KWô´KWR] (GLQEXUJK 'UHGJHUF\OLQGULFDOGRPHGFRYHUULQJKDQGOHó Edinburgh Casters, set of 3, one blind, baluster bodies chased withrestrained festoons, 2 (continued) (continued) William Dempster Dempster William DREDGERS 1795/96 1830/31 available Not Elder Adam Provincial no details Caster, Edinburgh in 18 caster Pierced p63 Hughes 1RWDYDLODEOH (GLQEXUJK &DVWHUVSDLUEDOXVWHUIRUPZL 1RWDYDLODEOH (GLQEXUJK 'UHGJHUZLWKKDQGOH &RQQRLVVHX -RKQ6HDWRXQ (GLQEXUJK 'UHGJHUF\OLQGULFDOGRPHGFRYH 1730 ca 1730 ca Hewitt Scott Patrick 1760/61 James Banff cove domed cylindrical, Dredger, YEAR MAKER DESCRIPTION 1766/67 LOCATION 1770/71 Ker and Gilliland or Davie William Edinburgh 3 of set Casters, SOURCE 2005 Collection Private 1775 ca 1775 ca Campbell & Milne Glasgow $OH[DQGHU*DLUGQHU (GLQEXUJK chased small, one large, 2, one of set Casters, &DVWHUVVHWRI 1992 London Bourdon-Smith J &RQQRLVV 1778/79 Cunningham Patrick Edinburgh caster Sugar 94 Casters, Dredgers and Pepper Pots H6ZDQ&ROOHFWLRQ Sothebys Gleneagles August 29, 29, August Gleneagles Sothebys 1983 #499 Christies February 17, 1977 #107 17, 1977 February Christies Ltd Lumley, Thomas Sothebys April NY USA 23, Sothebys Gleneagles September 1, 1981 #439 Sothebys Gleneagles August 29, 29, August Gleneagles Sothebys 1983 #498 &KULVWLHV6FRWODQG1RYHPEHU #112 1997 27, PhillipsEdinburgh October 22, &KULVWLHV1<86$2FWREHU 6RWKHE\V0DUFK Lyon & Turnbull Turnbull & Lyon August Collection The Murray #176 2003 28, Shaw Collection Collection Shaw 29, March Glasgow Christies 1983 #49 DORW ô´KWR] foot, rib about body andrim, FUHVWHGZLWKLQDFROODUFDWDORJFRQIXVLQJLQ QGULFDOFUHVWHGZLWKVFUROOKDQGOHDQG with molded edge to the joined body, on on body, joined the to edge molded with EO\FDWDORJGHVFULSWLRQFRQIXVLQJFUHVWHGZLWKD DORQPROGHGULPIRRWZLWKULQJKDQGOHUDLVHG PRWWRô´KWR] FRYHUSLHUFHGZLWKVFUROOVó´KWR] PROGHGERUGHUVIODWGHWDFKDEOHFRYHUZLWKWXUUHWGLVSHQVHU GHVFULSWLRQô´KWR] SLHUFHGEXQVKDSHGFRYHUEHOOVKDSHGILQLDOò´KWR] RYHUWKHLQLWLDO³9´´KWR] SLHUFHGDQGGHWDFKDEOHORZGRPHGFRYHU´KW VROGDVSDUWRI RQFLUFXODUIRRWó´KWR] VWHSSHGIRRW´KWR] WRSFUHVWRI/DWKRP´KWR] PEPPER POTS FD 1RWDYDLODEOH (GLQEXUJK 3HSSHUSRWQRGHWDLO 7KH0DSO -DPHV*LOOLODQG 3DWULFN5REHUWVRQ (GLQEXUJK (GLQEXUJK 3HSSHUER[6LU+RPH .LWFKHQSHSSHUSRWSUHVXPD &ULSSVS FD /RWKLDQ 5REHUWVRQ (GLQEXUJK .LWFKHQSHSSHUF\OLQGULF FD -DPHV:HOVK (GLQEXUJK .LWFKHQSHSSHUSRWPPRQO\F\OL FD -DPHV.HU (GLQEXUJK .LWFKHQSHSSHUSRWVFUROOKDQGOH 1741/42 Gordon Robert Edinburgh circular on shaped, vase plain, pot, Pepper 1740 ca 1740 ca Gilchrist William Edinburgh a fish of crest with engraved plain, cover, with circular only, mm pot, Spice 1730/31 Aytoun William Edinburgh form, pot, baluster Bun pepper 1730/31 Aytoun William Edinburgh partly girdle, applied base, molded circular on body, baluster pot, pepper Bun 1730/31 Aytoun William Edinburgh top, bun plain, otherwise girdle, molded with body baluster pot, pepper Bun 1730 ca 1730 ca Luke Robert Glasgow bun detachable girdle, foot, spreading on shaped, pear plain, caster, Pepper YEAR MAKER DESCRIPTION LOCATION SOURCE 95 Compendium of Scottish Silver September September V #227 1, 1981 1, 1981 #440 Sothebys Gleneagles August 29, 29, August Gleneagles Sothebys 1983 #496 31, January Glasgow Christies 1984 #165 Sothebys June 22, 1972 #21 1972 June 22, Sothebys 24, August Gleneagles Sothebys 1972 #20 OIRUPORRSKDQGOH 3KLOOLSV/RQGRQ0D\ ULFDOIRUPZLWKDORRSKDQGOHò´KWR] 6RWKHE\V*OHQHDJOH ZLWKSLHUFHGWKLPEOHOLNHWRSô´KWR] cover pierced and engraved with flowerheads and foliage, acorn finial, mm mm finial, acorn foliage, and flowerheads with engraved and pierced cover RYHUVWUXFNE\WKDWRI.HU´KWR] *ODVJRZH[KLELWLRQRIó´KWR] Edinburgh Edinburgh no details caster, Pepper Edinburgh domed high section, mid at molding reeded shape, vase plain caster, Pepper notes p548 Marks Jackson Ker another another 1785 ca I WM & Edinburgh McKenzie James and William cruet, probably Pepper 23, April 1993 #296 Sothebys 1775/76 1780/81 Robertson Patrick 1781/82 Taylor William Edinburgh Robertson Patrick no details pot, Pepper Edinburgh - :0F.HQ]LH Edinburgh details no pot, Pepper (GLQEXUJK no details pot, Pepper .LWFKHQSHSSHUSRWF\OLQGULFD Collection Swan Maple The Collection Swan Maple The Collection Swan Maple The 1761/62 William Taylor & & Taylor 1761/62 William $OH[DQGHU*DLUGQHU (GLQEXUJK .LWFKHQSHSSHUSRWF\OLQG 1766/67 striking Ker over 1760/61 1760/61 Robertson Patrick 1760/61 Dempster William Edinburgh 1760/61 Edinburgh Robertson & Lothian no details pot, Pepper Edinburgh 1760/61 Robertson details & no Lothian pot, Pepper Edinburgh no details pot, Pepper 1760/61 Dempster Ker & no details pot, Pepper 1761/62 available Not Edinburgh Clark John no details pot, Pepper Edinburgh no details pot, Pepper Edinburgh cover the on sleeve narrow handle, ring with cylindrical pot, pepper Kitchen Collection Swan Maple The Collection Swan Maple The Collection Swan Maple The Collection Swan Maple The Collection Swan Maple The Collection Swan Maple The YEAR MAKER DESCRIPTION 1760 ca LOCATION Hewitt James Edinburgh in the possibly handle, wire cover, bun borders, molded pepper, Kitchen SOURCE 96 Casters, Dredgers and Pepper Pots 1964-144 1964-144 Autumn 2005, #46, p19 #46, 2005, Autumn MEQ 442 Galleries 1817/18 1820 ca Fenwick George 1825/26 Cameron Alexander Edinburgh Dundee 1831/32 McKay James 1d ht, 2oz 3 3/8" vase-shaped, pot, Pepper 1890/91 Cunningham P & W no details pot, Pepper Edinburgh Edinburgh Kirkwood B. H. & R Edinburgh 2.4oz ht, 5/8" 3 castor, Pepper no details pot, Pepper 3.4oz ht, 2" casters, sand or pair, Pepperettes, Collection Private Catalog Bourdon-Smith J p99 2005 Catalog Shaw Nicholas Collection Swan Maple The Collection Swan Maple The YEAR MAKER DESCRIPTION 1790 ca LOCATION I Keay Robert Perth details no caster, Pepper SOURCE Scotland of Museums National 1800 ca 1800 ca 1800 ca I Keay Robert Howden Francis Perth Edinburgh no details pot, Pepper pot Pepper Art and Museums Dundee Collection Swan Maple The 97 Compendium of Scottish Silver 98 Church Silver ChurchCHURCH SILVER Silver Plate 12. A Communion Cup 1680s ca by William Lindsay for the Church of Montrose. Photograph courtesy of The Maple Swan Collection. 99 Compendium of Scottish Silver 100 Communion Cups CommunionCOMMUNION CUPS Cups Plate 13. A Communion Cup 1658ca by Edward Cleghorne I, Edinburgh, for St. Leonard’s Church, St. Andrew’s. Courtesy of The Maple Swan Collection 101 Compendium of Scottish Silver H.1996.206 Burns p260 Burns pp 293-294 Burns National Museums of Scotland National Museums L436.1 Finlay 1991 #23 Finlay 1991 Antiques Magazine vol 56 p272 Antiques rrie 1657", 6 ½" di6 ½" rrie 1657", Jackson Marks p408 8 ¼” htp269 Burns 5/8” ht pp 267-268 Burns Lady Marion Douglas, Kirk Session of Kirk Douglas, Marion Lady Kirk Session of Roseneath Holland p205 Session of Fogue Session #23 Finlay 1991 Session of Penpont, Session engraved "For the Kirk of Cu engraved "For the Kirk Kirk Session of Dalry, 7 3/16” Session Kirk ht7 ¾” ht of Cambuslang, Session Kirk p 263 Burns 268 p Burns Kirk Session of Carstairs, 7” ht of Carstairs, Session Kirk 266 p Burns rk Session of Kirkwall, 9 of Kirkwall, rk ½” Session ht pp 269-270 Burns Kirk Session of Fyvie, 7 Kirk Session Session of Fala and Soutra (which later merged) later (which Soutra Fala and of Session Arbirlot, 5 3/16” ht 3/16” 5 Arbirlot, CHURCH SILVER nburgh 7 ¾” htGlencairn, of Session Kirk pair, cups, Communion p276 Burns inburghpair, cups, Communion Edinburghof Dunfermline Session Kirk cup, Communion of Scotland National Museums Edinburgh Kirk of each Parish, name with the pair, one engraved cups, Communion Edinburgh by donated pair, beakers, Communion Edinburghpair, cups, Communion Edinburgh for the pair, cups, Communion Edinburgh Kirk the cup, for Communion wood Edinburghpair, Kirk cups, Communion ert Kirkwood Deacon George Crawford Deacon David Palmer Deacon Robert Dennistoun Assayer – David Heriot Deacon John Mosman Henry Thomson Cok I James Deacon COMMUNION CUPS 1617-191617-19 Gilbert Kirkwood1617-19 Gilbert Kirkwood Edinburgh1617-19 Gilbert Kirkwood Edi pair, cups, Communion 1617-19 Gilbert Kirkwood Edinburgh1617-19 Gilbert Kirkwood Ed pair, cups, Communion Gilbert Kirkwood Edinburgh Edinburgh Ki cups, Communion cup, Communion 1617-19 Gilbert Kirk 1615-17I George Robertson 1611-13 George Crawford 1608-10 Gilb 1596-1600 Hugh Lindsay 1585/86 John Mosman YEAR MAKER1563 dated LOCATION DESCRIPTION SOURCE 102 Communion Cups irk Session of Dumfries irk Session L.463 Burns p265 Scotland of National Museums L1979.9-10KJ htpp261-262 Burns of Middlebie, 7 13/16” ht of Middlebie, p266 Burns of Cawdor, 7 7/8” 7 of Cawdor, on of Penicuik p636 VI Appx Burns on of StraitonStraiton of Kirk Session of Ecclefechan of Ecclefechan Kirk Session session of Scotland National Museums Kirk Session of Dumfries K pair, Balmaghie parish church parish Balmaghie pair, #28 Finlay 1881 ps, pair, Kirk Session of Coulter Session Kirk pair, ps, 275 p Burns Edinburgh Sessi Kirk pair, cups, Communion Edinburgh Kirk cup, Currie Communion EdinburghKirk Session cups, Communion Edinburgh Sessi Kirk pair, cups, Communion Edinburgh Session Kirk pair, cups, Communion Edinburgh ht 7 7/16” Closeburn, of Session Kirk pair, cups, Communion Edinburgh 5 5/16” Session of Holywood, cup, pair, htKirk Communion Edinburghpair, cup, Communion p275 Burns p263 Burns Edinburgh Session pair, Kirk cups, Communion ert Kirkwood Deacon James Dennistoun Assayer – John Lindsay Deacon John Lindsay Deacon John Lindsay Deacon John Lindsay and Deacon Deacon John Lindsay Deacon John Lindsay Deacon John Lindsay 1619-21 Gilb 1617-19 I Cleghorne Thomas 1617-19 Thomson Thomas 1617-191617-19 George Crawford Gilbert Kirkwood Edinburgh Edinburgh Communionno details cup, cups, Communion Jacksonp541 Marks 1617-19 George Crawford 1617-191617-19I Robertson George Edinburgh Thomson Thomas cu Communion 1617-19 John Lindsay maker 1617-19I George Robertson 1617-19I George Robertson YEAR1617-19 MAKER George Crawford LOCATION DESCRIPTION SOURCE 103 Compendium of Scottish Silver Lord Kinnaird, nd and 2 and st )LQWU\3DULVK&KXUFK / %XUQVSS %XUQVS Burns pp 296-297 296-297 pp Burns Burns p196-197 p196-197 Burns St. Andrews 6LU7KRPDV+D\V p262 Burns %XUQVS KW %XUQVS U)LQWUD\3DULVK&KXUFKSRVVLEO\WKHHDUOLHVW I%HLWK´KW %XUQVS .LUN6HVVLRQRI,QYHUNHLWKQ\ó´KW %XUQVS RQRI,QYHUHVN´KW %XUQVSS DQGGDWHGZLWKGLIIHUHQW\HDUVDQG WKHFKXUFKODWHULQ.LUN6HVVLRQRI HVVLRQRI7\QURQ´KW %XUQVS HVVLRQRI,QFKWXUH DOHG³67+´DQG³'0+´IRUWKH+D\VXVHG IULDUV 1DWLRQDO0XVHXPVRI6FRWODQG SDLUVIRUWKH.LUN6HVVLRQ7RZQ&KXUFK FXODUDQGODWHUGRQDWHGWRWKHFKXUFKLQ knownmarked piece Aberdeen of silver, thepiece mis-ascribed in Jacksonto $OH[DQGHU5HLGRI(GLQEXUJK .LUN6HVVLRQRI&DUQZDUWK´KW Aberchirder .LUN6HVVLRQRI0HWKOLFN´KW both as a communion cup and a baptismal basin in successive generations of of generations successive in basin baptismal a and cup a communion as both WKH'DOU\PSOH+D\V ô´KW (GLQEXUJK &RPPXQLRQFXSVSDLU.LUN6HVVLRQRI%ODQW\UHó´ Deacon James James Deacon Dennistoun FDFD 7KRPDV.LUNZRRG (GLQEXUJK 7KRPDV&OHJKRUQH, (GLQEXUJK &RPPXQLRQFXSSUHVHQWHGLQ &RPPXQLRQFXSVSDLU*UH\ FD *LOEHUW.LUNZRRG :LOOLDP$QGHUVRQ (GLQEXUJK $EHUGHHQ &RPPXQLRQFXSVSDLU.LUN6 7KH)LQWUD\&RPPXQLRQ&XSIR *LOEHUW.LUNZRRG (GLQEXUJK &RPPXQLRQFXSVHQJUDYHG *HRUJH&UDZIRUG *LOEHUW.LUNZRRG (GLQEXUJK (GLQEXUJK &RPPXQLRQFXS.LUN6HVVLRQR &RPPXQLRQFXSSUHVHQWHGWR *LOEHUW.LUNZRRG (GLQEXUJK &RPPXQLRQFXSVSDLU.LUN6 *HRUJH5REHUWVRQ, (GLQEXUJK &RPPXQLRQEHDNHUILUVWVH *LOEHUW.LUNZRRG (GLQEXUJK 7KH'DOU\PSOH+D\&XSLQLWL *HRUJH&UDZIRUG *HRUJH5REHUWVRQ, (GLQEXUJK (GLQEXUJK &RPPXQLRQFXSV.LUN6HVVL &RPPXQLRQFXSVVHSDUDWH 1619-21 Gilbert Kirkwood Kirkwood YEAR MAKER DESCRIPTION 1619-21 Gilbert LOCATION SOURCE 104 Communion Cups FNVRQ0DUNVS XUQVSS 6RWKHE\V/RQGRQ-XQH W.LUN W %XUQVS ó´KW .LUN6HVVLRQRI3DLVOH\$EEH\ ó´KW %XUQVSS HZEDWO´RQEDOXVWHU EXUJK´KW -DFNVRQ0DUNVS RXWK/HLWK .LUN6HVVLRQRI6RXWK/HLWK I%HOKHYLH -DFNVRQ0DUNVS I,QYHUNHLWKQ\ó´KW %XUQVS LV.LUN6HVVLRQRI$UEXWKQRWò´KW %XUQVSS 6HVVLRQRI7ROOERRWK´KW %XUQVS UN6HVVLRQRI.HWWLQV -DFNVRQ0DUNVS VWHPDSODLQTXDWUHIRLOGLHVWDPSHGFROOHWDERYHWKHGRPHGIRR 6HVVLRQRI1HZEDWWOH´KWR] (GLQEXUJK &RPPXQLRQFXS.LUN6HVVLRQRI$EHUFKLUGHU´K (GLQEXUJK &RPPXQLRQFXSVHLWKHUDSDLURU.LUN6HVVLRQRI6 (GLQEXUJK &RPPXQLRQFXS.LUN6HVVLRQRI*UH\IULDUVó´KW(GLQEXUJK &RPPXQLRQFXSVSDLU.LUN6HVVLRQRI3DLVOH\$EEH\ % (GLQEXUJK &RPPXQLRQFXSHQJUDYHGDWWKHOLS³)RUWKH.LUNRI1 (GLQEXUJK &RPPXQLRQFXSVSDLU.LUN6HVVLRQRI3DLVOH\$EEH\ (GLQEXUJK &RPPXQLRQFXSVSDLU.LUN6HVVLRQRI&DQRQJDWH -D (GLQEXUJK &RPPXQLRQFXSVSDLU.LUN6HVVLRQRI6W*LOHV(GLQ Deacon Deacon George Crawford Deacon George Crawford Deacon Adam Lamb 'HDFRQ-RKQ6FRWW Adam Lamb Lamb Adam 'HDFRQ-RKQ6FRWW $FWLQJ'HDFRQ-RKQ )UDVHU $FWLQJ'HDFRQ-RKQ )UDVHU FD $OH[DQGHU/LQGVD\ 'XQGHH -RKQ6FRWW0DNHUDQG &RPPXQLRQFXSV.LUN6HVVLRQR 1633-35 Thomas Kirkwood Kirkwood YEAR MAKER DESCRIPTION 1633-35 Thomas LOCATION SOURCE 1633-35 Adam Lamb Lamb 1633-35 Adam Lamb 1635-37 Adam 7KRPDV.LUNZRRG (GLQEXUJK &RPPXQLRQFXS.LUN6HVVLRQR 1636 ca 1636 ca Lindsay Alexander Dundee Ki cups, Communion 1637-39 John Wardlaw Wardlaw 1637-39 John 1637-39 or or 1637-39 *HRUJH&UDZIRUG 3DWULFN%RUWKZLFN (GLQEXUJK (GLQEXUJK -RKQ6FRWW &RPPXQLRQFXSGDWHHQJUDYHG &RPPXQLRQFXSVSDLU.LUN -RKQ6FRWW 105 Compendium of Scottish Silver VHXPVRI6FRWODQG 6RWKHE\V-XQH 6RWKHE\V1RYHPEHU" KJ L1979.6-7 L1979.6-7 KJ .-/ Sothebys London November 30, 1972 #113 Phillips J S %XUQVS Sothebys London November 30, 1972 #114 Phillips J S %XUQVS ´KW WDOEDVHRQHRI %XUQVS R] 6RWKHE\V-XQH" .LUN6HVVLRQRI1HZEDWWOH KW -DFNVRQ0DUNVS GDWHG 1DWLRQDO0XVHXPVRI6FRWODQG RI.LQJKRUQ´ %XUQVSS ZHVW3DULVK 1DWLRQDO0XVHXPVRI6FRWODQG RPPXQLRQFXSVSDLU 1DWLRQDO0X FXSVPDGHIRUWKH.LUNRI1HZEDWWOH.LUN6HVVLRQRI1HZEDWWOH 17.7 oz ó´KW ó´KW (GLQEXUJK &RPPXQLRQFXSVSDLU.LUN6HVVLRQRI6RXWK/HLWK´ (GLQEXUJK &RPPXQLRQFXS.LUN6HVVLRQRI1HZEDWWOHò´KW (GLQEXUJK &RPPXQLRQFXS.LUN6HVVLRQRI1HZEDWWOH´KWR] (GLQEXUJK &RPPXQLRQFXSV.LUN6HVVLRQRI7ROOERRWK(GLQEXUJK Edinburgh Communion cups, pair of a set of 4 cups, Kirk Session of Haddington, Edinburgh Communion cups, pair of a set of 4 cups, Kirk Session of Haddington (GLQEXUJK &RPPXQLRQFXSEURDGERZONQRSSHGVWHPVWURQJSHGHV Acting John Deacon Fraser Deacon Adam Lamb Deacon Adam Lamb Acting John Deacon Fraser 1LFRO7URWWHU (GLQEXUJK &RPPXQLRQFXSVSDLU1RUWKZHVW3DULVK Deacon Adam Lamb Deacon Adam Lamb Deacon Adam Lamb 1640-42 Scott John YEAR MAKER DESCRIPTION LOCATION -RKQ6FRWW (GLQEXUJK &RPPXQLRQFXSVSDLU.LUN6HVVLRQ SOURCE 1644-46 Thomas Cleghorne Cleghorne 1644-46 Thomas $QGUHZ'HQQLVWRXQ 1640-42 Nicoll Trotter Trotter 1640-42 Nicoll 3DWULFN%RUWKZLFN (GLQEXUJK &RPPXQLRQFXSVSDLU1RUWK 1643 dated -RKQ:DUGODZ 3DWULFN%RUWKZLFN (GLQEXUJK & 3DWULFN%RUWKZLFN Cleghorne 1644-46 George 106 Communion Cups UQVS 1RYD6FRWLD0XVHXPYRO 6SULQJS³7KH 2FFDVLRQDO´ H.1992.1890 H.1992.1890 Burns p276 p276 Burns p164 0XVHXPRI)LQH$UW%RVWRQ86$ JWRXQH %XUQVS %XUQVS FXSVHQJUDYHGZLWKWKHGDWH´KW FKDW.HDUQ´LQVFULEHGRQWKHEDVHSDUWRI VVLRQRI.HLU´KW %XUQVS 6HVVLRQRI%LJJDUò´KW %XUQVSS pair, Walston church church Walston pair, Scotland of Museums National WKHFRPPXQLRQSODWHDW.HDUQ$EHUGHHQVKLUH´KW Kirk Session of Carsphairn Carsphairn of Kirk Session ´ó´KW´GLULP KH[DJRQDOVKDSHGVWHPHQJUDYHGRQERZO³)RUWKH.LUNHRI+DGLQ (GLQEXUJK &RPPXQLRQFXS.LUN6HVVLRQRI'DOPHOOLQJWRQô´KW (GLQEXUJK &RPPXQLRQFXSV.LUN6HVVLRQRI'DONHLWKò´KW Edinburgh Communion Dunbar cups, Kirk Session of (GLQEXUJK &RPPXQLRQFXS.LUN6HVVLRQRI'DONHLWKò´KW Jackson Marks p542 %X Edinburgh Edinburgh rim, of edge exterior around ermine resembling band cup, Communion Borthwick Borthwick Deacon George Cleghorne Robert Gibson Gibson Robert James Deacon )DLUEDLUQ John Wardlaw James Deacon )DLUEDLUQ Deacon James James Deacon )DLUEDLUQ Deacon Adam Lamb Adam Deacon Lamb 1649-50 Thomas Scott Scott 1649-50 Thomas RU 1657-59 1657 ca -DPHV6\PRQWRXQ (GLQEXUJK II Robertson George Edinburgh &RPPXQLRQFXSVSDLU.LUN6H cups, Communion RU 1657-59 3DWULFN%RUWKZLFN FD $OH[DQGHU6FRWW 7KRPDV0RQFXU (GLQEXUJK (GLQEXUJK &RPPXQLRQEHDNHUVSDLU.LUN &RPPXQLRQEHDNHU³)RUWKH&KXU YEAR MAKER DESCRIPTION 1645/46 LOCATION 1645 ca Borthwick Patrick Borthwick Patrick Edinburgh Edinburgh pair cups, Communion pairs 2 cups, Communion SOURCE Brett p124 96 vol 1972 November Apollo 1645 ca Patrick -RKQ6FRWW (GLQEXUJK &RPPXQLRQFXSVSDLU&DUVSKDLUQ 107 Compendium of Scottish Silver Burns p401 of Kirk Alvah Session Burns pp280-281 Museum Christies Scotland November 19- Christies Scotland November 20, 1986 #298 s, 9 1/8” ht pp 197-198 Burns a band of and dart, egg ar, dated 1657, 8 ar, dated 1/8” ht Burns p226 rk Cup Collection Swan The Maple the Town Church, St. Andrew St. Church, Town the Linlithgow, 8 3/8” ht Burns pp 237-238 t. Leonard’s Kirk 1659”, Kirk Session of St. t. Leonard’s Kirk 1659”, Session rk Session of Kilspindie of rk Session Perth City Art Gallery and deep bowl, foot chased with deep r, with the arms of the donor George Trotter of Trotter George donor of the with the arms r, , pair, Kirk Session of Dalgety, 7” htDalgety, of Session Kirk pair, , p215 Burns union cups, 4, Kirk Session of union Dunb cups, ommunion cup, the St. Leonard’s Ki Leonard’s St. cup, the ommunion listed under quaichs, 6 3/8” ht 6 3/8” quaichs, listed under Charterhall, Kirk Session of Fogo, 8 15/16” of Fogo, ht Kirk Session Charterhall, baluster stem, inscribed “S stem, inscribed baluster 13oz Andrews, 7 5/8” ht, Edinburgh Communion cup, (not entirely clear that it’s a communion cup) Glasgow Exhibition1911 Edinburgh of Wemysscup, Kirk Session Communion of Wemyss Kirk Session Edinburgh also be may Alvah, of Session Kirk cup, a Communion as used Quaich Edinburghof Kirk Session cup, Communion Edinburgh ht 8 1/16” Abercorn, of Session Kirk cup, Communion p225 Burns Edinburgh cup, plain Communion Deacon James Symontoun Deacon James Symontoun Deacon Patrick Borthwick Alexander Scott Alexander Deacon Edward Cleghorne I Deacon James Fairbairn Deacon James Deacon Fairbairn 1665-67 Andrew Law I 1665-67 Andrew Law I 1663-84I Edward Cleghorne 1663-65 or 1663-65 or 1671-73 1679-81 1661-63 Patrick Borthwick Edinburghpai cups, Communion 1659-61I Edward Cleghorne 1659-611660 caI Cleghorne Edward Edinburgh Gairdyne Robert ht7 7/8” of Bo’ness, Session Kirk cup, Communion Dundeepair, Ki cups, Communion p226 Burns 1657-59 John Wardlaw Edinburgh Comm 1658/59 Edward CleghorneI Edinburgh C 1659I Edward Cleghorne 1657-59 Scott Alexander Edinburgh of cup, Kirk Session Communion YEAR1657-59 MAKERI Edward Cleghorne Edinburgh cups Communion LOCATION DESCRIPTION SOURCE 108 Communion Cups illustrated opposite rns pp278-279 Burns pp316-317 Burns p287 Burns pp314-316 Burns p298-299 Kirk Session of Auctherderran Kirk Session Burns p227, p216 Burns pp 220-221 Burns Kirk Session of Arbroath Kirk Session Burns p228 of Aberlady, 73, arms of the 73, arms geour of Bowhill, assumed, Kirk Session Kirk assumed, 670, Deacon’s mark obscured by a obscured 670, Deacon’s mark dated 1671, note Rolland was not free not was dated 1671, note Rolland of Glencorse Bu uselee,of Mid-Calder, Session Bt., Kirk 673, Kirk Session of North Leith, of North Kirk Session 673, scription dated 1677, mm only, Kirk dated 1677, mm scription n inscription dated 17 the donor David Scrym the donor David ifferent maker, Kirk Session of Kennoway, 9 5/8” Kirk Session ht ifferent maker, r, presented in 1676 but made earlier, Kirk Session Kirk earlier, in 1676 but made presented r, 4, Kirk Session of Session of Cupar4, Kirk p635 Appx. VI, Burns on cups, pair, mm only so date only so pair, mm on cups, on cups, pair, presentatio on cups, union cups, pair, Kirk Session Session pair, Kirk union cups, munion cups, pair, donation in cups, munion munion cup, inscription dated 1 cup, inscription dated munion Session of Kilwinning, 7” ht Session of Kilwinning, 9 ¾” ht 9 ¾” until 1675 so possibly a d possibly a until 1675 so of Arbroath, 5 ¼” ht 5 ¼” Arbroath, of Kirk Session of Auctherderran Kirk Session 7 7/8” ht repair, Kirk Session of Saltoun Kirk repair, Session beakers below beakers donor Sir William Purves of Woodho Purves William donor Sir 7 7/16” ht rgh of pair, arms cups, Communion rgh cup, presentation Communion date of 1 dinburgh only, inscription cup, mm Communion Edinburgh ht13/16” 9 of Lingformacus, Session Kirk cup, Communion p286 Burns Edinburgh as 1674-76 be same may Note: Arbroath, of Session Kirk cup , Communion Deacon Alexander Reid Deacon Alexander Reid 1675-77 Law William Edinburgh Com 1675-77 Law William Edinburgh Communi 1675ca George Rolland E 1674-76 Scott Alexander Edinburgh pai beakers, Communion 1674-76 Alexander Reid Edinbu 1674/75 Cockburn James 1671-73 Law William Edinburgh Com 1669-71 William Law Edinbu 1667-691667dated Scott Alexander Lindsay Thomas II1669-71 Edinburgh Dundee Scott Alexander cups, Communion CommunionVigeans cup, St Jackson1989 Marksp599 YEAR1665-67 MAKER Law William Edinburgh LOCATION DESCRIPTION Comm SOURCE 1665-67 Law William Edinburgh Communi 109 Compendium of Scottish Silver RQ0DUNVS UQVS Burns pp287-288 pp287-288 Burns %XUQVS p228 Burns *DOOHULHV 6RWKHE\V$SULO %XUQVS The Maple Swan Collection Burns p286 p286 Burns R]G ´KW ´KW KW %XUQVSS Q -DFNVRQ0DUNVS HVVLRQRI6W/HRQDUG¶V´KW %XUQVS N6HVVLRQRI%DQII -DFNVRQ0DUNVS SWLRQGDWHGZKHQWKHEHDNHUZDV 5HYHUHQG7KRPDV0HOYLOOHRQFHSDULVK upper knop lightly engraved with engraved lightly knop upper HQJUDYHGZLWKVXQLQVSOHQGRUDERYH QVFULSWLRQGDWHG.LUN6HVVLRQRI 'XQGHH0XVHXPVDQG$UW HVVLRQRI'XGGLQJVWRQ -DFNVRQ0DUNVS ped, Kirk Session of Culle of Session Kirk ped, mmunion cup,The Chalice of St. Broach CommunionCup, engraved band PLQLVWHUDQGEHDULQJKLVDUPV.LUN6HVVLRQRI.LQJODVVLH /DPEHUWó´KW UHIDVKLRQHGIURPDQHDUOLHUYHVVHO.LUN6HVVLRQRI*DPULH double knopped stem, circular foot, URXQGHOVORZHUNQRWFKHGPDUNV±5*ODPERI6W$QGUHZ´KW of inscriptions near top with decoration, engraved panels below on bowl bowl on below panels engraved decoration, with top near inscriptions of LQVFULSWLRQGDWHG.LUN6HVVLRQRI0XLUDYRQVLGHó´KW (GLQEXUJK &RPPXQLRQFXS.LUN6HVVLRQRI%DOPHULQRó´KW %X (GLQEXUJK &RPPXQLRQFXSVSDLU.LUN6HVVLRQRI%DOOLQJU\ó´ Maker and Deacon Deacon and Maker Deacon Alexander Reid :LOOLDP/DZ (GLQEXUJK &RPPXQLRQFXSVGRQDWHGE\WKH 0DULRQ&OHJKRUQH (GLQEXUJK &RPPXQLRQFXSVSDLU.LUN6 FDFD 0LFKDHO=LHJOHUFD :LOOLDP6FRWW, &DQRQJDWH 5REHUW*DLUGLQHFD %DQII 7KH)OLVN&RPPXQLRQ&XS 'XQGHH :LOOLDP6FRWW, &RPPXQLRQFXSEHDNHUVKDSHG.LU %DQII &RPPXQLRQFXSVSDLUQRGHWDLOV &RPPXQLRQFXSEHDNHUVKD -DFNV FD -DPHV3HQPDQ (GLQEXUJK &RPPXQLRQFXSVSDLUGRQDWLRQL FD :LOOLDP/DZ (GLQEXUJK &RPPXQLRQEHDNHUPPRQO\LQVFUL FD $QGUHZ/DZ :LOOLDP/LQGVD\-UFD 0RQWURVH (GLQEXUJK 5REHUW*DLUG\QH &RPPXQLRQFXSJLIWHG'LUN6 &R 3HUWK &RPPXQLRQFXSIODUHGERZOODWHU 1677-79 Alexander Reid Reid 1677-79 Alexander 1677-79 William Law Law 1677-79 William YEAR MAKER DESCRIPTION 1676 ca LOCATION Reid Alexander Edinburgh presentation readable, mm the only with altered cups pair, cups, Communion SOURCE 110 Communion Cups Burns p319 p319 Burns %XUQVSS ,/ Burns p289 p289 Burns Burns p317 p317 Burns %XUQVSS %XUQVS Burn p322 Burn p322 ´KW JODVRI5D\QLHLQDQGSRVVLEO\ QRI 111 Compendium of Scottish Silver Finlay 1991 p55 Finlay 1991 of Scotland National Museums IL2003.47.9 Burns p279-280 Burns pp330-331 Aberdeen Museums and Aberdeen Museums ABDAG011115 Galleries Clayton Christies Book p183 Clayton Christies Book #16 1984 7, July Christies Glasgow Aberdeen City Art Gallery and Aberdeen City Art Museum UK Private Collection Burns pp221-222 Burns pp299-300 Burns p231 86 indicated, Kirk 86 indicated, lded foot, Kirk Session of Session foot, Kirk lded e use of the church in the of the church use e fray, datedfray, Edinburgh of How t only year of 16 only year of t ple, 6 11/16” htple, 6 11/16” p544 Jackson Marks 1688”, for the Leslie church the 1688”, for (Note: this may be the same or a mate to or a mate same be the (Note: this may ker form with flared rims, finely engraved with finely engraved rims, with flared ker form beaker form, applied mo beaker form, Session of Dunblane, 6 13/16” ht 6 13/16” Session of Dunblane, p 543 Marks Jackson Kirk Session of Benholm, 7 7/8” ht 7 7/8” of Benholm, Session Kirk p322 Burns Kirk Session of Redgorton, 8 ½” ht 8 of Redgorton, Session Kirk p320 Burns the Kirk Session Kirk of Sproutonthe Session Jackson Marks p 543 Kirk Session of Bothkennar Session Kirk p544 Marks Jackson ps, pair, Kirk Session of Innerpef Session Kirk pair, ps, beakers, pair, each engraved “…for th “…for engraved each pair, beakers, munion cup, Montrose church, munion the Roman Catholic Church the Roman Eucharist by William Watson, Leslie, Eucharist the prior Lindsay cup) the prior Lindsay vine leaves and bunches of grapes, inscribed “the blood…1688” , Kirk blood…1688” “the inscribed grapes, of bunches and vine leaves Session of Leslie Session of Cockpen, 6 ¾” ht 6 ¾” of Cockpen, Session Drumblade, 6 3/16” ht 6 3/16” Drumblade, rgh of Tem cup, Kirk Communion Session inburghpresen date letter not cup, Communion 1689/901689/90 Cockburn James Scott William 1690/91 Edinburgh Cockburn James pair, cups, Communion Edinbu Edinburgh cups, Communion 1688/89 Zaccharias Mellinus Edinburghof Mass in for the celebration used chalice, The Forsyth Chalice, Communion 1688 Penman James Edinburgh Communion 16871687/88 Gairdyne Robert 1687/88 Cockburn James Perth1688 ca Penman James Edinburgh Lindsay William cu Communion for cups, Communion Edinburgh Edinburghpair, cups, Communion Com 1686/87 Penman James Edinburgh bea pair, cups, Communion 1686/87 Cockburn James Ed YEAR1686/87 MAKER Penman James Edinburgh LOCATIONKirk Cups, Communion DESCRIPTION SOURCE 1686/87 Penman James Edinburgh pair, beakers, Communion 112 Communion Cups DAG0011129 on on DAG0011129 Burns p334 p334 Burns Burns pp279-280 pp279-280 Burns AB Galleries loan fromthe Kirk Session of the DeerParish New of Burns Appx, VI, p630 p630 VI, Appx, Burns L.1987.8 Burns 330 330 Burns Burns Appx VI, p630 p630 VI, Appx Burns Burns p245 p245 Burns eceding yearthe for EHUFRUQ´KW %XUQVS QRI.LUULHPXLU´KW -DFNVRQ0DUNVS %RWKNHQQDU´KW -DFNVRQ0DUNVS ISDLUV.LUN6HVVLRQRI+DZLFN´KW %XUQVS SDLUV.LUN6HVVLRQRI+DZLFN´KW %XUQVS "For the North East Paroche" Paroche" East North the "For Scotland of Museums National SIRU%RUWKZLFNô´KW -DFNVRQ0DUNVS same church the by same maker, Kirk Session of Prestonkirk the same church by the same maker, Kirk Session of Prestonkirk Prestonkirk of Session Kirk maker, same the by church same the 6HVVLRQRI/DVVZDGH´KW 1694 Walker George Aberdeen -DPHV3HQPDQ Auchreddy of Church the 4, from of set beakers, Communion $OH[DQGHU)RUEHV (GLQEXUJK (GLQEXUJK &RPPXQLRQFXS.LUN6HVVLRQRI$ &RPPXQLRQFXSVSDLURQHFX and Museums Aberdeen 1693/94 Forbes Alexander Edinburgh -RKQ6HDWRXQ engraved Kirk, College Trinity (GLQEXUJK &RPPXQLRQFXSSDLU.LUN6HVVLR 1693/94 Inglis Robert Edinburgh pr the made pair the match these pair, cups, Communion 5REHUW,QJOLV (GLQEXUJK &RPPXQLRQFXSV.LUN6HVVLRQRI 1692/93 Inglis Robert Edinburgh for year following the made pair the matches pair this pair, cups, Communion 1692/93 5REHUW,QJOLV Inglis Robert (GLQEXUJK Edinburgh &RPPXQLRQFXSVSDLUVPDOOHUR stem, Kirk knopped round with form goblet 4, of set cups, Communion YEAR MAKER DESCRIPTION 1691 ca LOCATION 1691/92 Walker George 1691/92 Law James Aberdeen Cockburn James Monymusk of Session Kirk cups, Communion 5REHUW,QJOLV Edinburgh Edinburgh Hays of gift Crawford Falkland for of cup, Session Communion Kirk pair, cups, Communion (GLQEXUJK &RPPXQLRQFXSVSDLUODUJHURI SOURCE 1989 Marks Jackson p635 VI, Appx Burns p149 Cripps 113 Compendium of Scottish Silver ackson Marks p568 ackson Marks Burns p245 Burns pp331-332 Finlay 1991 #55 Finlay 1991 of Scotland National Museums L1987.7 MEQ Burns p327 National Museums of Scotland National Museums KJ 318 Cripps p149 Burns pp423-325 /16” htp325 Burns Session of Hamilton J Renfrewp568 Marks Jackson Strathblanep568 Marks Jackson Kirkp544 Jackson Marks ith broad round-knopped stem, Kirk stem, round-knopped broad ith of Gargunnock, 8 5 Bolton parish, East Lothian, dated 1696 dated East Lothian, parish, Bolton p367 Burns Session of Pittinain, 8 ¼” ht of Pittinain, Session p331 Burns 13/16”, Cleghorne Session 29, 1696, Kirk 13/16”, Cleghorne paid June Kirk Session of Tynninghame now Whitekirk, of Tynninghame Session Kirk Kirk of FintrySession Jackson Marks p583 Kirk Session of Longside Kirk Session Marks Jackson aneford, 8” ht aneford, , Kirk Session of Dalserf , Kirk Session p544 Marks Jackson from Trinity College from cup, engraved with the date 1697, Kirk 1697, date cup, engraved with the on cups, pair, Kirk Session of Session Kirk pair, on cups, union cups, pair, for the for the pair, union cups, union cups, pair, Kirk Session of Session Kirk pair, union cups, munion cups, pair, goblet form w goblet form pair, cups, munion Session of Athelst 9 5/16” ht of Prestonpans of inburgh Session pair, Kirk cups, Communion Edinburgh8 ¼” htDunning, Session of pair, Kirk cups, Communion pp325-326 Burns Edinburgh pair, Kirk cups, Communion and Assayer George ZieglerGeorge Canongate Comm 1701/02 George Scott Ed 1701/02 Luke John Glasgow Communi 1699/1700 Brock Robert 1700 ca1700/01Walker George Glasgow McKenzie Colin 1701/02 Aberdeen Comm Edinburgh Maker Penman James cups, Communion cups Communion 1699/1700 Inglis Robert Edinburgh Com 1698/99 Ker Thomas Edinburgh cup Communion 1696/971697 ca Robert Brock1697/98Walker George Glasgow Ker Thomas Aberdeen Communion cups, Communion Edinburghpair, cups, Communion 1696 ca1696 Cockburn James dated YEAR1695/96 MAKER Cleghorne Thomas Edinburgh 9 pair, cups, Communion LOCATION DESCRIPTION SOURCE 114 Communion Cups Burns p332 Galleries ABDAG001037 acquired1974 in Metropolitan Museum of Art, Metropolitan Museum USA NY ht Burns pp247-248 8 13/16” ht Burns pp332-333 agow, 10 1/16” s, Kirk Session of West Linton of Session Kirk s, West Linton of Kirk Session Rhynd, 9 5/8” Rhynd, ht Burns pp362-363 on of Mertoun, 8 7/16” ht 8 7/16” on of Mertoun, p328 Burns Pittenweem Cripps p149 of Carlaverock, 7 3/8” ht, 23.7oz ht, 7 3/8” of Carlaverock, Collection, Untermeyer d stem separated by a curved over hood, Kirk hood, over by a curved separated d stem of West St. Giles, 8 5/16” Edinburgh, ht p241 Burns rk Session of Clackmannan, of Clackmannan, rk Session Kirk Session of Anworth, 9 3/16” ht Session of Anworth, Kirk p363 Burns Kirk Session of New North Kirk of New Kirk Session Cripps p149 North Kirk of New Kirk Session Cripps p149 cups, pair, Kirk Session of Lesmah Session pair, Kirk cups, cup, Kirk Session of cup, Kirk Session on cups, pair, Kirk Session of Session pair, Kirk on cups, union cups, pair, Kirk Session of Fossoway, 9 1/8” ht9 of Fossoway, Session pair, Kirk union cups, p248 Burns union cups, pair, foot an foot pair, union cups, Session of Carmichael, 9 7/16” ht 9 of Carmichael, Session Edinburgh Sessi Kirk pair, cups, Communion Edinburghno details cup, Communion p167 Untemeyer III Assayer – James Penman 1704/051704/05 Law William Bruce Robert Edinburgh Edinburgh Comm pair, cups Communion 1704/05 Kincaid Alexander Edinburgh Comm 1704/05 Ker Thomas Edinburghpair, Ki cups, Communion 1703/04Walker George Aberdeen Nigg Churchfor the pair, beakers, Communion and Museums Aberdeen 1703/04 Cleghorne Thomas YEAR1701/02 MAKER Cleghorne Thomas 1701/02 Scott George LOCATION DESCRIPTION Edinburgh cup, Communion SOURCE 1702/03 Ker Thomas 1702/031702 Seatoun James Edinburgh1702/03 Session Kirk cups, Communion Dunlop David 1703/04 Edinburgh Robert Bruce1703/04I W Communion Canongate1703/04 Edinburgh Scott George of Burn correction cup, maker Communion 1703/04 Inglis Robert Communi Robert Inglis Edinburgh Edinburgh Edinburgh cup, Communion KirkNorth New of Session Kirk cup, Communion Edinburgh Session Kirk cup, Communion Communion p149 Cripps 115 Compendium of Scottish Silver Burns p335 p335 Burns Burns p336 p336 Burns p355 Burns Burns pp336-337 pp336-337 Burns p336 Burns %XUQVS Burns pp 333-334 333-334 pp Burns p636 VI Appx Burns W 0LFKDHOV'XPIULHV´KW &ULSSVS PHV*XWKULH,URQJUD\FKXUFKó´KW &ULSSVS 0RUD\VKLUH &ULSSVS W&\UXV´KW %XUQVSS RQRI0RQLPDLO´KW %XUQVSS LRQRI.LUNOLVWRQò´KW %XUQVSS LRQRI:KLWHNLUN´KW %XUQVS LRQRI%DOIURQô´KW %XUQVS QFKXUFK´KW &ULSSVS WHG´.LUN6HVVLRQRI%URXJKWRQ -DFNVRQ0DUNVS n by retiring minister Reverend Tomas Wilkie, Wilkie, Tomas Reverend minister retiring n by HQJUDYHGGDWH.LUN6HVVLRQRI/DG\ 116 Communion Cups September 20, September 1984 #171 istence probable Phillips Edinburgh 1985 #240 Phillips April 18, SothebysOctober 31, 1974 #145 Burns p358 Burns pp231-232 Burns pp 225-2226 1911 Glasgow Exhibition ht Burns pp256-257 16” htpp358-359 Burns e Parish in 1711, Kirk Session of 1711, Kirk Session e Parish in cross motif within a sunburst, cross motif engraved “Bought for the Kirk the “Bought for engraved ryton, Montroseryton, p545 Marks Jackson of Westruther, 9 3/ of Galashiels, 8 7/16” location unknown Ex Kirk Session of Kirk CorstorphineSession Cripps p149 Kirk Session of Legerwood, 9 ¼” ht 9 of Legerwood, Session Kirk p149 Cripps Kirk Session of Errol, 8 5/16” ht8 of Errol, Session Kirk p256 Burns r, Kirk Session of Dirlton, 9 1/8” ht9 Dirlton, of Session Kirk r, 1/8” ht9 of Maybole, Session Kirk r, p363 Burns p364 Burns e for Borthwick, no details Borthwick, e for p545 Marks Jackson Kirk Session of Beath, 8 ¼” ht Beath, of Session Kirk p256 Burns ps, one for Penninghamone for ps, p545 Marks Jackson cups, 4, Kirk Session of Rothesay Session of , 11 3/8” Rothesay 4, Kirk htcups, p359 Appx VI p636 Burns and on cups, pair, cups acquired by th pair, cups acquired on cups, union cups, pair, bell shaped body, bell shaped pair, union cups, munion chalice, probably originally a Communion cup, bell shaped, cup, a Communion originally chalice, probably munion munion cups, Kirk Session of Kirk Ma Session cups, munion mmunion cups, pair, sources and cups, mmunion probably later engraved with “HIS” and a “HIS” with probably later engraved 18.6oz Session of Direlton 1720”, 9” ht, 35.6oz 1720”, 9” ht, of Direlton Session Leuchars rghSession Kirk cups pair, Communion ll Edinburgh Session pair, Kirk cups, Communion 1719/20 Henry Bethune Edinburgh Com 1718/191719/20 Robert Inglis Yorstoun Mungo Edinbu Edinburgh Comm 1717/18 Seatoun John 1717/181717/18 Inglis Robert Edinburgh1717/18 Inglis Robert pair, cups, Communion Patrick Turnbu Edinburgh Edinburgh cup, Communion pair, cups, Communion 1710/111710/11 McKenzie Colin 1711/12 Mitchelson James Edinburgh1713/14 Patrick Turnbull Edinburghpai cups, 1714/15 Communion Kincaid Alexander on cups, Edinburgh Communion 1714/15 McKenzie Colin Edinburgh cu Communion Yorstoun Mungo 1717/18 Communion Edinburgh Edinburgh Patrick Turnbullpai cups, Communion Com Edinburghpair, cups, Communion 1710/11 Ged William Edinburgh Communi YEAR1710 ca MAKERDunlop David Canongate LOCATION DESCRIPTION Co SOURCE 117 Compendium of Scottish Silver tland tland R ,S SVS 2QORDQWRWKH'XQGHH0XVHXP / 6RWKHE\V*OHQHDJOHV$XJXVW 6LOYHU/\RQ/WG 3ULYDWH&ROOHFWLRQ8.0XVHXP %XUQVS %XUQVS %XUQVSLOOXVWUDWHGRSSRVLWH 3 %RQKDPV$XJXVW R] HRI&XOSKLQ UVKDSHGERZOVWUXPSHWVKDSHG 0RQH\GLH %XUQV$SS[9,S KWHUOHVV -DFNVRQ0DUNVS .LUN6HVVLRQRI)RUWHYLRW´KW %XUQVSDQG$SS[9 LRQRI.HOVRô´KW %XUQVSS I.LQQDLUG -DFNVRQ0DUNVS I'XQGHH -DFNVRQ0DUNVS ODWHUFRYHUVIURP/RUG'RXQHKW 1DWLRQDO0XVHXPVRI6F GWRWKH3DULVKE\5HYHUHQG'DQLHOV0F.D\ WRWKH.LQQDLUGFXSVE\WKHVDPHPDNHURQH foot rim, gently flaring body, engraved with <($118$/5(1762)0257,),&$7,216/()7%<7+('21$725 727+,6%85*+´ stems with centralknops, spreading domed feet, flaredrims, engraved below IODUHGOLSVZLWK³*,9(1%<-2+11,&2/621:5,7(5,1('1572 7+(.,5.2))255(66$112$1'5(3$,5'a$112%< \HDUHDUOLHU.LUN6HVVLRQRI'DQ]LHO´KW LQ.LUN6HVVLRQRI-HGEXUJK´KW LQVFULSWLRQ³'HGLFDWHGWRWKH&KXUFKRI%R\QGLHE\-DPHV2JLOYL ´PDUNVPP;¶VKHDUWVKDSHGSXQFK%$1))ô´KW (GLQEXUJK &RPPXQLRQFXSV.LUN6HVVLRQRI$\UGDWHG &ULS 'DYLG0LWFKHOO (GLQEXUJK &RPPXQLRQFXSVSDLU.LUN6HVVLRQRI 6LPRQ0F.HQ]LH ,QYHUQHVV 7KH)RUUHV&RPPXQLRQFXSVSDLUEHDNH &KDUOHV'LFNVRQ 1725/26 or or 1725/26 24/25 FD $OH[DQGHU6PLWK 'XQGHH &RPPXQLRQFXS.LUN6HVVLRQR FD 3DWULFN*RUGRQ +HQU\%HWKXQH %DQII (GLQEXUJK &RPPXQLRQFXS.LUN6HVVLRQRI$XF &RPPXQLRQFXSVSDLUGDWHG +HQU\%HWKXQH (GLQEXUJK &RPPXQLRQFKDOLFHVSDLUZLWK 1724 dated &ROLQ&DPSEHOO (GLQEXUJK &RPPXQLRQFXSVSDLUVLPLODU &KDUOHV'XQFDQRU &ROLQ&DPSEHOO (GLQEXUJK &RPPXQLRQFXSV.LUN6HVVLRQR +HQU\%HWKXQH &KDUOHV'XQFDQ (GLQEXUJK (GLQEXUJK &RPPXQLRQFXSVSDLU.LUN6HVV &RPPXQLRQFXSVSDLUSUHVHQWH YEAR MAKER DESCRIPTION 1720/21 LOCATION 1720 ca Inglis James Scott Patrick Edinburgh Banff Peraitland of Session Kirk cups, Communion molded Beaker, Communion SOURCE p546 Marks Jackson 118 Communion Cups Glasgow Exhibition 1911 vol I, I, vol 1911 Exhibition Glasgow p103 #14 Burns p340 p340 Burns Burns pp339-340 pp339-340 Burns Burns p359 p359 Burns 6W$QGUHZ¶V&KXUFKRI6FRWODQG Golspie and Art Galleries 1074-1040 1074-1040 Galleries and Art foot R] WLVPPD\KDYH , 28plus oz oz 28plus , pp257-258 Burns LRQRI'ROSKLQWRQó´KW %XUQVS VVLRQRI0RUHEDWWOH´KW Charles Blair in 1730 1730 in Blair Charles Edinburgh, Kirk Session of Melrose PDNHU¶VIDWKHUZDVWKH&OHUNRIWKLVFKXUFKDWWKHWLPHVRQHSR IDFWRUHGLQWRWKLVFRQWUDFW.LUN6HVVLRQRI)DONLUN´KW with flanged base, of that is spool shaped crest stem, coronet, and broadmotto plain crest, knop, with plain engraved bucket lip, shaped everted bowl, &RXQWHVVRI6XWKHUODQGPDUNV0.FRQMRLQHG,162´KW Glasgow Glasgow Dumbarton of Session Kirk pair, cups, Communion p569 Marks Jackson Edinburgh Edinburgh Easter church, Anstruther cup, Communion p150 Cripps Glasgow Glasgow Douglas of Session Kirk pair cups, Communion p569 Marks Jackson Bilsings Bilsings Edmonstoun Edmonstoun Bilsings Bilsings (continued) (continued) 1731 ca 1731 ca 1731 ca Forbes Alexander Johan Got-helf- Aberdeen Marycoulter of Session Kirk cups, Communion Marksp583 Jackson 1730/31 Blair Charles Edinburgh by remade and 1655 in made originally Morebattle, for cups Communion 1728/29 Alexander 1728/29 Alexander 1729/30 1RWDYDLODEOH 1730 ca Blair Charles (GLQEXUJK Anderson James Edinburgh &RPPXQLRQFXSVSDLU.LUN6HVV Edinburgh Se Kirk pair, cups, Communion in career a short had maker but obliterated letter date 4, cups, Communion 1728 ca 1728 ca Johan Got-helf- 1728/29 Anderson James Edinburgh girdle, bowls, bell-shaped inverted rims, flared pair, cups, Communion YEAR MAKER DESCRIPTION LOCATION SOURCE 1727 ca 1727 ca 1727 ca Walker John 1727/28 Walker John 1728 ca Bethune Henry Aberdeen Aberdeen McKenzie Simon Alford of Session Kirk cups, Communion Edinburgh Inverness Dyke of Session Kirk cups, Communion no details cup, Communion circular domed on each Cups, Sutherland The pair, cups, Communion p583 Marks Jackson p583 Marks Jackson p546 Marks Jackson 119 Compendium of Scottish Silver Burns pp340-342 pp340-342 Burns On loan to the Museums Dundee DQG$UW*DOOHULHV p343 Burns Burns pp 342-343 342-343 pp Burns pp254-255 Burns Cripps p150 pp343-344 Burns p361 Burns Burns p547 p547 Burns Burns p360 p360 Burns &ULSSVS ´KW &ULSSVS RQ\&KXUFK*ODVJRZ -DFNVRQ0DUNVS RI&ULFKWRQ´KW &ULSSVS QRI'XQLQR´KW %XUQVSS HVVLRQRI)RZOLV:HVWHU´KW %XUQVSS 0RQWURVH´KW Dundee Communion Dundee cups, Kirk Session of Jackson Marks p600 (GLQEXUJK &RPPXQLRQFXSVSDLU.LUN6HVVLRQRI$XFKLQOHFN (GLQEXUJK &RPPXQLRQFXS.LUN6HVVLRQRI1HZEXUJK´KW Charles Duncan Duncan Charles $VVD\HU±$OH[DQGHU Ure Assayer Dougal Ged 1733 or I Dickson Charles 1733/34 Mitchelson James Ker 1733/34 Edinburgh 1733/34 James Mitchelson James and Harray Birsy of Session Kirk cup, Communion Edinburgh Panbride of Session Kirk cup, Communion p547 Marks Jackson p150 Cripps 1733/34 FD Aytoun William 5REHUW/XNH Edinburgh .HQQHWK0F.HQ]LH Kilrinney of Session Kirk cup, Communion (GLQEXUJK1735/36 +XJK3HQPDQ *ODVJRZ &RPPXQLRQFXSVSDLU.LUN6 Rollo John 1736/37 &RPPXQLRQFXSV.LUN6HVVLRQRI%DU (GLQEXUJK Penman Hugh &RPPXQLRQFXSVSDLU.LUN6HVVLR Edinburgh 1741/42 Edinburgh Stow of Parish the for cups, Communion Aytoun William Kinross of Session Kirk cup, Communion p150 Cripps p547 Marks Jackson p547 Marks Jackson YEAR MAKER DESCRIPTION 1731/32 LOCATION Gordon Hugh Edinburgh Kilsyth of Session Kirk cup, Communion SOURCE p547 Marks Jackson -DPHV7DLW (GLQEXUJK &RPPXQLRQFXSVSDLU.LUN6HVVLRQ 1732/33 Ker James Edinburgh of Session Kirk cups, earlier from refashioned pair, cups, Communion 120 Communion Cups '$* SSVS .- .- .- *DOOHULHV$% %XUQVS &ULSSVS %XUQVSS &ULSSVS %XUQVS %XUQVS %XUQVS ô´KW %XUQVS LQQRFN3DULVK&KXUFK 1DWLRQDO0XVHXPVRI6FRWODQG ULVKFKXUFK 1DWLRQDO0XVHXPVRI6FRWODQG RI7RQJXH´KW %XUQVS RI$XOGHDUQ´KW -DFNVRQ0DUNVS DUPVRI0DQILHOG.LUN6HVVLRQRI5XWKZHOO I2DWKODZ .LUN6HVVLRQRI2DWKODZ RI.LUNFXGEULJKW´KW -DFNVRQ0DUNVS LRQVD\VERXJKWLQ.LUN6HVVLRQRI HQWR6W&OHPHQW¶V&KXUFKLQ $EHUGHHQ0XVHXPVDQG UVKRRODQSDULVKFKXUFK 1DWLRQDO0XVHXPVRI6FRWODQG .LUN6HVVLRQRI7KH7URQó´KW %XUQVSS ò´KW .HPEDFN´KW (GLQEXUJK &RPPXQLRQFXSVSDLU.LUN6HVVLRQRI2OG&XPQRFN (GLQEXUJK &RPPXQLRQFXSV.LUN6HVVLRQRI$OORDó´KW &UL -DPHV0LWFKHOVRQRU -DPHV0F.HQ]LH, $VVD\HU±'RXJDO Ged -DPHV*OHQ *ODVJRZ &RPPXQLRQFXSVSDLU/RFKZLQQRFNSD 5REHUW/RZ /RWKLDQ 5REHUWVRQ (GLQEXUJK ,0LQDUHFWDQJOH (GLQEXUJK &RPPXQLRQFXSVSDLURU &RPPXQLRQFXSVSDLU.LUN6HVVLRQ -DPHV*OHQ *ODVJRZ &RPPXQLRQFXSVSDLUGDWHG/RFNZ $OH[DQGHU&DPSEHOO (GLQEXUJK &RPPXQLRQFXSVSDLU(QYH FD -DPHV$EHUFURPELH $EHUGHHQ &RPPXQLRQEHDNHUVSDLUJLY (GZDUG/RWKLDQ (GLQEXUJK 5REHUW*RUGRQ &RPPXQLRQFXSVIRUWKH3DULVK (GLQEXUJK &RPPXQLRQFXSVSDLUZLWKWKH (GZDUG/RWKLDQ (GLQEXUJK &RPPXQLRQFXSVSDLULQVFULSW 1741/42 Lawrence Oliphant Oliphant YEAR MAKER DESCRIPTION 1741/42 Lawrence LOCATION SOURCE FD $OH[DQGHU-RKQVWRQ 'XQGHH 5REHUW*RUGRQ &RPPXQLRQFXS.LUN6HVVLRQR (GLQEXUJK &RPPXQLRQFXSVIRUWKH3DULVK 121 Compendium of Scottish Silver G 1974-1044 1974-1044 National Museums of Scotland Scotland of Museums National 1975.267-268 218-219 KJ 6RWKHE\V6FRQH3DODFH$SULO 1979 #89 3ULYDWH&ROOHFWLRQ Breadalbane Collection Sale Sale Collection Breadalbane 1935 #363 + Galleries Christies May 14, 1963 #53 14, 1963 May Christies PHV*LOOLODQG LDWH&RQJUHJDWLRQ+DZLFN /LEHUVWRQ -DFNVRQ0DUNVS UJH¶V7URQ3DULVKFKXUFK*ODVJRZ 1DWLRQDO0XVHXPVRI6FRWODQ 3DXO VDQG6W*HRUJH V(SLVFRSDO&KXUFK N6HVVLRQRI1HZ$EEH\ô´KW %XUQVS ecclesiastical inscriptions removed, baluster stems, Edinburgh ERZOVVOLJKWO\FDXONHGDQGIODUHGKWR]GZW FLUFXODUEDVHVó´KWR]ERWK ZLWKPROGHGULEDQGUHHGHGULPHQJUDYHG³$VVRF ´VDLGWREHPDGHE\-*DLUGQHUEXWPRUHOLNHO\HLWKHU-D RU$OH[DQGHU*DLUGQHU.LUN6HVVLRQRI+DZLFNó´KW Edinburgh Communion cup, on circular molded foot, with knopped stem, broad bowl Alexander Gairdner Lothian & Robertson Robertson & Lothian Edinburgh Murries of Session Kirk inscription, Latin with pair, cups, Communion p348 Burns 1765 ca 1765 ca Wildgoose James $OH[DQGHU*DLUGQHU Aberdeen (GLQEXUJK Aberdeen in Church East cups, Communion &RPPXQLRQFXSVIURP6W p588 Marks Jackson 1760/61 Aitcheson Alexander Edinburgh 1762/63 -RKQ:HOVK Langton of Session Kirk cup, Communion 1763 Gilliland James 1763/64 (GLQEXUJK Edinburgh Craw William Gairdner Alexander &RPPXQLRQFXSVIRUWKH3DULVKRI Gordon of Session Kirk cup, Communion Edinburgh Canongate pair, cups, Communion Auchtertoul of parish cups, Communion p150 Cripps p150 Cripps p954 Marks Jackson 1760 ca 1760 ca Warnock David Glasgow and stems baluster tapering lips, everted slightly 4, of set cups, Communion 1760 ca 1760 ca or Gilliland James 1759/60 1760 ca Gilliland James Steven John Edinburgh Lesmahagow of Session Kirk pair, cups, Communion Dundee no details cup, Communion p247 Burns Art and Museums Dundee /RWKLDQ 5REHUWVRQ (GLQEXUJK &RPPXQLRQFXSVSDLU.LU YEAR MAKER DESCRIPTION or 1758-59 59-60 LOCATION SOURCE FD 'DYLG:DUQRFN *ODVJRZ &RPPXQLRQFXSVSDLU)RU6W*HR 122 Communion Cups DAG008611 DAG008611 DAG008613 DAG008613 DAG011114 DAG011114 DAG011113 DAG011113 1974-449 1974-449 UGHHQ0XVHXPVDQG 6FRWWLVK$UW5HYLHZYRO9,, p37 #2 advertisement Bell John Scotland of Museums National 221-222 KJ AB Galleries Scotland of Museums National 225-226 KJ Galleries AB Galleries Galleries Aberdeen Museumsand AB Galleries One beaker fromthe group on loan to Aberdeen Museumsand AB Galleries &OHPHQW¶V&KXUFK $EHUGHHQ0XVHXPVDQG ULEHG³5HOLHI&KXUFK&DPSEHOO¶V6WUHHW´ ó´KWR] Edinburgh Edinburgh Machar Edinburgh Communion cups, pair from St. Paul's and St. George's Episcopal church, $EHUGHHQ &RPPXQLRQEHDNHUVSDLUIURP6W&OHPHQW¶V&KXUFKEdinburgh Communion cups, pair from St. Paul's and St. George's Episcopal Church, $EH Edinburgh Edinburgh Lanark of Parish the for cups, Communion p549 Marks Jackson & Sons Probably George Son & Booth Crichton William Dempster Dempster William 1796/97 1797/98 Christie George Cunningham 1799/1800 Cunningham P & W Edinburgh Cunningham P & W Edinburgh 1811/12 Patrick Edinburgh Fortingall of Session Kirk pair, cups, Communion Tullieallan of Session Kirk cup, Communion Dunlop and Symington of Session Kirk cups, Communion 1841 3HWHU/DPEHUW S & GB $EHUGHHQ p549 Marks Jackson p549 Marks Jackson &RPPXQLRQEHDNHUVSDLUIURP6W 1880/81 p549 Marks Jackson Michael & George 1877 available Not Dundee Church Parish Clements St. for pair, cups, Communion Art and Museums Dundee 1773/74 or Davie William FD : 3&XQQLQJKDP, (GLQEXUJK &RPPXQLRQFXSVSDLULQVF YEAR MAKER DESCRIPTION 1770 ca LOCATION Gordon James Aberdeen Machar New of Session Kirk cups, Communion SOURCE p583 Marks Jackson 1770 ca 1770 ca Coline Allan Aberdeen New NS Thompson, Alexander by church the to given beaker, Communion 123 Compendium of Scottish Silver f Scotland UNVS Huntley House Museum, Huntley House HH894/33 Edinburgh .- KJ 224 KJ Royal Ontario Museum, Toronto Toronto Museum, Ontario Royal &DQDGDDE &KULVWLHV1RYHPEHU Finlay 1991 #25 1991 Finlay 3HUWK&LW\$UW*DOOHU\DQG Museum National Museums of Scotland Scotland of Museums National L.1987.9 Jackson Marks p543 L.455.11-12 OLG-RKQ3HDUV+XWWRQ XUFK(GLQEXUJK 1DWLRQDO0XVHXPVRI6FRWODQG -gilt, St. Mary's Episcopal Church, England England Church, Episcopal Mary's St. -gilt, o Museums National EDQGDURXQGFHQWHUHQJUDYHG³6W3HWHU¶V JIHHWFKDVHGZLWKOHDIVFUROOV 6-3KLOOLSV,QF/RQGRQ lid, with flower finial, double scrollhandle, domed foot, with 6lobes belowJDGURRQHGNQRS´KWô´GLEDVH a notlikely to have beenthe maker since he was only 18the at time, ´KW &KDSHO0RQWURVH´ô´KWR] (GLQEXUJK )ODJRQIURP6W3DXO VDQG6W*HRUJH V(SLVFRSDO&K (GLQEXUJK )ODJRQFKDVHGFKHUXEVRQWKHERG\FKHUXEVRQWKH (GLQEXUJK %DSWLVPDOEDVLQIRU6W-RKQ¶V.LUN3HUWK -DFNVRQ0D Edinburgh Edinburgh Kirk College Trinity basin, Baptismal #26 1991 Finlay Crichton LAVERS AND Also carries marks S & CR Charles Robb & Sons Deacon William Cok Cok William Deacon Deacon George Crawford FLAGONS BASINS 1877/78 Sons & Marshall Edinburgh *HRUJH 0LFKDHO silver pair, flagons, Communion -RKQ3HDUV+XWWRQ 1835/36 McKay James Edinburgh domed spout, everted and raised necks, slender with shaped urn pair, Flagons, 1592/93 David Gilbert Gilbert 1592/93 David 1633-35 Thomas Kirkwood Kirkwood 1633-35 Thomas *HRUJH&UDZIRUG (GLQEXUJK /DYHUVVHWRIRQVSUHDGLQ 1724/25 Bethune Henry *LOOLODQG .HU Edinburgh ht 11" Doune, Lord from pair, flagons, Communion (GLQEXUJK )ODJRQVF\OLQGULFDOPROGHG Scotland of Museums National 1684/85 Law John Edinburgh details no Flagon, 1911 Exhibition Glasgow YEAR MAKER DESCRIPTION LOCATION SOURCE 124 Communion Cups vate Collection UK ational Museums of Scotland ational Museums Burns p528 Burns p526 L.1987.10 Trinity College Kirk Trinity College Burns p525 IL.2001.66.6 Burns p520 Burns p523 Burns p518 Burns p531 L.1989.9 same as the one dated attle, laver 10” ht, basin attle, laver 10” ht, St Cutbert’s Edinburgh , laver , Edinburgh St Cutbert’s of Canongate, laver 9 ¼” ht, basin 9 ¼” ht, laver of Canongate, scription from Sir Alexander Erskine Sir Alexander from scription laver and basin, donated by Mary donated laver and basin, s Edinburgh , laver 12” ht, basin 17” di 12” ht, , laver s Edinburgh on of The Tron, said to be by Andrew be said to of The Tron, on of Kingsbarns, laver 9 5/16” ht, basin 5/16” ht, 9 laver Kingsbarns, of Meigle, Perthshire Pri llege Kirkllege of Scotland National Museums ity College Kirk, possibly ity College Kirk, possibly tional Museums of Scotland, but misdated but Scotland, of tional Museums North Leithp543 Jackson Marks and basin, Kirk and basin, Session of Newb er, Holyrood er, of Scotland National Museums mal laver and basin, Kirk Session of Kirk Session basin, laver and mal Forgue Communion BasinForgue Communion Forgue Parish of aptismal laver and basin, Baptismal Baptismal basin, laver and aptismal aptismal laver and basin, donation in basin, laver and aptismal Baptismal laver from Trin Baptismal laver Erskine, Kirk Session of West St Gile West St of Kirk Session Erskine, of Cambo dated 1705, Kirk Session Session Kirk 1705, dated Cambo of di 15” 1696/97 and in the Na the and in 1696/97 8 13/16” ht, basin 13 ¼” di 13 ¼” basin ht, 13/16” 8 Law either the later date, or by a different maker or by a different date, later the Law either 15” di 15” 15 13/16” di 15 13/16” hfor basin Baptismal hKirk Session basin, laver and Baptismal rgh Trinity Co laver from Baptismal rghGreyfriars basin, Baptismal N I Edinburgh laver Baptismal rn Edinburgh of parish for the basin Laver and Jorgensen Canongate The AL mm EdinburghKirk Sessi basin, laver and Baptismal 1707 ca Walter Scott Edinburghburn Incense 1707/08 Yorstoun Mungo Edinburgh B 1704/05 Yorstoun Mungo Edinburgh B 1701/02 Walter Scott Edinburgh 1700/01 George Scott Edinburgh Baptis 1693/941696/97 Cockbu James Walter Scott Edinbu 1682/83 or 1682/83 1694/95 1681 dated Edward Cleghorne 1674 dated Edward Cleghorne I Edinburg 1665-67 Law William Edinburg YEAR1643 dated Nicholas MAKER1649 ca Andrew Burrell LOCATION Edinbu DESCRIPTION SOURCE 125 Compendium of Scottish Silver Burns pp528-529 pp528-529 Burns IL.2003.66.5 IL.2003.66.5 Jackson Marks p545 ò´GL PROGHGJLUGOH.LUN6HVVLRQRI%RWKZHOOODYHUô´KWEDVLQ tt Edinburgh Greyfriars Laver, Baptismal Scotland of Museums National 1775/76 Oliphant Ebenezer Edinburgh Kirkcaldy of Parish basin, Baptismal p547 Marks Jackson 1712/13 1756/57 Duncan Charles Gordon Robert Edinburgh Crail of Session Kirk basin, and laver Baptismal Edinburgh handle, scroll capped leaf and lid no with laver basin, and laver Baptismal p528 Burns 1707/08 Walter Sco YEAR MAKER DESCRIPTION 1707/08 Walter LOCATION SOURCE 126 Patens PatensPATENS Plate 14. A Communion Paten 1650ca by Edward Cleghorne I, Edinburgh Courtesy of The Maple Swan Collection 127 Compendium of Scottish Silver 6ZDQ&ROOHFWLRQ 6RWKHE\V0D\ 6RWKHE\V-XQH 1DWLRQDO0XVHXPVRI6FRWODQG .- .- .- .- XUJK 1DWLRQDO0XVHXPVRI6FRWODQG XUJK 1DWLRQDO0XVHXPVRI6FRWODQG FK(GLQEXUJK 1DWLRQDO0XVHXPVRI6FRWODQG SSHGFRYHUZRRGILQLDORQPROGHGIRRW KDSHGIHHWPDUNV±PP($;¶VWKLVWOH± DJHVXEVHTXHQWUHSDLU %RQKDPV6FRWWLVK6DOH$XJXVW SLVFRSDO&KXUFKDW0RQWURVVHQJUDYHGLQWKH DOLFH )LQOD\ SDWHQIURP6W3DXO VDQG6W*HRUJH V(SLVFRSDO&KXUFK(GLQE SDWHQIURP6W3DXO VDQG6W*HRUJH V(SLVFRSDO&KXUFK(GLQE st nd ò´GL ò´GLR]G center (GLQEXUJK 3DWHQIURP6W3DXO VDQG6W*HRUJH V(SLVFRSDO&KXU (GLQEXUJK :HHPV (GLQEXUJK Weems & Sons PATENS -DPHV FD $OH[DQGHU-RKQVWRQ 'XQGHH 3DWHQZLWKVRPHDSSDUHQWGDP FD (GZDUG&OHJKRUQH, (GLQEXUJKFD =DFFKDULDV0HOOLQXV (GLQEXUJK &RPPXQLRQSDWHQ 5REHUW/XNH 3DWHQIRUWKH)RUV\WK&K *ODVJRZ 3HGHVWDOERZODQGFRYHUSODLQVWH 7KH0DSOH 3DWULFN&XQQLQJKDP FD 1RWFOHDU 3URYLQFLDO 3DWHQSODLQVWHSSHGULPVSRROV -DPHV *LOOLODQGDQG.HU (GLQEXUJK 2EORQJSDWHQ6W3HWHU V( YEAR MAKER DESCRIPTION LOCATION SOURCE 128 Communion Plates CommunionCOMMUNION PLATES Plates Plate 15. The Cruden Communion Bread Plate, inscribed 1691 for the church at Cruden Bay by GW, Aberdeen/ Courtesy of The Maple Swan Collection 129 Compendium of Scottish Silver .LUN6HVVLRQRI1RUWK/HLWK -DFNVRQ0DUNVS / 7KH0DSOH6ZDQ&ROOHFWLRQ Burns p224 p224 Burns + &HQWXU\SODWH 1DWLRQDO0XVHXPVRI6FRWODQG th DQ ò´GL )LQOD\ URRQHGERUGHURQULPLQVFULSWLRQLQ IXV&KXUFK0RUD\VKLUH 1DWLRQDO0XVHXPVRI6FRWODQG 1RUWK/HLWKPLVWDNHQO\DVFULEHGWR&KDUOHV 'LFNVRQ, center $EHUGHHQ $OPVSODWH6W3DXO V&KXUFK$EHUGHHQUHZRUNHGIURP (GLQEXUJK %UHDGSODWHVSDLUIRU7ULQLW\&KXUFK(GLQEXUJK DPLHVRQ 6RQV CHURCH PLATE Deacon George Crawford *HRUJH- YEAR MAKER DESCRIPTION LOCATION SOURCE 1633 ca 1633 ca Kirkwood Thomas &KDUOHV'XQFDQ (GLQEXUJK %UHDGSODWHVIRUWKHSDULVKRI *HRUJH5REHUWVRQ, (GLQEXUJK &RPPXQLRQEUHDGSODWH'XI FD *: $EHUGHHQ %UHDGSODWHRI&UXGHQWD]]DOLNHZLWKJDG 130 Coffeepots and Chocolate Pots CoffeeCOFFEEPOTS Pots Plate 16. A Coffeepot 1759/60 by William Taylor, Edinburgh Courtesy of J H Bourdon-Smith, London. 131 Compendium of Scottish Silver 1956 1956 ecember 19, Bonham September 26, 1975 1975 26, September Bonham #654 #133 1963 10, January Sothebys AntiquesSimon Kaye November #257 1966 17, Scotland of Museums National 1980.69 1340 MEQ Christies D Christies +RZ¶V1RWHVRQ$QWLTXH6LOYHU p23 I, 1941 vol 1939 Magazine Connoisseur p 107-09 and Collection How advertisement advertisement 17 vol Apollo Sothebys October 22, 1970 #213 #213 1970 22, October Sothebys Antiques Magazine October 1949 1949 October Magazine Antiques 56 vol Exhibit Academy Art Scottish 1939 #895 Collection Binning Lady #73 1991 Finlay Scotland of Museums National MEQ 899 The Maxwell, & Dalgleish 29 Fig Craft, 1987 Lovable RXWZRRGHQ offee service, pot of octagonal tapering form, form, tapering octagonal of pot service, offee al, matted, fluted top, fluted spout, ball finial, finial, ball spout, fluted top, fluted matted, al, ece c ZLWKDFUHVW´KW IROLDJHRQOHJVZLWKOLRQ¶VPDVNVSDZIHHWSODLQFXUYHGVS with engraved finial, button and bun lid, domed stepped handle, scroll Ardsheal, of or Appin, of for Steuart possibly motto, below crest unicorn 32oz 10 ½" ht, 25oz 10d gross wt wt gross 10d 25oz ht, ½" 10 long faceted curved spoutlater withhandle, capped wooden beak, scroll on octagonal double finial, molded baluster lid, rim foot, domed faceted PRQRJUDP³65´ handle, crest and motto, arms of Baillie, with a cream jug jug cream a with Baillie, of arms motto, and crest handle, COFFEEPOTS AND CHOCOLATE POTS POTS AND CHOCOLATE COFFEEPOTS Edinburgh Edinburgh and flowers scrolls, with below and above chased form, baluster pot, Coffee COFFEEPOTS 1740/41 James Ker 1740/41 James 1741/42 Aytoun William Edinburgh motifs, scroll and shells with chased body, cylindrical tapering pot, Coffee 1731/32 Kincaid Alexander Edinburgh cylindric plain, Coffeepot, 1718/19 1720/21 Bethune Henry Aytoun William Edinburgh Edinburgh cover domed octagonal, Coffeepot, 3 pi a of part Coffeepot, #21 1906 15, March Christies 1713/14 McKenzie Colin Edinburgh wooden spout, curved cover, domed octagonal, tapering, plain, Coffeepot, YEAR MAKER DESCRIPTION LOCATION SOURCE 132 Coffeepots and Chocolate Pots NVS Finlay 1991 #82 1991 Finlay &KULVWLHV1RYHPEHU 0DU\&RRNH$QWLTXHV$SULO Christies September 28, 1994 28, September Christies Christies May 16, 1979 #84 #84 16, 1979 May Christies Knightsbridge, Bonhams )HEUXDU\ 20, August London Sothebys 1995 #159 28, August Gleneagles Sothebys 1995 #159 6RWKHE\V/RQGRQ-XO\ #175 6RWKHE\V-DQXDU\ p586 advertisement Bell ò´KWR] ] ô´KW foot, with curved spout, G³&´VFUROOERUGHU FRQGLWLRQQRGHWDLOV +RZRI(GLQEXUJK U.LQFDLGEXWZLWKQRGHFRUDWLRQ no details details no #219 1985 February NY Sothebys , woodenhandle, tuckedin base, bell finial 10 ¾" ht, 25oz 10 ¾" ht, 5d 25oz FKDVLQJDURXQGWKHQHFNDQGEDVHDUWLFKRNHILQLDO´KWR hinged domed lid, baluster finial, chased with bands of fruit, scrolls, scale scale scrolls, fruit, of bands with chased finial, baluster lid, domed hinged ZRUNURFRFRRUQDPHQWDWLRQZLWKDPRQRJUDP´KWR] spreadingrim foot, stepped domed lid, baluster finial,long plain taperingJHQWO\FXUYLQJVSRXWó´KWR] R]G slightly domed hinged lid, spout capped with dolphin/sea monster, monster, dolphin/sea with capped spout lid, hinged domed slightly WHUPLQDWLQJLQVFUROOZRUNRQVSUHDGFLUFXODUEDVHFRQHILQLDO floral band at the neck and rococo ornament around handle sockets, curved VSRXWWHUPLQDWLQJLQJURWHVTXHGROSKLQPDVNSLQHDSSOHILQLDO Edinburgh Edinburgh floral and foliate for except plain body, cylindrical tapering Coffeepot, Edinburgh Edinburgh on plain, Drummond, by and pot chocolate a be to stated Coffeepot, (GLQEXUJK &RIIHHSRWSODLQWDSHULQJIRUPFKDVHGZLWKIORUDODQ Edinburgh a chased for except plain base, in tucked body, cylindrical tapered Coffeepot, 3UREDEO\-DPHV+LOO William Dempster or or Dempster William Davie William $VVD\HU+XJK Gordon $VVD\HU+XJK Gordon -+ (GZDUG/RWKLDQ (GLQEXUJK &RIIHHSRWVLPLODUWR$OH[DQGH 1744/45 WD 5REHUW+RSH (GLQEXUJK &RIIHHSRWQRGHWDLOV -DFNVRQ0DU 1749/50 Ebenezer Oliphant Oliphant 1749/50 Ebenezer (GZDUG/RWKLDQ (GLQEXUJK &RIIHHSRWH[FHOOHQWPDUNVDQG Oliphant 1749/50 Ebenezer 1749/50 Oliphant Ebenezer Edinburgh finial, pineapple scrolls, and flowers chased spout, head bird's Coffeepot, YEAR MAKER DESCRIPTION 1741/42 LOCATION Lothian Edward Edinburgh no details Coffeepot, SOURCE 95 vol 1969 Magazine Antiques 1741/42 Edward Lothian Coffeepot Edinburgh 1741/42 Edward 1741/42 Oliphant Ebenezer Edinburgh rim molded on body, cylindrical tapering Coffeepot, 133 Compendium of Scottish Silver Sothebys November 28, 1963 1963 28, November Sothebys #105 1994 #292 Antiques Magazine 1954 vol 89 vol 1954 Magazine Antiques #171 1964 24, January Christies Christies October 27, 1971 #172 1971 27, October Christies I Vol 1911 Exhibition Glasgow p109 #36 Collection Private Christies March 9, 1988 #172 #172 1988 9, March Christies #147 p12 1948, Edinburgh - Dunbar Hope D Sir Charles Christies October 14, 1987 #196 1987 14, October Christies Unsold Nicholas Shaw Catalog Winter Winter Catalog Shaw Nicholas 2001 p70 foot, ò´KW KWR] KWR] chased shells, bands 2 with of scrolls and flower swanneck sprays, spout, OHDIFDSSHGGRXEOHVFUROOKDQGOHó´KWR] finial, 10 ¼" ht, 33.2oz 33.2oz ht, ¼" 10 finial, FDSSHGFXUYHGVSRXWGRPHGOLGEXGILQLDOZLWKDPRQRJUDP forearm armed an of crest with engraved scale-work, and foliage flowers, beribboned at the elbow, embowed sinister,issuing froma cloud and carrying 10d 32oz ht, ¼" 10 not original, handle silver insulated a spear, OLGEXGILQLDOFKDVHGZLWKVFUROOVDQGURFRFRRUQDPHQWô´ OLGEXGILQLDOFKDVHGZLWKVFUROOVDQGURFRFRRUQDPHQWô´ 12 ¼" ht, 33.6oz Weems Edinburgh Coffeepot, straight sided,rococo chased with shells, flowers andleaves, 1756/57 Dempster Ker & Edinburgh no details Coffeepot, April 12, USA NY Sothebys 1755 ca 1755 ca 1756/57 Coline Allan Gilliland James Aberdeen Edinburgh no details Coffeepot, rim a on base the on rounded body, cylindrical tapering Coffeepot, #110 1991 Finlay 1754/55 Low Robert Edinburgh cone crest, and fruits, flowers scrolls, chased tapering, cylindrical, Coffeepot, 1753/54 Low Robert 1753/54 Dempster & Ker Edinburgh 1754/55 details Edinburgh no Coffeepot, Dempster Ker & foliage foot, molded circular on plain, body, 1754/55 cylindrical tapering Coffeepot, Edinburgh Low Robert no details Coffeepot, Edinburgh scrolls, original with chased base, tucked-in cylindrical, tapering, Coffeepot, Silver, Scottish of Exhibition Sons, & Edward 1753/54 Low Robert Edinburgh domed hinged spout, curved capped leaf foot, circular molded on Coffeepot, 1753/54 Low Robert Edinburgh dome hinged spout, curved capped leaf foot, circular molded on Coffeepot, YEAR MAKER DESCRIPTION 1753/54 LOCATION 1753/54 James Low Robert Edinburgh no details Coffeepot, SOURCE p62 1988 London Christies 134 Coffeepots and Chocolate Pots '$* NVS HFHPEHU LRQDO0XVHXPVRI6FRWODQG 1LFKRODV6KDZ&DWDORJ:LQWHU S %RQKDP¶V7KH6FRWWLVK6DOH $XJXVW 6RWKHE\V$SULO $QWLTXHV0DJD]LQHYRO /\RQ 7XUQEXOO7KH0XUUD\ &ROOHFWLRQ$XJXVW 1LFKRODV6KDZ&DWDORJ:LQWHU S *DOOHULHV$% $XWXPQS 6RWKHE\V$SULO 6RWKHE\V*OHQHDJOHV$SULO /\OH$QQXDO5HYLHZS &KULVWLH V' 0(4 3KLOOLSV*ODVJRZ-XQH LWKIORZHU KWR] IRRW ³,),&$1´IRU $EHUGHHQ0XVHXPVDQG òKWR] -%RXUGRQ6PLWK&DWDORJ DVHGZLWKIORZHUVDQGIROLDJHDUWLFKRNHILQLDO KFDVWIUXLWLQJEUDQFKWDSHULQJF\OLQGULFDOERG\ G\ZLWKUHSRXVVHZRUNFKDVHGZLWKVFUROOVIORZHUV ZRRGHQKDQGOHóKWR] decoration, stepped foot, domed lid, acanthus or artichoke finial, acanthus acanthus finial, artichoke or acanthus lid, domed foot, stepped decoration, FDSSHGVLOYHUKDQGOHDQGVSRXWLQLWLDOV³-&´FUHVWDQGPRWWR VSRXWHQGLQJLQDQDQLPDOKHDGFUHVWDQGPRWWRRI*UDKDPò DQGVKHOOZRUNZLWKFDUYHGJURWHVTXHPDVNVSRXWGRPHGFRYHUZ finial and scroll IORZHUVLQFRUSRUDWLQJYDFDQWFDUWRXFKHVWXFNHGLQRQPROGHG GHFRUDWHGVSRXWDQGOLGZLWKOHDI\ILQLDO´KW and other motifs, domed lid with leaf spray finial, short high spout on a on spout high short finial, spray leaf with lid domed motifs, other and VSUHDGLQJIRRW´KWR] ILQLDOò´KWR] Edinburgh Coffeepot, tapering cylindrical form with chased floral, foliate, and scroll Edinburgh Coffeepot, pear shaped body, repoussed and chased with fruit, flowers, scrolls :LOOLDP'DYLH -RKQ5REHUWVRQ -RKQ5REHUWVRQ (GLQEXUJK &RIIHHSRWVWUDLJKWVLGHGFK /RWKLDQ 5REHUWVRQ (GLQEXUJK &RIIHHSRWGRPHGOLNHZLW FD &ROLQH$OODQ $EHUGHHQ &RIIHHSRWVFUDWFKZHLJKWRQEDVH -DPHV:HOVK :LOOLDP'HPSVWHURU (GLQEXUJK /RWKLDQ 5REHUWVRQ &RIIHHSRWQRGHWDLOV (GLQEXUJK &RIIHHSRWSHDUVKDSHGER -DFNVRQ0DU /RWKLDQ 5REHUWVRQ (GLQEXUJK :LOOLDP7D\ORU &RIIHHSRWQRGHWDLOV (GLQEXUJK &RIIHHSRWURFRFRGHFRUDWHG 1DW 1756/57 Low Robert Edinburgh and scrolls work, shell of bands broad with chased body, tapering Coffeepot, YEAR MAKER DESCRIPTION 1756/57 LOCATION Robertson & Lothian Edinburgh acorn with lid domed base, rim spreading body, tapering plain Coffeepot, SOURCE 135 Compendium of Scottish Silver WLHV*ODVJRZ0DUFK Christies April 26, 1977 #81 1977 26, April Christies Collection Shaw 29, March Glasgow Christies 1954, V, vol Review Art Scottish p40 #1 Sothebys Gleneagles August 29, 29, August Gleneagles Sothebys 1978 #442 Scottish Art Academy Exhibit Exhibit Academy Art Scottish Collection Stuart-Stevenson 6RWKHE\V*OHQHDJOHV$XJXVW #290 1987 1, September Nicholas Shaw Catalog Winter Winter Catalog Shaw Nicholas S %RQKDP¶V7KH6FRWWLVK6DOH $XJXVW J Bourdon-Smith Catalog Catalog Bourdon-Smith J p26 #46 2005 Autumn #47 R] R] R] ILQLDOóKW &OD\WRQ'LFWLRQDU\S HQVLYHO\FKDVHGZLWKIUXLWIORZHUVDQG ZLWKDELUGILQLDOR] IROLDJHFXUYHGVSRXWGRPHGOLGEHDGHGFRQHILQLDO´KW and foliage, dome lid with latticed acorn finial, curved scrolled spout capped capped spout scrolled curved finial, acorn latticed with lid dome foliage, and DQGVXSSRUWHGZLWKIROLDJHZRRGHQVFUROOKDQGOH´KW ornaments, shorthigh spout, domed lid with bird finial, spreading base,ZRRGHQGRXEOHVFUROOFDSSHGKDQGOHò´KWR] swags and leaves, scrolls and flower heads, domed lid, bud finial, wood wood finial, bud lid, domed heads, flower and scrolls leaves, and swags KDQGOHODWHUFUHVWHG´KWR]DOO pineapple finial, scroll mounted leaf-capped curved spout, coat of arms, arms, of coat spout, curved leaf-capped mounted scroll finial, pineapple PRWWR3URFHGRPXVLQ3DFHIRU0RQWJRPHU\ôKWR] HDJOHSLHUFHGZLWKDQDUURZòKWR] Edinburgh Coffeepot, tapering cylindrical body, chasedabove and below with floral Probably William William Probably Dempster FRQWLQXHG &ROTXKRXQRI.LOOHUPRQW'XPEDUWRQVKLUH´KW 1765 ca 1765 ca Graham Adam 1765/66 Glasgow Dempster Ker & flowers scrolls, chased of 2 bands with decorated form, baluster Coffeepot, Edinburgh lid cartouche, rococo in arms of coat decoration, rococo in covered Coffeepot, 1765 ca 1765 ca Graham Adam Glasgow and scrolls shells, fruit, with chased foot, molded circular on Coffeepot, :' .HU 'HPSVWHU (GLQEXUJK &RIIHHSRWEDOXVWHUERG\H[W $GDP*UDKDP (GLQEXUJK &RIIHHSRWURFRFRVW\OHIORZHUV FD $GDP*UDKDP *ODVJRZ &RIIHHSRWKWR] &KULV 1760 ca 1760 ca 1761/62 Cruikshank John Gairdner Alexander Elgin Edinburgh with lid domed in base, tucked with form tapering sided, straight Coffeepot, stand with Coffeepot, #119 1991 Finlay YEAR MAKER DESCRIPTION LOCATION SOURCE 1760 ca 1760 ca Campbell & Milne Glasgow an of crest handle, wood chasing, scroll and fruit shaped, pear Coffeepot, 136 Coffeepots and Chocolate Pots 0XVHXPVRI6FRWODQG 0XVHXPVRI6FRWODQG 1LFKRODV6KDZ&DWDORJ:LQWHU S +D\GHQS Scotland of Museums National -DFNVRQ0DUNVS $SROOR0D\S Scotland of Museums National Exhibit Academy Art Scottish *DOOHULHV House Hopetoun Sothebys 1RYHPEHU )LQOD\ 0(4 6RWKHE\V-XO\ %RQKDPV0DUFK -%RXUGRQ6PLWK/RQGRQ 0(4 RSKDQGOHERWK OXWHGFUHVW±DQDUURZSRLQWLQJGRZQZDUG UVZDY\EDQGVòKW )LQOD\ I%XFKDQDQRI/DQDUNó´KWR] 6RWKHE\V-DQXDU\ ILQLDODUPVR ôKWR] circular foot, woodenhandle ULEERQVDQGRYDOGLVNVRQHLQLWLDOHG³/-6´FXUYHGVSRXWORZLWKELUG¶VKHDGV with an inscription dated 1769, repousse and chased with scrolls, flowers, flowers, scrolls, with chased and repousse 1769, dated inscription an with match to decorated lid, hinged and handle wood ornament, shell and foliage, WKHERG\EXGILQLDORQPROGHGULPIRRWó´KWR]G hingedlid, cone finial, whole onraised circular foot, engraved with coat of DUPVRI5DPVD\.LQVRIWKHHDUOVRI'DOKRXVLH´KWR] &RIIHHSRWELUG Edinburgh Coffeepot, silver gilt vase-shaped, body withapplied festoons pendant from FD -DPHV:LOGJRRVH1776/77 $EHUGHHQ Robertson Patrick &RIIHHSRWSHDUVKDSHGIORZH Edinburgh 5REHUW%RZPDQ no details Coffeepot, )UDQFLV+RZGHQ (GLQEXUJK &RIIHHSRWQRGHWDLOV Art and Museums Dundee 1DWLRQDO -DPHV0F.D\ (GLQEXUJK &RIIHHSRWEDOXVWHUVKDSHKDOII 1769/70 Robertson Patrick Edinburgh plain on decoration, rococo form, pear inverted elongated large, Coffeepot, 1767/68 available Not Edinburgh underneath crest, and monogram with engraved shaped, baluster Coffeepot, .HU 'HPSVWHU (GLQEXUJK &RIIHHSRWQRGHWDLOV 1DWLRQDO 1766/67 Gairdner Alexander Edinburgh domed spout, capped leaf handle, scroll form, circular tapering Coffeepot, YEAR MAKER DESCRIPTION LOCATION .HU 'HPSVWHU (GLQEXUJK SOURCE 137 Compendium of Scottish Silver Cincinnati Art Museum 1978.414 1978.414 Museum Art Cincinnati 1987 #305 1990 #80 MEQ 816 MEQ 1171 1976.18 1976.18 1171 MEQ MEQ 1316 1316 MEQ Private Collection Collection Private 29, April Edinburgh Christies 1992 MEQ 688 Edinburgh HH2809/65 HH2809/65 Edinburgh 1986.151 MEQ 1178 1178 MEQ DWLRQ´KW +XQWOH\+RXVH0XVHXP details details Scotland of Museums National details details Scotland of Museums National no details details no Scotland of Museums National ffeepot, begins with a lamp lamp a with begins ffeepot, Scotland of Museums National Earl of Glasgow (1765-1843), but presumable someone else), retailer's retailer's else), someone presumable but (1765-1843), Glasgow of Earl th rim, acanthus foliage finial to partly fluted domed cover, engraved crest of a of crest engraved cover, domed fluted partly to finial foliage acanthus rim, Boyle, George for be to (supposed coronet viscount's a beneath eagle spread 4 ó´KWó´RYHUKDQGOH mark "Morton" for Robert Morton, smallrepair at base of spout, 10"ht, 28oz (GLQEXUJK &RIIHHSRWSDUWRIDSLHFHVHUYLFHEXWWHUIO\GHFRU Sons 1831/32 Co Elder & 1833/34 Sutherland Daniel 1837/38 Edinburgh Glasgow 1840/41 Marshall W & J no details Coffeepot, no details Coffeepot, Sons & Marshall Edinburgh Edinburgh chased Coffeepot, Coffeepot, August Gleneagles Sothebys May House Hopetoun Sothebys 1993 London Bourdon-Smith J 1846/47 William Marshall & & Marshall 1846/47 William 1820/21 McHattie George Edinburgh gadrooned foot, circular spreading on pear-shaped, fluted, partly Coffeepot, 1824/25 James McKay Edinburgh Coffeepot, no no McKay 1823/24 Coffeepot, Edinburgh 1824/25 James Co & Howden James Edinburgh 1830/31 no details Coffeepot, McKay James Edinburgh background, stippled on motif floral with chased elaborately Coffeepot, Collection Swan Maple The 1900/01 Hamilton & Inches Edinburgh Co Edinburgh Inches 1847/48 & Marshall W & J 1900/01 Hamilton Edinburgh Hay Ramsay David by designed Coffeepot, Scotland of Museums National YEAR MAKER DESCRIPTION 1819/20 LOCATION Cunningham P & W Edinburgh details no Coffeepot, SOURCE Scotland of Museums National 1819/20 James McKay Edinburgh Coffeepot, no no McKay Coffeepot, Edinburgh 1819/20 James 138 Coffeepots and Chocolate Pots p252 DAG001243 DAG001243 DAG008802 DAG008802 #814 , 1978-2061 1978-2061 , Sothebys October 22, 1970 #213 #213 1970 22, October Sothebys Galleries Grantully Castle Antiques Antiques Castle Grantully Scotland of Museums National 1065 MEQ Bell-Aberdeen advertisement AB Galleries MEQ 1602a & b b & 1602a MEQ AB Galleries eces, 56.9oz Brett p194 ize, engraved with the Selkirk Arms Arms Selkirk the with engraved ize, Aberdeen of Bell eces Antiques Magazine vol 76 t, no details details no t, and Museums Aberdeen CHOCOLATE CHOCOLATE COFFEE SERVICE POTS 1782/83 Cunningham William Edinburgh 3 pi service, Coffee 1718/20 Aytoun William Edinburgh pi 3 octagonal, service, Coffee 1720 ca 1720 ca Bruce Robert 1720/21 Murray Patrick Edinburgh details no Edinburgh pot, Chocolate pr race Selkirk pot, Chocolate Art and Museums Dundee 1734/35 Lothian Edward 1765 ca Edinburgh Graham Adam details no pot, Chocolate Glasgow po Chocolate 303 50 p vol Magazine Antiques YEAR MAKER DESCRIPTION 1986/87 LOCATION Hope Adrian Edinburgh sides straight with Coffeepot, SOURCE Scotland of Museums National 1990 Hope Adrian Edinburgh no details Coffeepot, and Museums Aberdeen 139 Compendium of Scottish Silver 140 Cream and Milk Containers CreamCREAM & AND Milk MILK CONTAINERSContainers Plate 17. Group of 3 Edinburgh Cream Boats of different styles. Left – 1744/45 Edward Lothian; Center – 1752/53 Robert Gordon; Right 1741/42 James Weems Courtesy of The Phoenix Collection. Photograph by Janice M Dietert. 141 Compendium of Scottish Silver S S &OD\WRQ&KULVWLHV%RRN &KULVWLHV)HEUXDU\ Antiques Magazine December YROS advertisement Shrubsole Collection Ivory #41, Exhibition Empire Glasgow SO 6RWKHE\V*OHQHDJOHV$XJXVW 1969 #137 Sothebys Blair Castle September 6RWKHE\V-XQH 6RWKHE\V)HEUXDU\ 6RWKHE\V2FWREHU %UHWW 96 p56 vol Country Life January 14, 1965 1965 14, January Life Country SLOOXVDUWLFOHE\*%HUQDUG Hughes &OD\WRQ&KULVWLHV%RRN &KULVWLHV &KULVWLHV-XO\ House Hopetoun Sothebys 1RYHPEHU Phillips J S Scotland of Museums National 0(4 Finlay 1991 #73 1991 Finlay 1967 30, November Sothebys Edinburgh of How ´KWR] ERG\RQVSUHDGLQJUDWKHUIODWIRRWGRXEOH OV &RQQRLVVHXU0DJD]LQH VSRXWVLQJOHVFUROOKDQGOHODWHULQLWLDOVRQWKH W\SHSODLQGRXEOHVFUROOKDQGOHVKRUWPROGHG gonal, upright, small spout, silver scroll handle, handle, scroll silver spout, small upright, gonal, curved spout with continuous rim rim continuous with spout curved bottom, ½" ht, bottom, 7d 4 5oz with coffee pot and sugar box, 4 ¾" ht, 10oz ht, 10oz ¾" 4 box, and sugar pot coffee with scroll silver handle, domed lid, acorn finial, rim is continuous, spout has drop drop has spout continuous, is rim finial, acorn lid, domed handle, silver scroll handle opposite arms of coat full bottom, at EDVHPROGHGULPEROGVFUROOLQJKDQGOHRQVSUHDGLQJIRRWò coat of Arms of Baillie with coffee pot pot coffee with Baillie of Arms of coat CREAM AND MILK CONTAINERS CONTAINERS CREAM AND MILK -DPHV0LWFKHOVRQ (GLQEXUJK &UHDPMXJXSULJKWSLWFKHU 1RWDYDLODEOH &ROLQ0F.HQ]LH (GLQEXUJK (GLQEXUJK &RYHUHGKRWPLONMXJQRGHWDL &UHDPMXJSLWFKHUIRUPVKRUW :LOOLDP$\WRXQ (GLQEXUJK &UHDPHUSLWFKHUW\SHRFWD 1RWDYDLODEOH (GLQEXUJK +RWPLONMXJFRYHUHGEDOXVWHU 1714/15 Yorstoun Mungo Edinburgh the at tear drop with spout faceted molded form, pitcher upright, jug, Cream 1713/14 McKenzie Colin Edinburgh handle, scroll double wooden form, baluster octagonal covered, milk jug, Hot YEAR MAKER DESCRIPTION LOCATION SOURCE 142 Cream and Milk Containers McKisick Museum, University of SC Columbia, Carolina, South 1.219 USA p201 128 vol 28, January Inc. Phillips S. J. 1977 #180 catalog years 50 Shrubsole Colonial - Collection Hyman Sothebys May 11, 1967 #63 1967 11, May Sothebys Edinburgh of How Sothebys August 29, 1994 #130 1994 29, August Sothebys Colonial - Collection Hyman G1994-164 Williamsburg p6 133, vol Sothebys London November 26, 1953 Exhibition Empire Glasgow #22 p108 I, vol 1911, Asprey Collection, November November Collection, Asprey #13 1993, p221 Holland p844 Colonial - Collection Hyman G1994-192 Williamsburg RWGRXEOHVFUROOKDQGOHò´KW ovoid/egg shaped, matches teapot of the same year,later ´GLDWEDVH´GLDWPRXWK and scale work, leaf capped double scroll handle, on 3 faceted supports, supports, 3 faceted on handle, scroll double capped leaf work, and scale ´GLR]G chased with fruits, shells,and scale work, crest andmotto of Foulis of Ravelston Edinburgh Edinburgh 9.2oz ht, ½" 4 jug, hot milk Covered 1952 Magazine Connoisseur 1725/26 Henry Bethune 1725/26 Henry FD 5REHUW/XNH *ODVJRZ &UHDPMXJEDOXVWHUERG\PROGHGIR 1723/24 McKenzie Kenneth Edinburgh 1723/24 no details upright, jug, Cream Ker James 1725 ca Luke Robert Edinburgh bowl sugar a with border, wavy shaped, helmet jug, Cream Glasgow scrolls foliate shells, with chased lip rim, waved and flared oval, boat, Cream Sharp & Wilson 1954 Magazine Connoisseur YEAR MAKER DESCRIPTION 1719/20 LOCATION Yorstoun Mungo Edinburgh 10d 7oz ht, 3/8" 4 upright, jug, Cream SOURCE pl #80 Finlay 1719/20 1719/20 Yorstoun Mungo Yorstoun Mungo Edinburgh Edinburgh 1722/23 details no jug, Cream shape baluster jug, Cream Bethune Henry Edinburgh tall, milk jug, Hot Exhibition Empire Glasgow 1996 June Magazine Antiques 143 Compendium of Scottish Silver May 1967, vol 85 p 96 85 p vol 1967, May Christies February 13, 1957 13, 1957 February Christies 1994 9, June London Sothebys #310 Christies July 10-11, 1984 #378 #378 1984 10-11, July Christies #227 1980 2, December Sothebys 20, February Turnbull & Lyon 2004 #255 Fogg Art Museum, Harvard Harvard Art Museum, Fogg 1949.114.111 University Collection Hutchinson +RZ¶V1RWHVRQ$QWLTXHV6LOYHU p23 1941 I, vol #134 1991 Finlay Brooklyn Museum 63.95.2 Harvard University Art Museum Breadalbane Collection 1953 Magazine Connoisseur #112 1962 7, March Christies Collection Shaw 1983 March Glasgow Christies #87 NYC of Museum Metropolitan AC#1983.24 Williamsburg G1994-173 G1994-173 Williamsburg foot, DWLRQô´ foot, body flares outand up no details details no Apollo VSRXWEDOOILQLDOWRWKHFRYHUZRRGHQKDQGOHó´KWR] engraved around mouth and onlid withnarrowa band of masks, domed handle, scrolls scroll single capped, plain and silver lip, curved short work, strap OLGZLWKDSSOLHGKLQJHEXQDQGEXWWRQILQLDO´KWR] stepped on handle, scroll silver capped plain simple urn finial, lid, hinged VSUHDGLQJEDVH´KWR] HQJUDYHGLQLWLDO³+´ to the scalloped mouth with a small spout, molded drop below, straight then then straight below, drop molded spout, small a with mouth scalloped the to scroll-shapedhandle, girdlehigh on body, part the of Johnson piece 4 tea VHUYLFHò´ORQJ´ZLGH molded V-shaped lip, silver scroll handle, lid with spherical finial, engraved engraved finial, spherical with lid handle, scroll silver lip, V-shaped molded DURXQGPRXWKDQGRQULPRIOLGZLWKEDQGVRIFRQYHQWLRQDOGHFRU 10oz ht, Edinburgh Hot milk jug, covered, plain spherical body, short v-shaped spout,applied Edinburgh Hot milk jug, covered,near spherical form, on molded spreading foot, Assayer Edward Penman (continued) (continued) 1729/30 James Ker 1729/30 James 1730 ca Tait James Edinburgh short foot, molded circular on spherical only, mm covered, milk jug, Hot 1728/29 Ker James Edinburgh molded reeded on spreading body, near spherical covered, milk jug, Hot 1727/28 1727/28 Mitchelson James Kincaid Alexander Edinburgh Edinburgh ht 4" form, baluster upright jug, Cream lid, hinged finial, acorn handle, wooden feet, hoof 3 on covered, jug, Milk auction Sothebys 1727/28 Ker Kincade Alexander 1727/28 James Edinburgh details no boat, Cream 1727/28 Ker James Edinburgh oval on edge, molded shaped, helmet jug, Cream Show Harvard Hutchinson YEAR MAKER DESCRIPTION LOCATION SOURCE 1725/26 Luke Robert Glasgow boat, Cream 144 Cream and Milk Containers 1979 1979 Picture Files Files Picture DAG008503 DAG008503 ecember 19, Connoisseur Magazine 1941 1941 Magazine Connoisseur p230 107, vol February Knightbridge Bonhams #234 1994 22, 1938 Exhibition Empire Glasgow #54 19 pl illus Christies Scottish Scottish Christies 1952 Scotland of Museums National 1953 125 Scotland of Museums National 1327 MEQ Christies D Christies #163 1995 6, June Edinburgh Christies #339 Connoisseur Magazine 1955, 1955, Magazine Connoisseur p90 135 vol advertisement How Aberdeen Museumsand AB Galleries in 1986 Purchased 1959 August Life Country photos with article pp130-133 Sothebys Gleneagles August 31, 31, August Gleneagles Sothebys 1981 #453 mily mily GERG\ R] DUURZV ´KWR] riband riband the KirkhillTea Service of 5 pieces, crest andmotto the of Gordon fa VFUROOKDQGOHRSSRVLQJ9¶VDVDEDQGGHFRUDWLRQVXUURXQGLQJOL junction, tall spout, decoration is simpler and earlier than other Aytoun Aytoun other than earlier and simpler is decoration spout, tall junction, example rim, chased with flower heads, scale work, and shells, scroll handle, gilt gilt handle, scroll shells, and work, scale heads, flower with chased rim, LQWHULRUHQJUDYHGZLWKFUHVWPPVOLJKWO\UXEEHGó´ZLGH tall stem, tall spout, like other 1730 Aytoun example except broader area of of area broader except example Aytoun 1730 like other spout, tall tall stem, GHFRUDWLRQVFUROOVOHDYHVDQGPDWWLQJQRMX[WDSRVHGY¶VRU and scrolling foliage, 5oz 2d 2d 5oz foliage, scrolling and DQGDVKHOOGRXEOHVFUROOKDQGOHRQKRRIIHHW´ Edinburgh Hot milk jug, covered, spherical body, silverhandle, ball and button finial, on 1732/33 Aytoun William Edinburgh body upper on girdle broad shaped, helmet jug, Cream collection Ivory 1732/33 Michelson James Edinburgh girdle, reeded applied handle, scroll flying shaped, helmet jug, Cream 1730/31 Aytoun William Edinburgh a in motto and crest with engraved girdle, broad shaped, helmet jug, Cream 1730 ca 1730 ca Cooper George Aberdeen from body, baluster spout, short handle, silver tall pedestal, a on jug, Cream 1730/31 William Aytoun Aytoun 1730/31 1730/31 William Anderson James Edinburgh 1730/31 details no jug, Milk Aytoun William Edinburgh double silver stem, tall on finial, button and bell shaped, spherical jug, Milk 547 p Marks Jackson 1730 ca 1730 ca Luke Robert Glasgow everted shaped feet, and paw 3 fleur-de-lys on shape, oval plain boat, Cream 1730 ca 1730 ca Luke Robert Glasgow shell with rim, engraved everted handle, scroll feet, hoof 3 on boat, Cream YEAR MAKER DESCRIPTION 1730 ca LOCATION Luke Robert Glasgow heads, flower foliage, with chased flat rim and everted lip oval, boat, Cream SOURCE 145 Compendium of Scottish Silver 19 #650 gh May 17, May gh U J Bourdon-Smith London 1993 London Bourdon-Smith J Collection Phoenix The 4XHHQ¶V6LOYHUS 6RWKHE\V-XO\ Edinburgh of How Collection Noble Exhibition Empire Glasgow #120 1991 Finlay 2004 Catalog Shaw Nicholas S Scotland of Museums National . Christies South Kensington May May Kensington South Christies vol93 p131 vol93 #74 1991 Finlay Collection Linlithgow Scotland of Museums National 0(4 Sothebys March 14, 1974 #195 1974 14, March Sothebys ORQJR] LWKDVXJDUERZO DUWRIWKH+RSHWRXQ7HD6HUYLFH´KW &OD\WRQ'LFWLRQDU\S RIWKH*LUGZRRG7HD6HUYLFH &RQQRLVVHXU0DJD]LQH GSODLQHQJUDYHGLQLWLDOV´KWR] 3KLOOLSV"(GLQEX oof feet, withleaf capped double scrollhandle, shaped capped double scroll silver handle, 6 ¾" long long ¾" 6 handle, silver scroll double capped of a mixed Aberdeen Tea Service Service Tea Aberdeen mixed a of flowers, shells, and leafage, double scrollhandle, onhoof 3 feet, sold withPDWFKLQJVDXFHERDWGDWHGR]ERWK 4 ½" ht HYHUWHGULPHQJUDYHGDUDEHVTXHVXQGHUVLGHZLWKDQLQLWLDO´ shell at the lip with leaf capped double scroll handle, on 3 hoof feet, headed headed feet, hoof 3 on handle, scroll double capped leaf with lip the at shell E\WUHIRLOV ´ORQJR] %DQII &UHDPMXJXSULJKWVSDUURZEHDNVSRXWFUHVWRI'XII Z 1735/36 Aytoun William Edinburgh leaf knees, trefid with feet pad 3 spout, and rim chased everted boat, Cream 1735 ca 1735 ca Gordon Patrick FD -DPHV0LWFKHOVRQ 1735 ca (GLQEXUJK Cooper George &UHDPMXJRYDOKHOPHWVKDSH Aberdeen part handle, scroll double silver feet, pad on shaped, pear upright, jug, Cream :LOOLDP$\WRXQ (GLQEXUJK &UHDPMXJKHOPHWVKDSHGSDUW -DPHV.HU 1735 ca (GLQEXUJK Aytoun William +RWPLONMXJFRYHUHGRQIHHWS Edinburgh with chased lip, long rim, wavy projecting body, oval shallow boat, Cream 1733/34 Ker James Edinburgh h on boat, Cream YEAR MAKER DESCRIPTION 1733/34 LOCATION Ker James Edinburgh a and foliage, flowers work, lattice with engraved rim everted boat, Cream SOURCE 146 Cream and Milk Containers 1974 1974 1967 #23 1967 ecember 20, ecember 13, Sothebys August 26, 1972 # 71 # 1972 26, August Sothebys Christies D Christies #193 Connoisseur Magazine 1933, 1933, Magazine Connoisseur 91 p342 vol #81 1949 27, April Christies Negative London Christies #157597 Christies Glasgow March 1983 1983 March Glasgow Christies #77 Collection Shaw Koopman 29, August Gleneagles Sothebys 1978 #437 p45 1982, Review Silver Lyle Sothebys Gleneagles August 31 #288 1987 1, September Ticher Irish Silver p26 p26 Silver Irish Ticher Shrubsole #377 1984 10-11, July Christies Sothebys South Kensington #87 1998 10, November Negative London Christies #25239 Holland p Holland 121 Collection Noble D Christies Sharp & Wilson VKHOOKHDGHG LVPRWWR³4XL ´R] ece service, silverhandle, short spout, chasedrim OLSOHDIFDSSHGGRXEOHVFUROOKDQGOHXQGHUVLGHZLWKLQLWLDOV IORZHUVVKHOOVDQGIROLDJHGRXEOHVFUROOKDQGOHR] and spout, paw feet andtrefid knees KDQGOHò´ORQJR] handle, 6oz 15d 15d 6oz handle, ERG\ZLWKFUHVWRI/RUG%RUWKZLFNKLVEDURQ¶VFRURQHWDERYHKFRQGXFLW´EHORZVKDSHGZDY\ULPRQKRRIIHHWLVVXLQJIURPOHJVOHDIFDSSHGIO\LQJVFUROOKDQGOHò´ORQJR] crown, low body, uplifted spout, 7 ½" ht ht ½" 7 spout, uplifted body, low crown, flowers, scrolls and shells, with leaf capped double scroll handle, with initials initials with handle, scroll double capped leaf with shells, and scrolls flowers, ³'0'´RU''0R] button finial, tall spout, mixed decoration in narrow band near mouth with with mouth near band narrow in decoration mixed spout, tall finial, button scrolls and diaper work, 8oz Edinburgh Cream boat, on 3 scroll feet, issuing from trefoils, shaped borders chased with 1739/40 Ker James Edinburgh pi a 4 of part boat, Cream 1740ca 1740ca Glen James Glasgow waved motifs, comma by headed feet, on 3 paw body, plain oval, boat, Cream 1739/40 Mitchelson James Edinburgh with chased rim flat shaped above, scrolls with feet, hoof 3 on boat, Cream 1739/40 Mitchelson James Edinburgh scroll double capped leaf feet, hoof 3 on rim, chased, everted boat, Cream 1738/39 Ker James Edinburgh scroll rim, leaf chased everted legs, lobed trefid feet, paw on boat, Cream 1737/38 Edward Lothian Lothian 1737/38 Edward 1737/38 C R Edinburgh oval only, mm and date letter carry to said Edinburgh, possibly boat, Cream 1736/37 Ker James Edinburgh under conjoined "M", script initial feet, paw rim, chased everted boat, Cream YEAR MAKER DESCRIPTION 1735/36 LOCATION Lothian Edward Edinburgh and ball handle, scroll double silver body, spherical jug, hot milk Covered SOURCE 147 Compendium of Scottish Silver DAG01365 DAG01365 Sothebys April NY USA 23, 1993 #294 vol I, 1941 p22 1941 I, vol The Phoenix Collection Collection Phoenix The # 1966 24, March Sothebys Antiques Bloom N Shaw Collection Collection Shaw 1983 March Glasgow Christies #43 Christies July 3, 1984 #163 #163 3, 1984 July Christies #41 1983 29, March Christies #17 p183 Christies Clayton AprilSothebys NY USA 25-26, 1978 #770 National Museums of Scotland Scotland of Museums National P.1975 1143 MEQ Scottish Art Review vol VIII VIII vol Review Art Scottish #2 1961 p35 advertisement Bell John Christies July 3, 1984 #161 #161 3, 1984 July Christies #43 1983 29, March Christies Shaw Aberdeen Museumsand AB Galleries 1984 in purchased oof feet with R] 0´PDUNV,% foot, with v-shaped spout, scroll RQSDZIHHW´ORQJR] -5RELQVRQV1< ULROHOHJVR] +RZ¶V1RWHVRQ$QWLTXHV6LOYHU ovoid, with cover, on 3hoof feet, v-shaped spout with molded gilt interior, leaf capped double scroll handle, on 3 paw feet, headed by by headed feet, paw 3 on handle, scroll double capped leaf gilt interior, WUHIRLOó´ORQJR] IORZHUVRQKRRIIHHWZLWKOHDIFDSSHGKDQGOHó´ORQJ double scroll handle handle scroll double FDSSHGGRXEOHVFUROOVLOYHUKDQGOH´ORQJR] drop, engraved around the border and cover with band of stylized foliage, foliage, stylized of band with cover and border the around engraved drop, EDOXVWHUILQLDOVFUROOKDQGOHHQJUDYHGZLWKODWHULQLWLDOV³& 8%6,«,+´KWR] 3 hoof feet, body later chased chased later body feet, hoof 3 voluted trefid cabriole legs legs cabriole trefid voluted handle, provenance Shaw Collection, #43, 2oz 10d 2oz #43, Collection, Shaw provenance handle, Edinburgh Edinburgh and scrolls shells, with decorated rim, wavy everted form, oval boat, Cream Banff Cream jug,upright, tall baluster body, onmolded foot,narrow v spout, silver Assayer Dougal Ged /DZUHQFH2OLSKDQW (GLQEXUJK &UHDPERDWRQYROXWHGFDE 1740/41 Dougal Ged Ged 1740/41 Dougal 1740/41 Mitchelson James Edinburgh ornament, rococo with chased flat lip, and rim everted shaped boat, Cream -DPHV0LWFKHOO (GLQEXUJK &UHDPERDWHYHUWHGFKDVHGULP 1740 ca 1740 ca Baillie John 1740 ca 1740 ca Luke Robert Glasgow spout, and rim everted chased attachments, trefid feet, paw 3 on boat, Cream 1740 ca 1740 ca Baillie John Inverness milk jug, Hot 1740 ca 1740 ca Mitchell Colin Canongate on handle, scroll double capped leaf lip, plain rim, plain everted boat, Cream 1740 ca 1740 ca Oliphant Ebenezer Edinburgh h 3 on handle, scroll double chased, lip rim, everted boat, Cream YEAR MAKER DESCRIPTION 1740 ca LOCATION Baillie John Inverness spreading on shaped, pear jug, Cream SOURCE 148 Cream and Milk Containers 6RWKHE\V-XO\ +RZRI(GLQEXUJK &KULVWLHV0DUFK &KULVWLHV-XO\ &KULVWLHV-XO\ 'H+DYLOODQG$QWLTXHV $SROORYRO2FWREHUS &KULVWLHV0D\ May Kensington South Christies 1990 2, October Christies &KULVWLHV2FWREHU &KULVWLHV)HEUXDU\ &KULVWLHV$SULO Kensington South Christies 1RYHPEHU 21, November Glasgow Christies 1990 #39 &RQQRLVVHXU0DJD]LQH)HEUXDU\ p107-109 1939, +RZDGYHUWLVHPHQW Sothebys NY USA OctoberSothebys NY USA 3-4, 1993 NY Shrubsole Collection Phoenix The 1991 WLDOV´ORQJ HGHYHUWHGULPOLSFKDVHGZLWKVKHOOVDQG ULPRQSDZIHHWR] +RZRI(GLQEXUJK OHDIFDSSHGGRXEOHVFUROOKDQGOHHYHUWHGULPOLS scroll handle, everted chased rim rim chased everted handle, scroll IROLDJHGRXEOHVFUROOKDQGOHFUHVWDQGPRQRJUDPR] IORUDOGHVLJQVVFUROOKDQGOHRQSDZIHHWô´ORQJR] FKDVHGZLWKVFUROOVIROLDJHDQGURFRFRRUQDPHQWVHWVRILQL R] DUDEHVTXHVOHDIFDSSHGGRXEOHVFUROOKDQGOHó´ORQJR] OHDIFDSSHGGRXEOHVFUROOVLOYHUKDQGOHô´ORQJR] DWWDFKPHQWVVFULSW:RQERWWRPDFURVV Edinburgh Cream boat, part of a 3 piece tea service, onhoof3 feet, acanthus double Edinburgh Cream boat,hoof on 3 feet with trefid knees, chased evertedrim and spout, Edinburgh Cream boat, broad everted plain shapedrim, on 3 paw feet,with trefid Edinburgh Edinburgh feet paw on rim, chased everted boat, Cream London Ltd, Walter William Weems Probably James Campbell Assayer Dougal Ged Assayer Dougal Ged Assayer Dougal Ged 1742/43 IC *HRUJH)RUEHV (GLQEXUJK &UHDPERDWRQSDZIHHWVKDS 1742/43 Low Robert Edinburgh and scroll shell, with chased lip and rim inner body, oval plain boat, Cream (EHQH]HU2OLSKDQW (GLQEXUJK &UHDPERDWRQSDZIHHW 1741/42 Lothian Edward Edinburgh with chased rim everted shaped feet, hoof applied 3 on boat, Cream 1740/41 Edward Lothian Lothian YEAR MAKER DESCRIPTION 1740/41 Edward LOCATION SOURCE 1741/42 James 1741/42 James (EHQH]HU2OLSKDQW /DZUHQFH2OLSKDQW (GLQEXUJK &UHDPERDWHYHUWHGFKDVHG 149 Compendium of Scottish Silver 1964-27 1964-27 Galleries #177 J Bourdon-Smith London Negative London Christies #744575 Catalog Bourdon-Smith J #44 p21 2002 Autumn Christies July 26, 1960 26, July Christies #46 1966 15, December Sothebys N. Boom & Son Ltd #155 1972 26, July Christies Clayton Dictionary p42 #651 p42 #651 Dictionary Clayton MEQ 814 J Bourdon-Smith Catalog Spring Spring Catalog Bourdon-Smith J 1973 p43 99 1974 vol January Apollo Asprey Spink advertisement Apollo vol 17 1933 pXIII pXIII 17 1933 vol Apollo Apollo October 1968 vol 88 p54 vol 1968 October Apollo #172 5, 1967 July Christies ece ´KW JR] foot, molded lip, double scrollhandle, SDZIHHWLQLWLDOV³$(´SDUWRIDSL no details details no Art and Museums Dundee 6.2oz 6.2oz VFUROOVOHDIFDSSHGGRXEOHVFUROOKDQGOHSDZIHHWò´ORQ ERG\HQJUDYHGZLWKDF\SKHUDQGDERUGHURIVKHOOVDQGVFUROOV tea service service tea SDZIHHW´IURPOLSWRKDQGOHR]G 3 pieces scroll handle, 7.6oz 7.6oz handle, scroll handle, initials script "F" or "T" in a circle circle a in "T" or "F" script initials handle, Edinburgh Edinburgh handle scroll double capped feet, 3 paw on rim, chased everted boat, Cream 25, 1973 July London Christies Edinburgh Cream boat, chasedthe on flaredand lip wavy with flowerheads, leaves and Edinburgh Edinburgh of set mixed a of part handle, dolphin flying rim, chased everted boat, Cream William Davie Davie William Assayer Hugh Gordon Probably Hugh Penman William Dempster Dempster William 1744/45 or Dempster William 1743/44 HP 1743/44 HP 1743/44 1743/44 Penman Hugh Gordon Robert Edinburgh Edinburgh details no boat, Cream boat, Cream 221 p Holland 1743/44 Lothian Edward Edinburgh circular on shaped, pear jug, Cream 1743/44 or Davie William -DPHV.HU (GLQEXUJK &UHDPERDWHYHUWHGFKDVHGULPRQ 1743/44 Aytoun William Edinburgh crest with chased rim everted feet, 3 on boat, Cream Scotland of Museums National 1743 ca 1743 ca Luke Robert Glasgow 3 handle, scroll double spout, rim, v-shaped everted body, plain boat, Cream 1742/43 Lothian Edward Edinburgh double capped leaf feet, paw 3 on spout, and rim everted chased boat, Cream YEAR MAKER DESCRIPTION 1742/43 LOCATION Clark James Edinburgh scroll double capped leaf feet, pad on rim, chased everted boat, Cream SOURCE 150 Cream and Milk Containers (GLQEXUJK Sothebys August 24, 1972 #71 1972 24, August Sothebys Christies Scotland November 25- November Scotland Christies 1997 27, #107 1991 Finlay Glasgow Art Gallery and Museum Brett #818 Brett #818 or 1974 14, March Sothebys 1984 #195 1974 Catalog Bourdon-Smith J autumn Catalog Bourdon-Smith J 2002 p21 Sothebys May 3, 1962 #12 1962 3, May Sothebys #177 25, 1973 July Christies AntiquesSimon Kaye #251 1987 June 18, Sothebys The Phoenix Collection Collection Phoenix The #80 1991 Finlay oof feet, with trefidattachments, GIOHXUGHOLVDQGSDZIHHWVKDSHGHYHUWHG at, oval, on 3 paw feet headed by comma motifs, wavy lip, leaf leaf lip, wavy motifs, comma by headed feet 3 paw on at, oval, ERDWSODLQRYDORQVW\OL]H FDSSHGGRXEOHVFUROOKDQGOHXQGHUVLGHLQLWLDOHG´ORQJR] everted rim rim everted rim chased with flower heads and foliated scrolls, leap capped flying scroll scroll flying capped leap scrolls, foliated and heads flower with chased rim base, the to marked long crest, later with engraved interior, gilt later handles, FUHVWRI6WXDUWó´ORQJR] motifs,paw on 3 feet issuing from volutes, crest andmotto Duncan, of ô´ORQJR] scroll silverhandle, part a piece of 3 service capped double scrollhandle, shapedrim chased with flowers and scrolls, ô´ORQJR] 6 ½" long lid, flat almost of outside on also decoration, chased leafy of band with body handle scroll double capped leaf finial, or artichoke cone Edinburgh Cream boat, oval, on3 scrolland paw feet issuing from scrolled volutes, Edinburgh Edinburgh of half lower u-shaped feet, pad and 3 scroll on upright, covered, jug, Cream William Davie Davie William William Davie Davie William FD -DPHV*OHQ *ODVJRZ &UHDPERDWQRGHWDLOVR] +RZRI 1745 ca 1745 ca Glen James Glasgow bo Cream 1745 ca 1745 ca Glen James Glasgow chased handle, silver scroll double capped leaf feet, paw 3 on boat, Cream FD -DPHV*OHQ *ODVJRZ &UHDP 1744/45 or Dempster William 1744/45 AG 1744/45 Ker James Edinburgh Edinburgh Edward Lothian by and bowl teapot a with sold jug, Cream shell and foliage flowers with chased lip and rim shaped everted boat, Cream 3 #12 May Sothebys 1744/45 or Dempster William 1744/45 Lothian Edward Edinburgh double body, lower u-shaped feet, pad and cabriole 3 on upright, jug, Cream YEAR MAKER DESCRIPTION 1744/45 LOCATION Lothian Edward Edinburgh h 3 on rim, chased everted boat, Cream SOURCE 151 Compendium of Scottish Silver G1995-11 G1995-11 Antiques Magazine vol 86 p410 vol Magazine Antiques advertisement Shrubsoles Christies October 16, 1968 #79 #79 1968 16, October Christies Brand Inglish 1980 p137 #152 #152 p137 1980 Inglish Brand 1962.730 p27 Silver Irish Ticher p18 Holland Colonial - Collection Hyman Williamsburg 14, November Scotland Christies 1985 #312 J Bourdon-Smith Catalog Spring Spring Catalog Bourdon-Smith J 1981 Sothebys July 21, 1966 21, July Sothebys Sothebys October 31, 1974 31, October Sothebys ò´KW oof feetheaded by trefoils, 2 HHYHUWHGHGJHRQSDZIHHW´IURPOLS motto of Curle, part of a set a set of part Curle, of motto with flowers, foliage and scrolls, double scroll handle, 7oz 7oz handle, scroll double scrolls, and foliage flowers, with handle, swan or pelican crest,8" crest and motto, everted rim chased with foliage, flying scroll handle formed formed handle scroll flying foliage, with chased rim everted motto, and crest DVDGROSKLQPRWWR³)RU«'()(16(´FUHVWRIDUDP¶VKHDG feet, dolphin flying handle handle flying dolphin feet, to back of handle, 7.25oz 7.25oz handle, of back to KDQGOHò´KWR]G XQLGHQWLILHGPDUNV$'LQDVKDSHGVKLHOGDQGDELUG¶VKHDG 10d 5oz Edinburgh Cream boat, George II, scroll on 3 and paw feet, shaped evertedrim chased Edinburgh Edinburgh with engraved body plain otherwise feet, paw and foliate 3 on boat, Cream bly William William bly Assayer Hugh Gordon Davie, Assayer Hugh Gordon 1746/47 Welsh James 1746/47 1746/47 Penman Hugh Lothian Edward Edinburgh Edinburgh details no boat, Cream and crest handle, scroll double feet, pad on rim, chased everted boat, Cream Collection Swan Maple The 1746/47 WD possi 1746/47 WD 1745/46 1745/46 Gordon Robert 1745/46 Ker James Edinburgh Dempster William 1746/47 handle dolphin rim, chased everted boat, Cream Edinburgh Edinburgh Aytoun William details no jug, Cream bowl with boat Cream Edinburgh scroll double capped leaf set, feet, paw on rim, chased everted boat, Cream 1963 p444 Life Country Scotland of Museums National Collection Swan Maple The 1745 ca 1745 ca available Not Edinburgh paw with legs cabriole semi rim, 3 chased shaped everted oval, boat, Cream FD -DPHV*OHQ *ODVJRZ &UHDPERDWOHDIFDSSHGVFUROOKDQGO 1745 ca 1745 ca Glen James Glasgow capped leaf scroll double plain, quite form, Baluster II, George jug, Cream YEAR MAKER DESCRIPTION 1745 ca LOCATION D A Aberdeen h on raised body, baluster jug, Cream SOURCE 152 Cream and Milk Containers 2005 p92 2005 Christies Glasgow March 1983 1983 March Glasgow Christies #50 collection Shaw MEQ 30 Sothebys Gleneagles August 25, 25, August Gleneagles Sothebys 1997 #151 John Bell advertisement advertisement Bell John #157 4, 1966 July Sothebys Grimwade The Queen's Silver 9 # Sothebys NY USA June 10-11, June 10-11, USA NY Sothebys 1980 #433 Nicholas Shaw Catalog 2001 p70 2001 Catalog Shaw Nicholas National Museums of Scotland Scotland of Museums National A.1981.306 HFUHVWDQG oof feet, scrollhandle 45/8" wide, 4.9 oz Nicholas Shaw Catalog details details Scotland of Museums National leaf capped double scroll handle, 6oz 5d 6oz handle, scroll double capped leaf IO\LQJGROSKLQRUPRQVWHUKHDGHGKDQGOHLQLWLDO³/´RWKHUVLG PRWWR³(;%(//248,(6´´ORQJR] Duchess of EdinburghDuchess of handle, chased evertedrimand spout,part a piece of 3 service chased rims, crest of Udney "All my hope is in God", 9" long, 25.3oz total total 25.3oz long, 9" God", in is hope my "All Udney of crest rims, chased Edinburgh Edinburgh lip everted handle scroll reverse capped leaf feet, paw 3 on boat, Cream #269 1984 27, March Christies Assayer Hugh Gordon 1750 ca 1750 ca 1750 ca Coline Allan 1750 ca Coline Allan Aberdeen Glen James Aberdeen form baluster jug, Cream Glasgow no details covered, small, pot, Milk no jug, Cream UK Collection Private 1992 #100 July London Christies 1750 ca 1750 ca Glen James Glasgow border, plain everted feet, paw cabriole voluted 3 on twice, mm boat, Cream 1749/50 Oliphant Ebenezer Edinburgh feet, paw on rim, chased shaped everted oval, boat, or sauce boat Cream 1748/49 Dempster Ker & Edinburgh h on 3 boat Cream 1747/48 Gordon Robert Edinburgh ½" 8 rim, chased handle, capped leaf feet, paw large on boat, Cream 95 p2 vol 1972 April Apollo 1747/48 Low Robert Edinburgh as Elizabeth Princess of crest no spout, rim, chased feet, pad on boat, Cream 1746/47 Ker James Edinburgh scroll double capped leaf attachments, trefid feet, paw 3 on boat, Cream 1746/47 James Ker YEAR MAKER DESCRIPTION 1746/47 James LOCATION SOURCE 1746/47 Gordon Robert Edinburgh ¼" 7 handle, dolphin with boat Cream Collection Noble 1746/47 Gordon Robert Edinburgh everted feet, paw lion on boats, cream dolphin-handled pair, boats, Cream 153 Compendium of Scottish Silver #941051 #941051 h 23, 1993 #125 1993 h 23, gative gative ecember 5, 1962 Lorentz Antiques Toronto Toronto Antiques Lorentz 1993 Canada Christies South Kensington Kensington South Christies 1RYHPEHU November Edinburgh Christies #40 1990 21, Christies D Christies Sothebys November 1962 #97 1962 November Sothebys AntiquesSimon Kaye &KULVWLHV/RQGRQ0DUFK Ne Christies $3 Munro Collection Collection Munro #155 Library Huntington Wark, NYC of Museum Metropolitan AC#13.42.70 USA Christies Glasgow June 11, 1991 1991 June 11, Glasgow Christies #170 The Phoenix Collection Collection Phoenix The Private Collection Collection Private 1952.1290 1952.1290 XFKH´ORQJ liage, shaped shaped liage, later chased with with chased later ece service,heavy leaf capped \LQJVFUROOKDQGOHKRRIIHHWó´ORQJ oof feet, chased with a band of fo SDUWRIDPL[HGSL silverhandle, gadrooning around the top 6.3oz 6.3oz andrising foot, elaborate serpentand scrollhandle, body URFRFRIORZHUVDQGVFUROOLQJIROLDWHVZDJVYDFDQWURFRFRFDUWR DQGVFUROOIHHWZDY\ULPDQGDIO\LQJVFUROOKDQGOHR] 4.1oz 4.1oz double scroll silver handle, chased rim and spout, 7.7oz 7.7oz spout, and rim chased handle, silver scroll double DOLRQUDPSDQWJUDVSLQJDVZRUGPRWWR³3DU9DOXHU´´ORQJ LQWHUWZLQHGVQDNHKDQGOHFUHVWDQGPRWWR´ORQJR] everted rim rim everted pad feet with shell attachments, dolphin handle, 6 3/4" long long 3/4" 6 handle, dolphin attachments, shell with pad feet 7 ¼" long, 6oz 5d 5d 6oz long, ¼" 7 Edinburgh Edinburgh details no jug, Cream Scotland of Museums National James McKenzie or James Mitchelson 1755/56 Gilchrist William /RWKLDQ 5REHUWVRQ Edinburgh (GLQEXUJK 9oz long, ½" 7 handle, flying rim, chased everted feet, paw 3 on boat, Cream Marc Sothebys &UHDPERDWRUVDXFHERDW 1760 ca 1760 ca Coline Allan Aberdeen scroll double capped swags, applied pedestal, on upright, milk jug, Mask 1754/55 Robertson & Lothian Edinburgh gadrooned rim, on molded and gadrooned boat, a sauce as listed boat, Cream 1754/55 Gordon Hugh Edinburgh shell 3 on outline, shaped of body shallow boat, a sauce as listed boat, Cream 1RWDYDLODEOH (GLQEXUJK &UHDPERDWSODLQRYDOERG\IO 1753/54 Low Robert Edinburgh of crest feet, shell handle, scroll double rim, chased boat, sauce or Creamboat 1753/54 Robertson & Lothian Edinburgh attachments, furry feet, paw on 3 body, shaped pear inverted boat, Cream 1752/53 Welsh John Edinburgh h and shell 3 on boat, Cream 1751/52 rectangle a in IM 1752/53 Gordon Robert Edinburgh scroll 3 on chasing, scroll and leaf rim with shaped boat, or sauce boat Cream YEAR MAKER DESCRIPTION 1751/52 LOCATION Lothian Edward Edinburgh chased, and engraved also rim, lip wavy everted chased boat, Cream SOURCE 154 Cream and Milk Containers 1974 ecember 20, #759494 #759494 Christies November 1969 #34 1969 November Christies 1970 23, March Christies AntiquesSimon Kaye Shrubsole NY USA 1981 E4087 1981 E4087 USA NY Shrubsole %RQKDP¶V7KH6FRWWLVK6DOH #23 2003 21, August Winter Catalog Shaw Nicholas 2004 p92 Collection Shaw 1983 March Glasgow Christies #78 Sothebys Scone Palace April 13, 1976 #128 0(4 Christies D Christies Negative #184 WY Stock Christies Edinburgh April 29, 29, April Edinburgh Christies 1992 Collection Private Sothebys November 11, 1971 1971 11, November Sothebys #111 London Koopman KWR] JR] oof feet, leaf capped scrollhandle, scroll oof feet, shaped evertedrim, leaf-capped no details details no Scotland of Museums National KDQGOHR] ULP´ORQJR] VLOYHUKDQGOH´KWR] &0óORQJR] FDSSHGGRXEOHVFUROOKDQGOHVKHOOIHHWKHDGHGE\PDVNVô´ handle, body later chased all over with heavy floral decoration decoration floral heavy with over all chased later body handle, IO\LQJVFUROOKDQGOHHQJUDYHGRQVLGHZLWKLQLWLDO0ORQ VXJDUERZORIVDPHPDNHUó´KWR]ZLWKERZO Edinburgh Edinburgh with sold flowers, of cluster with chased possibly foot, pedestal on jug, Milk 1762/63 Gairdner Alexander Edinburgh scroll double and scrolls, flowers of band chased feet, hoof 3 on boat, Cream 1762/63 Robertson & Lothian Edinburgh h 3 on boat, or sauce boat Cream 1762/63 1762/63 Robertson & Lothian Edinburgh Robertson & Lothian Edinburgh edging, leaf (repaired), handle flying boat, Cream scroll double capped leaf lip, molded body, shaped pear upright, jug, Cream USA1990 NY Robinson J 1761/62 Robertson & Lothian Edinburgh script engraved rim, notched everted shape, form pyri inverted boat, Cream 1760/61 Robertson & Lothian Edinburgh leaf and flutes, sprays floral with chased 2 crests, body, baluster jug, Cream 1760/61 Robertson & Lothian Edinburgh boat, Cream 1760 ca 1760 ca CK Canongate silver scroll double spout, and rim plain everted feet, hoof 3 on boat, Cream YEAR MAKER DESCRIPTION 1760 ca LOCATION 1760 ca Coline Allan Dempster Ker & Aberdeen feet pad 3 on sugar with Jug Cream SOURCE #285 1987 August Sothebys 1760 ca 1760 ca Campbell & Milne Glasgow h 3 on plain, oval, boat, Cream 155 Compendium of Scottish Silver LQHYRO U0DJD]LQH RLVVHXU0DJD]LQH vol 180, p138 p138 180, vol 94 p66 vol Apollo vol 53 1951 pXI pXI 53 1951 vol Apollo 27, August Gleneagles Sothebys 1990 p6 133 vol advertisement Bell John advertisement Bell #4 advertisement Bell John Nicholas Shaw Catalog Winter Winter Catalog Shaw Nicholas p93 2002/03 0(4 Christies London October 1988 1988 October London Christies #154 1971, 11, November Sothebys #79 1770 1953 IV vol Review Art Scottish òORQJR]G 3ULYDWH&ROOHFWLRQ ece tea service GHWDLOV $QWLTXHV0DJD]LQH details details Scotland of Museums National ERDWQRGHWDLOV &RQQRLVVHX chased around the upper body, part of a 3 pi a 3 part of body, upper the around chased ORQJR] bands of floral decoration and flutes, double scroll handle handle scroll double flutes, and decoration floral of bands PRWWRDQGFRURQHWò´ORQJR] &UHDPERDWQRGHWDLOV &RQQ *ODVJRZ &UHDPERDWQRGHWDLOV &RQQRLVVHXU0DJD]LQH Edinburgh Cream jug, flyinghandle, part3 a piece of serve dating 1758- Edinburgh Cream boat, oval,leaf capped flying scrollhandle, on3hoof feet, crest, 7D\ORU (GLQEXUJK &UHDPERDWFKDVHGZDY\ULPGDPDJHWRULP William Davie Davie William James Hill Hill James 3DWULFN5REHUWVRQ (GLQEXUJK 1769/70 William 1769/70 William 1770 ca Campbell & Milne FD 1RWDYDLODEOH1770/71 or Dempster William -DPHV:HOVK &UHDPERDWSDUWRIDVHW (GLQEXUJK &UHDP $QWLTXHV0DJD] 1767/68 Dempster Ker & Edinburgh spout, upswept foot, stepped body, shaped pear inverted upright, jug, Cream 1767/68 Dempster Ker & Edinburgh Douglas, of motto and crest rim, everted slightly feet, hoof 3 on boat, Cream 1765 ca 1765 ca & Clark Robert 1765/66 .HU 'HPSVWHU Welsh John (GLQEXUJK &UHDPERDWSDUWRIDVHWQR Edinburgh no boat, Cream YEAR MAKER DESCRIPTION 1763/64 LOCATION Gairdner Alexander Edinburgh swirled body, shaped pear upright, case, a in pot earlier an with jug, Cream SOURCE 156 Cream and Milk Containers , Boston Christies May 1, 2001 #236 1, 2001 May Christies Sothebys Gleneagles August 29, 29, August Gleneagles Sothebys 1978 #431 Sothebys Blair Castle September #57 1980 12, Collection Private p184 16, vol vol 93 p347 93 p347 vol Sothebys Gleneagles August 1992 #147 Collection Private 1992 February Magazine Life Country 31 135 p vol 1964 13, #73 Collection Shaw Bonham's Sale 10914, #12 10914, Sale Bonham's Winter Catalog Shaw Nicholas 2004 p92 May/June 1968 vol 143 vol 1968 May/June LWLDOV³6*:´ ece set,no details ece service,no details Private Collection IRRWGRXEOHVFUROOKDQGOHIXOO\PDUNHGRQRXWVLGHRIIRRWLQ ´KWR] inan oval, part apiece of 4 tea service handle, 7" long, 5.3oz 5.3oz long, 7" handle, Edinburgh Cream jug,upright, with loophandle, on spreading oval base, crestand motto Edinburgh Edinburgh details no a set, of part boat, Cream Magazine Life Country William Rynd Rynd William William Dempster Dempster William 1785 ca 1785 ca 1789/80 Anderson Robert available Not Inverness 1789/91 handle snake panels, Cunningham P fluted & with W and foot body upright, jug, Cream Edinburgh pi a 4 of part boat, Cream #116 1991 Finlay no details a set, of part boat, Cream 1954 July Magazine Life Country 1790 ca 1790 ca Jr Stewart Alexander 1790/91 Inverness or Robertson William no details a set, of part boat, Cream 1934 Magazine Connoisseur 1791/92 Cunningham P & W Edinburgh decoration cut bright handle, loop sided, 10 shaped, helmet jug, Cream Parsons and Firestone 1791/92 Robertson William Edinburgh 1793/94 details no a set, of part jug, Cream available Not Edinburgh 15d 3oz style, Adam tall, feet, on boat, Cream #98 1991 Finlay 1983 March Glasgow Christies 1783/84 or Davie William 1784/85 I Cunningham P & W Edinburgh pedestal circular engraving, cut bright shaped, helmet covered, jug, Cream 1779/80 Hewitt James Edinburgh scroll capped acanthus rim, notched everted shape, pear inverted boat, Cream YEAR MAKER DESCRIPTION 1775 ca LOCATION McEwan James Glasgow pi a 3 of part boat, Cream SOURCE 157 Compendium of Scottish Silver Christies July 12, 1989 12, 1989 July Christies Sothebys Gleneagles August 27, 27, August Gleneagles Sothebys 1979 #205 N & I Franklin Collection Private 2004 Catalog Shaw Nicholas p103 Edinburgh Sothebys Gleneagles September 1, 1981 #444 1994 #91 1981 25, March Christies vol 181 #112-113 #112-113 181 vol Sothebys Scone April 19, 1977 1977 19, April Scone Sothebys #54 William Walter Ltd, London London Ltd, Walter William 1994 advertisement Shreves eced mixed XDUHIRRWFUHVWDQGPRWWRRI+XWWRQ QGOHRYDOEDVH´GL´KW +XQWOH\+RXVH0XVHXP ed, bright cut, body fluted into panels, 2 foliate foliate 2 panels, into fluted body cut, bright ed, FDUWRXFKHVUHHGHGKDQGOHRYDOVSUHDGLQJEDVHô´KWR] 6 ¼", 6.1oz 6 ¼", 6.1oz tea service service tea with later crest and motto, reeded loop handle, oval pedestal base base pedestal oval handle, loop reeded motto, and crest later with Cream boat, part a piece of 3 set,no details square pedestal base, with sugar basket, 6 ½" ht ½" 6 basket, sugar with base, pedestal square likely James Douglas Douglas James likely Edinburgh Edinburgh details no boat, Cream 1991 Ltd, Walter William Edinburgh Creamer, part a of set, Adam style, attributed to James Dempster but more Assayed Edinburgh James Douglas Douglas James James Douglas Douglas James 1797/98 I Cunningham P & W Edinburgh shap vase jug, Cream &KDUOHV%HQG\ (GLQEXUJK &UHDPMXJKHOPHWVKDSHGRQVT 1796/97 Gairdner Alexander Edinburgh pi a 4 of part cut, bright fluting, concave outline, oval boat, Cream 1796/97 Robertson William 1796/97 Edinburgh Cunningham P & W detail no a set, of part style, Adam boat, Cream Edinburgh no detail a set, of part jug, Cream : 3&XQQLQJKDP, (GLQEXUJK &UHDPMXJURXQGWRSSHGKD London Ltd, Walter William 1973 29, November Sothebys 1795 ca 1795 ca Byres William Banff details no beak, sparrow upright, jug, Cream 1987 7, May Life, Country 1795/96 M & G 1795/96 Spence Alexander Edinburgh cartouche drapery worked wriggle and cut bright shaped, helmet jug, Cream 1795 ca 1795 ca or Dempster James YEAR MAKER DESCRIPTION 1793/94 ID LOCATION SOURCE 1795 ca 1795 ca available Not 1795/96 Bain George Edinburgh handle, loop high engraving, cut bright body, shaped helmet boat, Cream details no a set, of part Creamer, 38 p50 vol Magazine Antiques 158 Cream and Milk Containers p295 g Winter g Winter Nicholas Shaw Catalog Winter Winter Catalog Shaw Nicholas p86 2002/3 Antiques Shaw Nicholas 2004 advertisement Holmes 1989 #42 1945.39 26, 1988 #76 1988 26, John Bell advertisement advertisement Bell John Scottish Art Review vol VIII VIII vol Review Art Scottish #2 1961 p33 advertisement firm Glasgow Huntley House Museum Huntley House HH3488/70 Edinburgh 2002/03 p85 p85 2002/03 MEQ 635 ece set, Arms Kincragie of Sothebys Hopetoun April House ece set,rectangular, with brightdecoration cut Antiques Magazine vol 41, details details Scotland of Museums National decoration, 4 ½" ht, 6.76oz 4 ½" ht, decoration, 6.76oz 6DQGHPDQRI3HUWKò´KWR] squared handle, off part a piece of 3 tea service ´;ó´;´KW Perth Perth Edinburgh details no a set, of part boat, Cream details no jug, Cream April House Hopetoun Sothebys Scotland of Museums National Assayed Edinburgh Simpson 1807/08 McKay James 1808/09 1808/09 Howden Francis & Edinburgh struck) (over K R no details a Edinburgh set, 1808/09 of Cunningham part boat, Cream no details a set, of part boat, Cream p17 100 1974 vol Apollo #20 46, vol Magazine Antiques 1807/08 McHattie George Edinburgh cut bright Perth, of Sandman of motto and crest feet, 4 ball on jug, Milk 1806/07 McHattie George Edinburgh of motto and crest feet, ball 4 on body engraved cut, bright jug, Milk 1806/07 Cunningham P & W Edinburgh pi a 3 of part boat, Cream 1804/05 Spence Alexander Edinburgh pi a 4 of part jug, Cream 1802/03 Howden Francis Edinburgh body, upper the to applied girdles 3 bottom, the on flat upright, jug, Cream 1800/01 Fenwick & McHattie Edinburgh bowl, sugar a with base, oblong oval, handle, top square jug, Cream YEAR MAKER DESCRIPTION 1798/99 LOCATION McKay James Edinburgh no jug, Milk SOURCE 1800/01 1800/01 Cunningham P & W Edinburgh Cunningham P & W Edinburgh no detail a set, of part boat, Cream 6.5oz ht, 6" flowers, of frieze a with chased shaped, helmet jug, Cream Catalo Shaw Nicholas 71 vol 1957 Magazine Antiques 159 Compendium of Scottish Silver 1976 #38 1976 1934 pIV 1934 pIV K.2004.205 K.2004.205 John Bell advertisement advertisement Bell John advertisement Shreve Sothebys Gleneagles August 1988 #473 24, August Gleneagles Sothebys 1997 #122 #246 1990 #86 p 1328 advertisement Shreve 2002/03 p88 p88 2002/03 MEQ 1608 1608 MEQ ece service Apollo s Paterson as a historical award award historical a as Paterson s Scotland of Museums National GHWDLOV /\OH$QQXDO5HYLHZS ece set, on bun feet, initial "H" Sothebys February 26, no details details no Scotland of Museums National PRWWREHORZ³7+528*+´ piece service Glasgow Glasgow 3 a of part feet, ball 4 on interior, gilt form, rectangular ovalled jug, Cream Grierson 1814/15 McKay James Edinburgh 3 pi of part band, gadrooned feet, 4 ball on jug, Cream 1816-19 McDonald James Edinburgh no details a set, of part boat, Cream 76 vol 1959 Magazine Antiques 1810 ca 1810 ca and Newlands 1810/11 Fenwick George Edinburgh 1811/12 *HRUJH)HQZLFN no details a set, of part boat, Cream McKay James (GLQEXUJK1812/13 &UHDPERDWSDUWRIDVHWQR McKay James Edinburgh no details a set, 1814/15 of part boat, Cream Edinburgh Cunningham P & W no details a set, of part boat, Cream Edinburgh Jame Mr. to engraved Jug, Cream 1, 1991 May Edinburgh Christies May House Hopetoun Sothebys 115, vol Magazine Antiques YEAR MAKER DESCRIPTION 1808/09 LOCATION McPherson Dirk & Edinburgh 6.6oz ht, 4" feet, ball 4 on jug Milk SOURCE Winter Catalog Shaw Nicholas 1809/10 1809/10 McKay James 1809/10 Fenwick George Edinburgh Fenwick George Edinburgh no details a set, of part boat, Cream Edinburgh pi a 3 of part boat, Cream jug, Milk 87 p 85, 1967 vol Apollo 1809/10 Fenwick George Edinburgh a coronet, below arms of coat handle, full off squared rectangular, jug, Cream 160 Cream and Milk Containers DAG003152 DAG003152 , 1986-114 1986-114 , MEQ 1323 1323 MEQ p106 1987 #305 MEQ 1311 1311 MEQ p 24 130 vol Fogg Art Museum Harvard Leverette 1848.49 University, House AB Galleries Galleries 1985 1591 MEQ MEQ 635 no details details no Scotland of Museums National details details Scotland of Museums National details details Scotland of Museums National VFUROOHGFDUWRXFKHSDUWRIDSLHFHVHUYLFH´KW Edinburgh Cream boat, part a piece of 3 set,no details Sothebys File Photo Edmonstoun Edmonstoun 1823/24 McKay James 1824/25 McKay James Edinburgh no details a set, of part boat, Cream Edinburgh no details a set, of part boat, Cream vol87 1968 April-June Apollo August Gleneagles Sothebys 1820/21 available Not 1820/21 Alexander no details a set, of part boat, Cream 1952 Magazine Connoisseur 1820/21 Cunningham P & W Edinburgh boat, Cream 1820 ca 1820 ca Jamieson William 1820 ca Aberdeen Cameron Alexander 1820 ca Dundee details no A,B,D,WJ, WJ, marked jug, Cream Anderson Robert 1820 ca no detail jug/boat, Cream Inverness a 1820 Livingstone Edward Dundee motto and crest handle, snake body, paneled jug, Cream McKay James no details a set, of part boat, Cream Edinburgh and Museums Aberdeen no jug, Milk Scotland of Museums National Art and Museums Dundee #111 1991 Finlay YEAR MAKER DESCRIPTION 1817/18 LOCATION McKay James Edinburgh no jug, Milk SOURCE 1818/19 1819/20 McKay James 1819/20 McKay James Edinburgh I Cunningham P & W Edinburgh Edinburgh no details a set, of part boat, Cream rim, gadrooned handled, scroll capped leaf body, fluted oval jug, Cream no details a set, of part boat, Cream 1990 Gleneagles Sothebys 1990 Gleneagles Sothebys 161 Compendium of Scottish Silver ugust 28, 1959 #86 1959 ugust 28, ational Museums of Scotland Scotland of Museums ational ational Museums of Scotland Scotland of Museums ational Christies NY June 28, 1989 28, June NY Christies Christies November 23, 1983 #92 1983 23, November Christies 1988 #484 1988 #484 1990 #101 1990 #101 1988 #77 1988 #77 advertisement Bell #304 1988 #81 1988 #81 MEQ 854 MEQ 949-951 1969 1969 949-951 MEQ 1988 #83 p47 1977 ece set,no details ece set,no details Sothebys Gleneagles August 27, ece set,no details ece set,no details Sothebys Gleneagles August 29, foot andrim N Edinburgh Edinburgh details no a set, of part boat, Cream April House Hopetoun Sothebys Perth Cream jug,part a piece of 3 service, no details N Edinburgh Cream boat, part a piece of 3 set,no details Sothebys A Edmonstoun Edmonstoun Assayed Edinburgh Adam Mossman YEAR MAKER DESCRIPTION 1825/26 LOCATION Beech George Edinburgh pi a 3 of part boat, Cream SOURCE 1834/35 Co Elder & Edinburgh pi a 3 of part boat, Cream 1835/36 C0 Elder & Edinburgh pi a 4 of part boat, Cream 1825/26 McKay James 1825/27 available Not Edinburgh 1825 ca no details a set, of part boat, Cream Murray Charles 1826/27 Alexander Perth no details a set, of part boat, Cream no details bowl, a with boat, Cream April House Hopetoun Sothebys p2 86 vol 1967 August Apollo 1, 1991 May Edinburgh Christies 1827/28 Sons & Gray Robert Glasgow gadrooned jug, Cream 1828/29 II Keay Robert 1829/30 McKay James 1829/30 McKay James Edinburgh 1832/33 no details a set, of part boat, Cream Co Elder & Edinburgh ht 6" milk jug, Hot Edinburgh pi a 3 of part boat, Cream April House Hopetoun Sothebys #34 Catalog Bourdon-Smith J 1832/33 Marshall William Edinburgh details no a set, of part boat, Cream August Gleneagles Sothebys 1838/39 struck) (over M A 162 Cream and Milk Containers DAG008803 DAG008803 1962-701-2 1962-701-2 ational Museums of Scotland Scotland of Museums ational Huntley House Museum Huntley House 36/60 LR Edinburgh AB Galleries Galleries 1964 736-738 MEQ Museum Huntley House HH2809/65 Edinburgh Autumn 1993 #36 p40 #36 1993 Autumn Edinburgh HH1666/56 HH1666/56 Edinburgh HFHVHUYLFH´;´GL;´KW +XQWOH\+RXVH0XVHXP P6LU:DOWHU6FRWW¶V³/D\RIWKH/DVW 0LQVWUHO´SDUWRIDSLHFHVHUYLFH´;ó´ ´;´;´KW Perth Cream jug,nodetails Dundee Museums and Art Perth Cream jug,part a piece of 3 service, no details Edinburgh Cream jug, octagonal, butterfly decoration, part a piece of 4 service, Edinburgh 9oz inscription, script gothic with pail Cream N Catalog Bourdon-Smith J Assayed Edinburgh Assayed Edinburgh Sons Cunningham 1992/93 Hope Adrian Edinburgh no details Creamer, and Museums Aberdeen YEAR MAKER DESCRIPTION 1839/40 LOCATION II Keay Robert SOURCE 1842/43 & II Keay Robert 1842/43 Marshall 1844/45 Chisolm & McKay 1846/47 William Edinburgh McKay James & no details a set, of part boat, Cream 1872/73 McKay Edinburgh no details a set, of part boat, Cream 1983 Annual Review Lyle 1983 Annual Review Lyle 1874/75 Meldrum and Pollack Edinburgh pi a 3 of part details, no jug, Cream 1RWDYDLODEOH *ODVJRZ &UHDPMXJFKDVHGZLWKVFHQHVIUR 163 Compendium of Scottish Silver 164 Cruets CruetsCRUETS Plate 18. A Cruet 1760ca by Milne & Campbell, Glasgow. Courtesy of The Maple Swan Collection 165 Compendium of Scottish Silver 0DJD]LQHYRO 6RWKHE\V*OHQHDJOHV$XJXVW 6RWKHE\V6FRQH3DODFH$SULO 6RWKHE\V-XQH +RZRI(GLQEXUJK Scotland of Museums National 0(4 &KULVWLHV1<$SULO Christies May 18, 1977 18, 1977 May Christies &KULVWLHV-XO\ 6RWKHE\V$XJXVW Sothebys November 16-17, 1981 1981 16-17, November Sothebys sales Sothebys 6RWKHE\V*OHQHDJOHV$XJXVW VERWWOHV HRQVFUROO ,,RQVKHOODQGVFUROOIHHWDSSOLHGZLWK VWHUFRYHUVERWWOHVPPRQO\[ ZLWKFHQWUDOKDQGOH /RQGRQFD ERWWOH WHUKDQGOHFDUWRXFKHZLWKFUHVWQRERWWOHVRU nquefoil, base plate and bottle rings connected by by connected rings bottle and plate base nquefoil, ULQJVDSSOLHGZLWKDFUHVWHGIORUDODQGURFRFRGHFRUDWHGSODTX and shell supports, with silver capped cut glass bottle, crest of Blair or Scott, Scott, or Blair of crest bottle, glass cut capped silver with supports, shell and ´KWR] FDVWHUVò´KWR] KW DYDFDQWFDUWRXFKHGRXEOHVFUROOKDQGOHVLOYHUPRXQWHGJODV ´ORQJR]G vinegar bottles, frame with ring holders, central baluster screw on handle and and handle on screw baluster central holders, ring with frame bottles, vinegar one arms on of coat engraved an enclosing cartouches rococo supports, shell side, vase 3 shaped casters engraved with identical crests and mottosrepeated RQFDSVPDUNHGRQVWDQGDQGFDVWHUEDVHVó´KWR]GDOO central handle, also applied with later initial and crested oval shield, vase vase shield, oval crested and initial later with applied also handle, central shaped castors eachapplied with a girdle bottles at the glass shoulder, cut covers later pierced with work, diaper and foliage stylized of panels alternate ZLWKVLOYHUPRXQWV´KWR] RIZHLJKDEOHVLOYHU rococo engraved armorial supports, shell pad above brackets wrapped leaf casters and bottles stem, turned with handle ring scroll central cartouches, PLVVLQJò´KWR] CRUETS CRUETS Edinburgh Edinburgh and oil glass cut mounted silver of pair and 3 casters with frame, Cruet $VVD\HU+XJK *RUGRQ +XJK*RUGRQ -DPHV0LWFKHOO (GLQEXUJK (GLQEXUJK &UXHWVHWRIFDVWHUV &UXHWIUDPHFLQTXHIRLOGHVLJQ $QWLTXHV .HU 'HPSVWHU (GLQEXUJK &UXHWFLQTXHIRLOVKDSHEDOXV (GZDUG/RWKLDQ FD -DPHV.HU (GLQEXUJK &UXHWVHWFDVWHUVUHSDLUVWRFD 1736ca available Not +XJK*RUGRQ Edinburgh FD cruet Warwick (GLQEXUJK -DPHV*OHQ :DUZLFNFUXHWIUDPHFL *ODVJRZ 2LODQGYLQHJDUFUXHWIUDPH*HRUJH 1983 p568 Review Annual Lyle 1736/37 I Marshall William Edinburgh and holders bottle ring the supporting base cinquefoil frame, cruet Warwick YEAR MAKER DESCRIPTION LOCATION SOURCE 166 Cruets Sothebys July 18, 1963 #342 1963 18, July Sothebys AntiquesSimon Kaye Sothebys July 18, 1963 #342 1963 18, July Sothebys AntiquesSimon Kaye Christies May 3, 1995 #65 #65 3, 1995 May Christies Christies Glasgow May 13, 1997 May Glasgow Christies 27, March Glasgow Christies 1984 #255 15, November Glasgow Christies 1984 #192 Christies February 23, 1972 #79 23, 1972 February Christies Sothebys June 24, 1965 #29 1965 June 24, Sothebys Edinburgh of How Sothebys Gleneagles August 29, 29, August Gleneagles Sothebys 1974 #112 UHVWò´KW PLVVLQJò´KW supports, casters of baluster form, 2 glass bottles with unmarked silver silver unmarked with bottles glass 2 form, baluster of casters supports, 41.5oz mounts, crested escutcheon, casters of baluster form with acorn finials, fitted with 2 2 with fitted finials, acorn with form baluster of casters escutcheon, crested 41.5oz mounts, silver unmarked with bottles glass detachable baluster handle, with with inverted 3 cartouche pear casters bottles, withpierced glass cut domed mounted silver 2 finials, baluster and covers bottle mottos, within monograms later with casters Stirling, of arms of coat PRXQWVZLWKFUHVWDQGPRWWRó´KWR] DV\PPHWULFFDUWRXFKHILWWHGZLWKFXWJODVVERWWOHVFDVWHUV 27oz cartouche, engraved with a crest, central support surmounted by a scrolled a scrolled by surmounted support central crest, a with engraved cartouche, bottles, mounted silver and glass cut later 5 of set composite handle, ring ó´R] at one side, central ring handle, later glass bottles, 3 with silver covers, with with covers, silver with 3 bottles, glass later handle, ring central side, one at 29oz coronet, and motto crest, 26.8oz 26.8oz VXSSRUWVQRERWWOHRUFDVWHUVZLWKDSSOLHGFDUWRXFKHZLWKDF the bottles) bottles) the Edinburgh Edinburgh scrolled asymmetric with frame cinquefoil feet, shell 4 on stand, Cruet Assayer Hugh Gordon 1757/58 Gordon Robert Edinburgh shell and handle central holders, ring escutcheon, crested a with frame, Cruet 1756/57 Gordon Robert Edinburgh a with supports, shell and handle central holders, ring with frame, Cruet 1755 ca 1755 ca Dempster Ker & 1754/55 Ged Dougal Edinburgh cartouche, rococo applied feet, shell capped leaf 4 on stand frame, Cruet 1755/56 Gordon Robert Edinburgh plain handle, scroll with stem baluster feet, 4 shell on frame Cruet 1754/55 Dempster & Ker Edinburgh cartouche scroll and flower rings, bottle molded feet, shell 4 on frame, Cruet 1753/54 Dempster Ker & Edinburgh and shell scroll handle, baluster central shape, cinquefoil frame, Cruet YEAR MAKER DESCRIPTION 1753/54 LOCATION 1753/54 Aytoun William 1753/54 Gordon Robert Edinburgh Gordon Hugh details no set, Cruet Edinburgh no details set, Cruet Edinburgh (minus 40oz ht, ¼" 10 bottles, 2 and 3 casters with frame cruet Quinquefoil SOURCE 66 vol July Magazine Antiques 1960 Magazine Antiques 167 Compendium of Scottish Silver Collection Collection MEQ 617 1962.1025 1962.1025 617 MEQ Christies July 11, 1979 #219 11, 1979 July Christies 27, August Gleneagles Sothebys 204 1979 # Sothebys Blair Castle September #40 1980 12, #164 1986 24, June Christies Collection Private Huntley House Museum Huntley House HH1292/51 Edinburgh 1064 MEQ Sothebys October 28, 1976 28, October Sothebys MEQ 898 1130 MEQ R] RXFKHô´KW VFHQWHUKDQGOHFLUFXODUEDVH´KW on shell feet, 3 casters, 2 bottles, 2 of the casters by by casters the of 2 2 bottles, casters, 3 feet, shell on at shaped, with oil and vinegar vinegar and oil with at shaped, Scotland of Museums National ece The Maple Swan Collection details details Scotland of Museums National with armorials on 4 open work shell feet, 10 ½", 30oz :LOOLDP'HPSVWHUURFRFRFDUWRXFKHZLWKDUPVRQIUDPHò´KW bottles) (without 14.1oz HVFXWFKHRQHQJUDYHGZLWKLQLWLDOV³$3&´ IRRWHGVFUROOVXSSRUWVFHQWUDOWXUQHGULQJKDQGOHYDFDQWFDUW ´DFURVVWKHFXSV crested casters by Samuel Wood, London, over striking that of William William of that striking over London, Wood, Samuel by casters crested with Wood), striking over Dempster be it could (or Edinburgh of Dempster 55oz bottles, glass mounted silver later Edinburgh Edinburgh shaped vase 2 borders, gadrooned feet, shell and scroll 4 on frame, Cruet Edinburgh cinquefoil, frame, Cruet Edinburgh Edinburgh bo frame, Cruet Probably William William Probably Dempster Dempster William Dempster William YEAR MAKER DESCRIPTION 1760 ca LOCATION Campbell & Milne Glasgow feet shell on cartouche, vacant 2 bottles, and casters 3 with stand set, Cruet Swan Maple The SOURCE 1761/62 Welsh James 1761/62 WD Edinburgh no set, Cruet 1763/64 and Dempster Ker & 1765 ca Campbell & Milne 1778/79 Glasgow or Davie William bottles, glass mounted silver original 2 with bottles 2 for frame, Cruet 1832/33 Paton George 1881/82 A L Edinburgh cups 6 with Egg cruet Edinburgh pi 3 set, Cruet Scotland of Museums National 1762/63 Gordon Robert Edinburgh cartouche asymmetrical with quinquefoil bottles, or casters no frame, Cruet 1765 ca 1765 ca Graham Adam Glasgow 4 shell- by joined rings bottle and plate base shaped sexfoil frame, Cruet 1810/11 McKay James -DPHV0F.D\ Edinburgh details no Egg cruet, (GLQEXUJK (JJFUXHWVWDQGJLOWOLQHGFXS Scotland of Museums National 168 Cups CupsCUPS Plate 19. A Tumbler Cup by Henry Bethune, Edinburgh. Courtesy of The Phoenix Collection. Photograph by Janice M Dietert 169 Compendium of Scottish Silver 9, 1972 #138 Finlay 1991 #33 Finlay 1991 Royal Ontario Museum, Toronto Museum, Royal Ontario 928.44 Canada Christies February 1952.48 Sothebys1973 May 17, #178 St Mary's College, University of University St Mary's College, Galleries ABDAG001038 Finlay 1991 #9 Finlay 1991 of Scotland National Museums Scottish#18 Finlay 1991 aved scalloped edges, slightly edges, scalloped aved ed wood foot and baluster stem, wood foot and ed details of Scotland National Museums p Location unknown unascribed, possibly partly possibly unascribed, century rim, straps and foot and straps rim, century th mounted, 3 vertical silver spines to a silver rim, a silver to vertical silver spines 3 mounted, by 3 hinged straps, engr by 3 hinged straps, Tulloch Coconut Cu ft to Provost Duff, no ft further , four marks, mm 2X’s mm , four marks, UK Private Collection p, silver mounted, on circular turn on circular silver mounted, p, t cup, no details no t cup, UK Private Collection onut cup, no details onut cup, no initials “MMD” on rim and “RMD” opposite rim, 4” ht, 3 ¼” di 4” ht, and “RMD” opposite rim, initials “MMD” on rim silver mounts with engraved and scalloped rims, engraved with initials, marks engraved rims, and scalloped with engraved silver mounts ht 4 ¼” – 5X’s – mm flared lip with corded girdle, repeated on trumpet foot, marked on base only marked on flared foot, girdle, repeated trumpet lip with corded ht, 5 ¾” with M crowned, CUPS probably partly Scottish with 16 probably ate Coconut cup, The inburghWatson Mazer, fleur-de-lis Themark Edinburgh footplain trumpet and a plain rim Mazer, St. Mary's The p19 Finlay 1991 nnistoun Edinburgh Coc MAZERS Auchinleck COCONUT 1720 ca ML Inverness gi Coconut cup, 1690 cadated1711 Scott I William Not available Banff Coconut cup 1711, dated cup, Coconut 1690 ca Matthew Colquhoun Ayr cu Coconut 1550 ca Alexander 1670 ca Not available Provincialheld nut Coconut cup, 1640 ca1655 ca II Gairdyne Robert Scott Elder William Dundee1655 ca Banff Robert Banks Coconu Coconut cup, with silver mounts Canong and Museums Aberdeen 1520-50 Not available Ed YEAR MAKER1600 ca1637-39 Lindsay Thomas Andrew De LOCATION Dundee DESCRIPTIONdetails Coconut cup, no SOURCE 1320 caUK Private Collection Not availableothers, and Fitzgilbert for John ornament with augmentation Mazer, The Bute 170 Cups Finlay 1991 #32 Finlay 1991 Sothebys London1987 June #199 Holland p209 1992 Asprey London Private Collection Private Collection UK Private Collection of On loan to National Museums Scotland as QL 1987.12 Park Lane Exhibition 1929 #668 Godfrey of Sir Provenance Christies March 26, 1958 #162 Christies May 17, 1927 #116 Ltd Lumley Thomas W. Randolph Herst Collection W. Randolph S J Phillips London Finlay 1991 p19, 22 St Andrews of Scotland National Museums MEQ 148 1954.691 , slightly spreading sides, engraved sides, , slightly spreading e the maker as James Dennistoun dated Dennistoun as James maker e the r How of Edinburgh er cup, tapering, large, circular form circular large, tapering, er cup, 1617 but he was Deacon at the time he but 1617 under the teeth, many sources stat sources teeth, many the under with arms and initials "W.C.M." within crossed plumes mantling Arms of Arms mantling plumes within crossed and initials "W.C.M." with arms ht, 4" di, 5.6oz 2 Crockett, 5/8” Edinburghcloth of originally with traces mid-rib, dentine with bowl, Mazer, all silver Edinburgh The Craigievar Mazer Finlay 1991p21 Edinburgh The Fergusson Maze TUMBLER CUPS James CrawfuirdJames I Cleghorne Thomas EdinburghDeacon James Dennistoun no details Mazer, p24 Finlay 1991 RL Cok III James Deacon George II Heriott Edinburgh Mazer, no details Apollo August 1977 vol 100, p97 YEAR (continued) MAKER LOCATION DESCRIPTION MoncurThomas Glasgow Tumbl James GrayJames Not available GrayJames Canongate Mazer The Tulloch John Mosman CanongateAdam Acting Deacon Craig The Galloway Mazer not a mazerpossibly Cup, McLeod Mazer, The p22 Finlay 1991 UK Private Collection p245 #353 Clayton’s Dictionary 171 Compendium of Scottish Silver 949 949 #18 1908 #89 1908 26, 1933 #68 26, 1933 ecember 10, 7UHDVXUH([KLELWLRQ &OD\WRQ¶V'LFWLRQDU\S Christies July 17, 1963 #137 17, 1963 July Christies 1963 auction Christies Connoisseur 1964 Christies February 17, 1963 #137 17, 1963 February Christies Noble Collection Collection Noble 2004 Catalog Shaw Nicholas p93 Christies July 3, 1984 #190 #190 3, 1984 July Christies #487 Collection How 6FRWWLVK$UW$FDGHP\([KLELW 1939 #483 Collection Noble D Christies #101 How Collection Collection How 1991 #222 1990 24, October Christies G VWUDLJKWVLGHVVOLJKWO\HYHUWHGOLS QJUDYHGVFULSW-%òKWGL ZLWKLQLWLDOV³,:0$´ò´KWR]G &OD\WRQ&KULVWLHVS RIDVWDJDQGPRWWR6LGXHVTXLVFRQWUD 6RWKHE\V1RYHPEHU JUDYHGLQLWLDOVòKWR] 6RWKHE\V*OHQHDJOHV$XJXVW HYHUWHGOLSòGLR]GERWK R]GHD &KULVWLHV-XO\ engraved with initials, mm pellet between the initials and mullet below in below mullet and initials the between pellet mm initials, with engraved VKDSHGVKLHOGSXQFK QRWLQ-DFNVRQ ò´KW´GLR] OHWWHU2LQLWLDOV³-%´WRWKHULJKWRIWKHPDUNò´KW R]G (continued) (continued) FD -RKQ/XNH *ODVJRZ 7XPEOHUFXS:LOOLDPDQG0DU\ODUJH 1694/95 1694/95 Luke John Luke John Glasgow Glasgow 5d 5oz cup, Tumbler date repeated, IL mark, town punch, edged a wavy in IL - marks cup, Tumbler 1992 Exhibition How YEAR MAKER DESCRIPTION LOCATION SOURCE FD 5REHUW*DLUG\QH 3HUWK 7XPEOHUFXSSODLQIRUPHQJUDYHG -DPHV3HQPDQ (GLQEXUJK 7XPEOHUFXSSODLQòGL -RKQ/XNH *ODVJRZ $UW 7XPEOHUFXSDSSDUHQWVSOLWUHSDLUH 7KRPDV&OHJKRUQH (GLQEXUJK 5REHUW,QJOLV 7XPEOHUFXSHYHUWHGOLSHQ (GLQEXUJK 7XPEOHUFXSVSDLUZLWKFUHVW 7KRPDV&OHJKRUQH (GLQEXUJK 7XPEOHUFXSVSDLUVOLJKWO\ 172 Cups #125 #125 Sothebys September 25, 1973 #5 1973 25, September Sothebys 1995 1970 29, October Sothebys Goodwin's Antiques 1992 1992 Antiques Goodwin's Collection Phoenix The 1939 #447 Robertson HN Major Provenance #294 1988 21-22, advertisement Argentum #193 1987 13, October Christies Nicholas Shaw Catalog 2005 p87 2005 Catalog Shaw Nicholas ò´KWR] ´GLR] &KULVWLHV(GLQEXUJK1RYHPEHU WXFNHGLQEDVHHQJUDYHGZLWKLQLWLDOV³-:´ LWKVOLJKWO\IODUHGULPò´KWR] 6RWKHE\V$SULO DQG³.6´LQVFULSW´KWR] decorationnear lip, crest in an oval within drapery mantlingand crossed IROLDWHVSUD\Vô´KWR] WKHRWKHUE\$\WRXQZLWKDQLQGLVWLQFWGDWHOHWWHU letter but assayer for 1717-19 time period, crest and motto "Juvant Aspera Aspera "Juvant motto and crest period, time 1717-19 for assayer but letter Fortes" for Steuert Allenton of 5.6oz 5.6oz Edinburgh Edinburgh Ker by on lip, everted slightly with each cups, matching 2 cups, Tumbler Aytoun Aytoun 1745 ca 1745 ca Glen James 1747/48 1747/48 Ged Dougal Glasgow Dougal Ged 'RXJDO*HG Edinburgh no everting plain pair, cups, Tumbler Edinburgh 17d 4oz ht, ¾" 2 "Calm", motto and crest with cup, Tumbler (GLQEXUJK lip everted cup, Tumbler 7XPEOHUFXSVOLJKWO\HYHUWHGOLS 1977 22, September Sothebys Edinburgh, Antiques Goodwin's 1981 Review Lyle Annual FD 'RXJDO*HG1743/44 Clark James 1743/44 (GLQEXUJK William & Ker James 7XPEOHUFXSPDUNVYHU\UXEEHG Edinburgh 1743/44 (GZDUG/RWKLDQ no details cup, Tumbler Oliphant Ebenezer (GLQEXUJK Edinburgh 7XPEOHUFXSSODLQFLUFXODUZ cup bright of band narrow base, in tucked lip, everted slightly cup, Tumbler p584 122 Magazine Antiques 1720 ca 1720 ca McKenzie Simon Inverness ht 1/6" 2 mark, "MK" cup, Tumbler Exhibit Academy Art Scottish 1702/03 1705 ca Inglis Robert 1717-19 Inglis Robert Edinburgh Bethune Henry ht Edinburgh ¾" 2 initials, lip, everted slightly cup, Tumbler Edinburgh 10d 7oz ht, ¾" 2 "RS", initials cup, Tumbler no date apparently interior, gilt motto, and lip, crest everted cup, Tumbler #95 1964 24, April Christies #10 5, 1972 July Christies YEAR MAKER DESCRIPTION 1700/01 LOCATION II Luke John Glasgow ht, ¾" 2 front, the on initials "MWGJB" the with engraved cup, Tumbler SOURCE 173 Compendium of Scottish Silver 1974 1974 HFHPEHU &KULVWLHV/RQGRQ1RYHPEHU 1993 1993 Apollo MEQ 797 0(4 6RWKHE\V(GLQEXUJK$SULO Sothebys Gleneagles September 1, 1981 #454 6RWKHE\V'HFHPEHU 6RWKHE\V0DUFK $UW,QVWLWXWHRI&KLFDJR 1$5 MEQ 796 6RWKHE\V-XQH AntiquesSimon Kaye #187 ô´KW ] 1DWLRQDO0XVHXPVRI6FRWODQG XFKHZLWKFUHVWô´KW RQWKHERWWRP 1DWLRQDO0XVHXPVRI6FRWODQG DQGWXFNHGLQEDVHLQLWLDOVLQVFULSW³-:´ OWLQWHULRUPPLQGLVWLQFWô´GLR] &KULVWLHV' -%RXUGRQ6PLWK/RQGRQ YHUWHGOLSFKDVHGZLWKDEDQGRIOHDYHVDQG WO\WDSHULQJERGLHVURFRFRERUGHUVRIVFUROOVZKHDW no details details no Scotland of Museums National IORZHUKHDGVR]ERWK HDUVDQGEXQFKHVRIJUDSHVODWHUFUHVWDQGPRWWR´KWR] ZLWKDFUHVW SHOLFDQLQSLHW\ EHORZWKHPRWWR³&(/(67(6«´ R] DQG³.6´IRU-RKQ:LOVRQDQG.DWKHULQH6WHYHQVRQó´KWR ´GL Aitchison, slightly waisted bell shaped form, on tucked in base, base, in tucked on form, shaped bell waisted slightly Aitchison, PRQRJUDPPHGDQGGDWHG´KWR]ERWK Edinburgh Edinburgh rim, everted slightly with top, the toward tapering slightly body cup, Tumbler (GLQEXUJK 7XPEOHUFXSVSDLUHQJUDYHGVFULSWLQLWLDOV'1,3 (GLQEXUJK 7XPEOHUFXSIODWFKDVHGURFRFRIORUDOSDWWHUQFDUWR RU:LOOLDP'HPSVWHU I :LOOLDP'DYLH :LOOLDP'DYLH .HU 'HPSVWHU (GLQEXUJK .HU 'HPSVWHU Aitchison 1765/66 7XPEOHUFXSVSDLUVOLJKWO\H (GLQEXUJK 1766/67 Alexander Dempster Ker & 7XPEOHUFXSVSDLUQRGHWDLOV Edinburgh wt 8oz ht, ½" lip, 2 everted band, chased pair cups, Tumbler #180 1993, November Christies .HU (GLQEXUJK 7XPEOHUFXSVSDLUZLWKWKHLQLWLDOV3* :LOOLDP'HPSVWHURU /RWKLDQ 5REHUWVRQ (GLQEXUJK 7XPEOHUFXSVSDLUVOLJK -RKQ&ODUN (GLQEXUJK 7XPEOHUFXSVOLJKWO\HYHUWHGULP 1759/60 Robertson John Edinburgh cup, Tumbler YEAR MAKER DESCRIPTION LOCATION 1RWDYDLODEOH (GLQEXUJK 7XPEOHUFXSVKDSHGRXWOLQHJL SOURCE 1759/60 Robertson John Edinburgh Alexander by 1766/67 one matching another with sold cup, Tumbler 174 Cups LRQ '$* J/ FN V XUGRQ6PLWK/RQGRQ GHH0XVHXPVDQG$UW *DOOHULHV$% 1REOH&ROOHFWLRQ 6RWKHE\V*OHQHDJOHV6HSWHPEHU -%RXUGRQ6PLWK/RQGRQ *DOOHULHV 6RWKHE\V6FRQH$SULO #85 )LQOD\ 1DWLRQDO0XVHXPVRI6FRWODQG +0(4 +\PDQ&ROOHFWLRQ&RORQLDO :LOOLDPVEXUJ 6RWKHE\V2FWREHU +\PDQ&ROOHFWLRQ&RORQLDO :LOOLDPVEXU HVKLUH GE\DNQRS RRW³:HDUH6DYHGE\ :&GLR]G &KULVWLHV1<$SULO LWKFUHVWDQGPRWWRRI+DPLOWRQKW RUQDWHZLWKFKDVHGOHDYHVQHDUEDVHFKDVHG \ZDLVWHGSODLQERGLHVIODUHGULPVHDFKHQJUDYHG 7XPEOHUFXSSDLUQRGHWDLOV $EHUGHHQ0XVHXPVDQG ZLWKWKHLQLWLDO³3´´GLR] FRQWHPSRUDU\F\SKHU-0&$UPVRI&DPSEHOORI1HWKHUSODFH$\U ôKWR]G 8oz 6d 8oz decoration on cover, large pinecone finial finial pinecone large cover, on decoration )DLWK´ (GLQEXUJK 7XPEOHUFXSVOLJKWO\HYHUWHGOLSHQJUDYHGLQLWLDOV (GLQEXUJK 7ZRKDQGOHGFXSFRYHUHGVWUDSKDQGOHVHDFKWRSSH (GLQEXUJK 7XPEOHUFXSQRGHWDLOV(GLQEXUJK 7XPEOHUFXSVSDLUQRGHWDLOV -%RXUGRQ6PLWK/RQGRQ 7KH0DSOH6ZDQ&ROOHFW (GLQEXUJK 7XPEOHUFXSVHYHUWHGULPHQJUDYHGZLWKFUHVWDQGP TWO-HANDLED William Dempster Dempster William William Davie Davie William William Dempster Dempster William William Davie Davie William FD : 3&XQQLQJKDP (GLQEXUJK 7XPEOHUFXSQRGHWDLOV 'XQ Kirk : 3&XQQLQJKDP Edinburgh (GLQEXUJK 1996/97 William *HRUJH0F+DWWLH 7XPEOHUFXSQRGHWDLOV (GLQEXUJK 7XPEOHUFXSQRGHWDLOV -%R +DQFR 1776/77 or Davie William FD $OH[DQGHU=LHJOHU (GLQEXUJK 7XPEOHUFXSVSDLUVOLJKWO -DPHV3HQPDQ :LOOLDP'HPSVWHURU :LOOLDP'DYLHRU -DPHV+HZLWW (GLQEXUJK 7XPEOHUFXSVRUEHDNHUVSDLUZ YEAR MAKER DESCRIPTION 1767/68 LOCATION or Dempster William SOURCE $OH[DQGHU5HLG (GLQEXUJK 7ZRKDQGOHGFXSFRYHUHGYHU\ 175 Compendium of Scottish Silver Finlay 1991 #65 1991 Finlay &OD\WRQ'LFWLRQDU\S Hopetoun Earl of 1977 15, June London Christies #137 1DWLRQDO0XVHXPVRI6FRWODQG 0(4DED E 1988 #67 #109 %XUOLQJWRQ0DJD]LQH'HFHPEHU p50 112, 1970 vol Edinburgh of How 1DWLRQDO0XVHXPVRI6FRWODQG + #164 3, 1984 July Christies #194 12, 1983 July Christies &OD\WRQ'LFWLRQDU\S &KULVWLHV0DUFK Grantully Castle Antiques Antiques Castle Grantully #190 1977 28, April Sothebys Sothebys November 15, 1962 1962 15, November Sothebys #31 Jessop Antiques Sothebys Hopetoun House, House, Hopetoun Sothebys #63 1978 13, November #154 14, 1954 July Christies #60 1991 Finlay '0/´GDWHG R]G 6RWKHE\V+RSHWRXQ+RXVH$SULO cup, Arms of Baille of Jerviswood, crest and motto motto and crest Jerviswood, of Baille of Arms cup, 1967 30, November Sothebys handles, circularmolded foot, plain body, studthumb piece,arms the of city of Edinburgh, domed cover,acorn finial DURXQGERG\VFUROOKDQGOHVHQJUDYHZLWKFRQMRLQHGLQLWLDOV³ ´KWR]G LQLWLDOHGDERYHDSSOLHGJLUGOH³$06'´ó´KWR] VFUROOKDQGOHVEDVHZLWKLQLWLDOVò´KWR] initials and dates at later periods, 2 scroll handles, flat later chased cover, cover, chased later flat handles, scroll 2 periods, later at dates and initials WXUQHGILQLDORQULPIRRWò´KWR] Inverness Inverness applied band reeded with foot, rim reeded on miniature, handled cup, Two LOOLDP0DF/HDQ (continued) (continued) -RKQ6HDWRXQ1709/10 Seatoun John (GLQEXUJK 7ZRKDQGOHGFXSFRYHUHGKW Edinburgh handled Two 1715 ca 1715 ca W 1707/08 Scott William Edinburgh scroll single 2 with Cup, Spout Hopetoun The covered, cup, handled Two 1696/97 Cockburn James Edinburgh handles, bodies scroll cast uncapped plain, pair, cups, handled thistle Two 1695/96 Penman James Edinburgh plain capped 2 cast lobes, applied girdle, reeded cup, handled thistle Two YEAR MAKER DESCRIPTION LOCATION SOURCE 1694/95 Seatoun John Edinburgh armorials, with body a cylindrical of side either on engraved handle cup, Two 176 Cups Scottish Art Review vol XIII Art Review vol Scottish 1972#4 back cover advertisement of Edinburgh How National Museums of Scotland National Museums MEQ 1076 Christies January 29, 1964 #170 Christies January Phillips Edinburgh May 22, 1987 #87 Christies November 21-22, 1990 Christies November #48 uncertain Source Sothebys November 3, 1966 #42 November Sothebys 1580 1980 Sothebys December 1, 1982 #59 December Sothebys Phillips Edinburgh May 22, 1987 Sothebys July 29, 1990 #309 foot, inscribed King’s Own Regt. th lip, 10 ½” ht, 59.5oz 10 ½” ht, lip, 1727” and “The Gift “The and 1727” th des with badge of the presentation inscription ary coat of arms of John of arms ary coat on spreading plain, engraved with 2 coats of 2 coats with engraved plain, t sided with tucked in base, on base, in with tucked t sided 1727”, 3 ¾” ht, 13.34oz 1727”, 3 ¾” ht, th itials “DML” of Scotland National Museums - RC, OABD, COABD, - RC, UK Private Collection aped, engraved with aped, engraved ed bowl chased on both si ed bowl chased on on/to/C Smithson/June 20 on/to/C Smithson/June ed bowl with ed bowl slightly everted on one side with contempor one side with on thought to be Jamaican and made by Charles Allan by Charles and made Jamaican thought to be cup, with spout, no detailscup, with spout, no UK Private Collection ed cup, circular, 2 scrolled handles, 2 scrolled ed cup, circular, ed cup, no cover, plain, straigh no cover, ed cup, “The Gift of/Mrs E “The Gift of/Mrs Crompt the Blue and Orange Society, identical armorials, festoons of fruit, flowers festoons armorials, Society, identical Orange the Blue and double scroll handles, and leaves, leaf capped “Ex Dono Saml. Dukinfield Esqr. To Col. Jas. Thorne, 4 Thorne, Jas. Col. To Esqr. Dukinfield Saml. Dono “Ex reeded rim foot, 2 leaf capped scroll handles, contemporary Arms of Orr, of Arms contemporary handles, scroll capped 2 leaf foot, rim reeded 7 ¾” ht, 10oz rococo flowers and scrolls, on circular molded foot, double scroll handles, double scroll foot, molded on circular scrolls, and flowers rococo with acorn finial, bell shap per Robert Barker per arms, motto, 4 marks – RL, tree, RL, S – 4 ¾” ht, 20.9 oz ¾” ht, – 4 S RL, tree, – RL, 4 marks motto, arms, scroll handles, engrave of Mackenzie with later arms other on the and Camlachie, of Barrowfield Orr 4 5/8” ht, 20oz Gordon, impaling of/Mrs E Crompton/to/M Rose/June 20 Rose/June of/Mrs E Crompton/to/M Of Foot”, Of Foot”, 5 ½” ht, 18.8oz Two handled thistle cup, Two girdle, in deen marks covered, handled cup, Two hhandled cup, bell shap Two deen Two handled cup, now ongatevase sh handled cups, pair, Two inburgh Two handled 1727 ca Colin Mitchell Can 1725 ca Cruickshank Robert Aber Old 1750/51Dempster Ker & Edinburg 1725 ca Luke Robert Glasgowhandl Two 1736/37 Dougal Ged1750 caAllan Coline Edinburgh Twohandled cup, compressedbun knop onhandles, stepped and domed lid, Aber 1752/531754/55 Gilchrist William Dempster Ker & Edinburgh Edinburgh with acanthus capped gold Two handled cup, gold, wooden handle, Twohandled cup, upper body chasedrococowith cartouches, panelsof of Scotland National Museums YEAR1720 ca MAKER McKenzie Simon Inverness LOCATION DESCRIPTION SOURCE 1724/25 Charles Blair Ed 1725 ca Luke Robert Glasgowhandl Two 1730 ca Luke Robert Glasgow capped body, acanthus slightly everted base, on spreading handled Cup, Two 177 Compendium of Scottish Silver LQWHU %UHDGDOEDQH&ROOHFWLRQ6DOH 'XQGHH0XVHXPVDQG$UW *DOOHULHV 6RWKHE\V*OHQHDJOHV$XJXVW Nobel Collection Collection Nobel 28, August Gleneagles Sothebys 1975 #50 #92 1991 Finlay 0(4 S %UHDGDOEDQH&ROOHFWLRQ6DOH + 0HWURSROLWDQ0XVHXPRI$UW1< 86$ GOHVô´KW ORZHUVORZHUSDUW RQO\[R]G &KULVWLHV2FWREHU USDUWDQGFHQWHURIFRYHUUHSRXVVHGZLWK ZLWKJROGKDQGOHV )LQOD\ 3ULFH/HLWKUDFHV 1DWLRQDO0XVHXPVRI6FRWODQG &ULSSVS HUVKDSHVFUROOKDQGOHVKWR] 1LFKRODV6KDZ&DWDORJ: GERG\DSSOLHGUHHGHGPLGULEDERYHZKLFKLV WIRUIHHGLQJ 1DWLRQDO0XVHXPVRI6FRWODQG SHGRXWOLQHFRYHUHGVSRXWHERQL]HGZRRGILQLDO VWHUERG\FXUYHGVSRXW6VFUROOKDQGOHVò´KW OV /\OH6LOYHU5HYLHZS FKDVHGZLWKEDQGLQJRIIROLDWHGVWUDSZRUNR] WRUDLVHGFRYHU XQPDUNHG FUHVWDQGPRWWRô´KWR] R] HQJUDYHGDXQLFRUQSDVVDQWRQDFRURQHWOHDIFDSSHGVFUROOKDQ 4oz 4oz REOLTXHIOXWHGERUGHUó´GLR] (GLQEXUJK 7ZRKDQGOHGFXSFKDVHGDQGUHSRXVVHGZLWKVZDJVRII :LOOLDP'DYLH FRQWLQXHG ´KWR] :LOOLDP'HPSVWHURU $OH[DQGHU*DLUGQHU (GLQEXUJK 7ZRKDQGOHGVSRXWFXSVKD 3DWULFN5REHUWVRQ (GLQEXUJK 7ZRKDQGOHGFXSEHOOVKDSH $OH[DQGHU*DLUGQHU (GLQEXUJK 7ZRKDQGOHGIHHGFXSEDOX $OH[DQGHU*DLUGQHU (GLQEXUJK 7ZRKDQGOHGFXSZLWKVSRX FD 0LOQH &DPSEHOO *ODVJRZ 7ZRKDQGOHGFXSSODLQEDOXVW .HU 'HPSVWHU (GLQEXUJK 7ZRKDQGOHGFXSFRYHUHGORZH FD .HU 'HPSVWHU (GLQEXUJK 7ZRKDQGOHGFXSJROG.LQJ V FDFD .HU 'HPSVWHUFD .HU 'HPSVWHU (GLQEXUJK .HU 'HPSVWHU (GLQEXUJK 7ZRKDQGOHGFXS5R\DO$UPVPP (GLQEXUJK 7ZRKDQGOHGFXS&DVWOH*UDQW 7ZRKDQGOHGFXSJROGFRYHUHG /RWKLDQ 5REHUWVRQ (GLQEXUJK 7ZRKDQGOHGFXSQRGHWDL YEAR MAKER DESCRIPTION LOCATION SOURCE 178 Cups alog Autumn W SOH6ZDQ&ROOHFWLRQ E\V3LFWXUH%RRN-XQH 3KLOLSV*ODVJRZ$XFWLRQ 1991 Summer S *UDQWXOO\&DVWOH$QWLTXHV Scotland of Museums National 0(4 6RWKHE\V*OHQHDJOHV$XJXVW 1973 #36 6RWKHE\V*OHQHDJOHV$XJXVW 6RWKHE\V*OHQHDJOHV$XJXVW 1997 #130 Scotland of Museums National . MEQ 1333 1980.62 1980.62 1333 MEQ Scotland of Museums National a 1963.37 6RWKHE\V6FRQH3DODFH$SULO 1980 #108 ò´KWR] KWR] eceased by this date),no LQFDUWRXFKH³0'´ %HOORI$EHUGHHQ ERG\HQJUDYHGRQRQHVLGHZLWKDUPVRIWKH -XO\IRRWDOVRHQJUDYHGZLWKQDPHV HGHGKDQGOHVFUHVWRI*UDKDPòKWR] 1LFKRODV6KDZ&D th YDVHVKDSHGZLWKWKH5R\DO$UPVRI6FRWODQGDQG RI&XOORGHQ´KWR] th foliage and pendants, reeded loop handles, later engraved with shields shields with engraved later handles, loop reeded pendants, and foliage 26 date and names enclosing details details Arms of Arthur Forbes, 7 FLW\RI(GLQEXUJKRQWKHRWKHUDQLQVFULSWLRQDQGGDWH ´KWR] FXUYHGVSRXWHYHUWHGVNLUWEDVHFUHVWHGDERYHLQLWLDOVô´ (GLQEXUJK 7ZRKDQGOHGFXSFRYHUHGôKWR]G 6RWKH Edinburgh Edinburgh details no plain, cup, handled Two Scotland of Museums National Edinburgh Two handled invalid cup, baluster body, reeded everted lip, 2 straphandles, Or William Dempster Tait) Tait) William Dempster Dempster William 1791/92 Robertson William Edinburgh cut bright of borders with foot, trumpet body, shaped bell cup, handled Two 1788/89 William Davie Davie 1788/89 William FD :LOOLDP%\UHV1790/91 %DQII Dempster William Edinburgh 7ZRKDQGOHGFXSFRYHUHGHQJUDYHG d was Davie William (Note: cup, handled Two 'LFN 0F3KHUVRQ (GLQEXUJK 7ZRKDQGOHGFXSYDVHVKDSHG : 3&XQQLQJKDP (GLQEXUJK 7ZRKDQGOHGFXSFRYHUHG :0 (GLQEXUJK 7ZRKDQGOHGFXSVSDLUQRGHWDLOV 7KH0D 1771/72 "Tait" (Benjamin (Benjamin YEAR MAKER DESCRIPTION 1771/72 "Tait" LOCATION SOURCE 1771/72 Robertson & Lothian Edinburgh 1772/73 no details covered, handled cup, Two or Davie William #99 1991 Finlay : 3&XQQLQJKDP (GLQEXUJK 7ZRKDQGOHGFXSFRYHUHGUH 179 Compendium of Scottish Silver Nicholas Shaw Catalog Winter Winter Catalog Shaw Nicholas 2001 p74 Nicholas Shaw Catalog 2004 2004 Catalog Shaw Nicholas p104 Nicholas Shaw Catalog Winter Winter Catalog Shaw Nicholas 2000 p79 MEQ 1529 1529 MEQ Cincinnati Art Museum 1936.406 1936.406 Museum Art Cincinnati 1306 MEQ Nicholas Shaw Catalog 2005 2005 Catalog Shaw Nicholas p100 Private Collection Collection Private 1991 28, February Sothebys MEQ 807 Winter Catalog Shaw Nicholas 2000 p79 Winter Catalog Shaw Nicholas 2000 p79 engraved in cartouche cartouche in engraved Scotland of Museums National July 1818, 9" ht, 22.2 oz oz 22.2 ht, 1818, 9" July th vacant cartouche, 10 1/8" ht, 19.1oz 19.1oz ht, 1/8" 10 cartouche, vacant Race 10 Scotscraig, 9" ht, 24.9oz 24.9oz ht, 9" Scotscraig, "Dominus Fiducia Mea," 9 1/8" ht, 32oz 32oz ht, 1/8" 9 Mea," Fiducia "Dominus EDVH´KW´RYHUKDQGOHV with alternate lobes and straps below the midriff, leaf capped scroll handles, handles, scroll capped leaf midriff, the below straps and lobes alternate with 53oz ½"ht 11 Riddell, 13 ½" ht, 39.7 oz oz 39.7 ht, ½" 13 Riddell, Burns John Mr. to presented engraved, cut, bright covered, cup, Tumbler 1803 18 April Glasgow handled Two cup, covered, compana of shape, engraved with crest andmotto Edinburgh assay Assayed Edinburgh 1812/13 1814/15 Henderson Alexander Edinburgh 1816/17 mark G & N no details handled cup, Two Sons & Gray Robert Edinburgh trophy racing handled cup, Two 1991 Toronto Antiques Lorentz #241 1988 October NY Christies 1808/09 1810 ca McKay James Erskine James Edinburgh Aberdeen ht 10" handled cup, Two and flowers of festoons cut bright shape, compana of handled cup, Two 31 p93 vol Magazine Antiques 1817/18 Howden James Edinburgh Troop a for Hope John Sir Major by given cup, handled presentation Two 1807/08 Sons & Cunningham Edinburgh Dalgleish, William Captain to given cup, handled presentation Two 1805 ca 1805 ca Robertson & Dick 1806/07 Edinburgh Fenwick & McHattie Edinburgh cup, handled Two Club" Farmers "Dalkeith engraved cup, handled Two Scotland of Museums National YEAR MAKER DESCRIPTION 1802/03 LOCATION Fenwick & McHattie Edinburgh 1804 Hay D. to presented cup, handled Two Scotland of Museums National SOURCE 1804/05 Cunningham P & W Edinburgh the around work cut bright foot, splayed body, shaped urn handled cup, Two 1802/03 Fenwick & McHattie 1802/03 Edinburgh Walter to E presented T & foot, circular spreading a on covered cup, Tumbler 1804/05 Cunningham P & W Edinburgh applied body of half lower form, Ann Queen cover, and handled cup Two 180 Cups MEQ 1332 1332 MEQ 1976 #56 #125 MEQ 810 1962.1881 1962.1881 810 MEQ MEQ 723 MEQ 855 tion cup, no details details no cup, tion Scotland of Museums National Two handled presentation cup, no details details no cup, presentation handled Two Scotland of Museums National Edinburgh / Leith Edinburgh Edinburgh details no cup, presentation handled Two Scotland of Museums National Hay Leith) Leith) Hay Co Co YEAR MAKER DESCRIPTION 1820/21 LOCATION (also Bendy Charles SOURCE 1821/22 Son & Gray Robert 1821/22 Edinburgh Son & Gray Robert 1836/37 10d 145oz ¼"ht, 16 inscribed, handled cup, Two Edinburgh Urquhart Leonard 16d 139oz above, the from different covered, handled cup, Two Edinburgh presenta handled Two 1985 27, November Sothebys 28, August Gleneagles Sothebys 1879/80 & Naysmith James 1886/87 Marshall William Edinburgh cartouche vacant with chased cup, handled Two Scotland of Museums National 181 Compendium of Scottish Silver 182 Dinnerware DinnerwareDINNERWARE Plate 20. One of two covered Entrée Dishes 1829/30 by Marshall & Son, Edinburgh. Courtesy of a private collector. Photograph by Janice M Dietert. 183 Compendium of Scottish Silver 184 Dish Crosses and Rings DISH CROSSES AND DISH RINGS Plate 21. A Dish Cross 1767/68 by WD, probably William Dempster, Edinburgh. Courtesy of The Phoenix Collection. Photograph by Janice M Dietert. 185 Compendium of Scottish Silver sgow Novembersgow 18- D Scottish Art Review Vol XIII #3 #3 XIII Vol Review Art Scottish 1972 cover back advertisement Edinburgh of How #183 1975 24, March Christies #64 18, 1978 July Christies 28, August Gleneagles Sothebys 1985 #148 J Bourdon-Smith London MEQ 1972.274 1972.274 MEQ Minneapolis Institute of Art of Institute Minneapolis 74.63.29.4 #23 1967 26, January Sothebys Antiques Bloom N #696 1992 19, Christies Glasgow November 12, 12, November Glasgow Christies 1991 #271 1984 1578 MEQ The Maple Swan Collection Earl of Northesk, Northesk, of Earl th WKFOHDUPDUNVR] +RZRI(GLQEXUJK PVZLWKEDQQHUGLR] 1LFKRODV6KDZ&DWDORJS DIGLVKUHVWVVLPSOHDUPV´ORQJó´KW MXVWDEOHVKHOODQGVFUROOVXSSRUWV´ZLGHR] &KULVWLHV*O , no details details no , Scotland of Museums National no details details no Scotland of Museums National work and shell design, 18.3oz 18.3oz design, and shell work VXSSRUWVSLHUFHGDVVKHOOPRWLIVô´DFURVVR]G ODPSPLVVLQJHQJUDYHGZLWKFUHVWDQGPRWWRR]G R] EHORZDFRURQHWR] VFUROOKDQGOHô´KWR] DINNERWARE possible a second owner owner second a possible Edinburgh Dish cross, large,adjustable on 4 shell and scroll feet, circular lamp frame, Edinburgh Edinburgh crest bars, on the marked feet, pattern shell supports, scroll sliding cross, Dish Daniel Ker Probably William William Probably Dempster DISH CROSSES AND DISH RINGS 1766/67 James Gilliland and and Gilliland 1766/67 James 1767/68 Dempster William Edinburgh feet-cum-dish sliding burner, central lacking form, typical cross, Dish 1765/66 Dempster Ker & Edinburgh of scroll swags suspended 3 with applied ring the feet, shell 3 on ring Dish 1758/59 WD 1758/59 WD /RWKLDQ 5REHUWVRQFD (GLQEXUJK1765/66 0LOQH &DPSEHOO 'LVKFURVVQREXUQHUDG *ODVJRZ Dempster & Ker Edinburgh 'LVKFURVVVKHOOGHFRUDWHGDU ring, Dish 1750 ca 1750 ca Ross Hugh 'RXJDO*HG Tain 5REHUW*RUGRQ (GLQEXUJK (GLQEXUJK feet paw 3 on ring, Dish 'LVKFURVVH[FHSWLRQDOH[DPSOHZL 'LVKFURVVRQVKHOOIHHWOH 1736/37 Penman Hugh Edinburgh with (strengthened), base circular spreading on ring, baluster plain ring, Dish YEAR MAKER DESCRIPTION LOCATION SOURCE 1693/94 Cockburn James Edinburgh 4 Carnegie, David of Arms, Arms of Coat ring, Dish 186 Dish Crosses and Rings of Scotland p105 Lyon & Turnbull,The Murray 193 # 2003 20, August Collection MEQ 1571 1571 MEQ Sale, Scottish The Bonhams #42 2003 21, August 2001, p76 2001, Bonhams the Scottish Sale Sale Scottish the Bonhams #34 2005 24, August Sothebys Gleneagles August 29, 29, August Gleneagles Sothebys 1977 #186 Private Collection Collection Private MEQ 1966.990 1966.990 MEQ 1969.406 & a-d & 1969.406 The Phoenix Collection Collection Phoenix The HUODPSDQGVWDQGDOVRPDUNHG³+D\´RI/HLWK 1DWLRQDO0XVHXPV no details details no Scotland of Museums National sh cross, without a burner burner a without cross, sh Scotland of Museums National VFULSW:'ò´R] EHORZDUURZVKDSHGGLVKVXSSRUWVò´R] bars,pierced on 4 shell feet, centralring pierced with6 pedal flowerhead ZLWKVFDOORSHGVXUURXQGô´R] marked on each arm, 11", 13oz leaves, handles similarly cast, 11 ½", 118oz 118oz ½", 11 cast, similarly handles leaves, Edinburgh Edinburgh brackets sliding 4 arms, to terminals head flower form, X typical cross, Dish Edinburgh 14.8oz long, ¾" 12 burner, without cross Dish Winter Catalog Shaw Nicholas ENTRÉE DISHES ENTRÉE or William Dempster or William Dempster (continued) (continued) 1894/95 Inches & Hamilton Edinburgh 12.3oz ¼" di, 8 a dog, and foliage ring with Dish 2005 Catalog Shaw Nicholas 1783/84 William Davie Davie 1783/84 William Davie 1784/85 William 1794/95 Howden Francis Edinburgh engraved support one lamp), (no holder lamp adjustable form with cross Dish 1782/83 Patrick Robertson Edinburgh Dish ring, ring, Dish Edinburgh Robertson 1780/81 1782/83 Patrick Robertson Patrick Edinburgh no details cross, Dish Collection Swan Maple The 1776/77 I Cunningham P & W Edinburgh the of ends the to finials baluster with ring, central sliding with cross, Dish 1771/72 Robertson Patrick Edinburgh rests, shell pierced and brackets scroll with supports sliding cross, Dish 1829/30 Son & Marshall Edinburgh ivy and flowers with borders handles, and covers with pair, dishes, Entrée YEAR MAKER DESCRIPTION LOCATION SOURCE 1770/71 James Gilliland Gilliland Di Edinburgh 1770/71 James 1809/10 McKay James *HRUJH0F+DWWLH Edinburgh (GLQEXUJK 3, covered of set dishes, Entrée (QWUpHVHUYLQJGLVKZLWKFRY Collection Swan Maple The 187 Compendium of Scottish Silver 005, 005, Carnegie Institute Museum of Art Art of Museum Institute Carnegie 78.36.21 MEQ 1077 1077 MEQ Indianapolis Museum of Art Art of Museum Indianapolis #2426 TR a-I 78.96 MEQ 1610 1610 MEQ 1963 16, October Christies Sothebys June 22, 1960 June 22, Sothebys Edinburgh of How 1987 #66 February Sothebys 27, August Gleneagles, Sothebys 1979 3192 p 718 UK Collection Private #228 EDVNHWVLGHEDVNHWVRQOHJVô´KW handle with bearded masks, repousse decoration on exterior with grape vines, vines, grape with exterior on decoration repousse masks, bearded with handle OHDYHVDQGFOXVWHUV´GL Jug, engraved, "David Murray from R Leith Volunteer" Volunteer" Leith R from Murray "David engraved, Jug, Scotland of Museums National ó´ZLGH covered spout, shallow domed lidand with crest acorn finial, ground, fluted scrollmatted a thumb on piece, foliage scrolling of bands with later chased oz 37.3 ht, ½" 8 coronet, spout, low domed lid with acorn finial, body later engraved with the Arms Arms the with engraved later body finial, acorn with lid domed low spout, 13.9oz ht, 6" Moreton, impaling Lynam bright cut foliage and flowers, crest and motto in an oval cartouche, 8 ¼" ht, ht, ¼" 8 cartouche, oval an in motto and crest flowers, and foliage cut bright 21.5oz Edinburgh Edinburgh bowls circular small 4 bowl, central oval Epergne, Scotland of Museums National Edinburgh Edinburgh molded short handle, shaped harp silver body, shaped pear plain jug, Ale? Edinburgh Edinburgh of collar a with decorated and fluted oval, jug, a coffee called jug, water Hot & Sons JUGS Maker and assayer assayer and Maker Assayed Edinburgh EPERGNES 1809/10 available Not Edinburgh molded lip, everted and neck high to tapering sides swelling Jug/pitcher, 1806/07 Patrick Cunningham Cunningham 1806/07 Patrick 1718/19 Edward Penman Penman 1718/19 Edward 1800/01 I Cunningham P & W 1804/05 Cockburn S W 1794/95 Cunningham P & W Edinburgh no details Epergne, 1701/02 Ker Thomas Edinburgh no details Jug, 122, vol Magazine Antiques p7 II, 1972, Notes How's :LOOLDP5REHUWVRQ (GLQEXUJK (SHUJQHZLWKFHQWUDORYDO 1713/14 McKenzie Colin Edinburgh 65.2oz "1869", engraved panel, work strap with chased jug, Covered 2 5, April Olympia Sothebys 1716/17 Yorstoun Mungo Edinburgh partly molded with foot, molded circular on a body, shaped pear Jug, plain, YEAR MAKER DESCRIPTION LOCATION SOURCE 188 Dish Crosses and Rings talog Winter Winter talog 2000, p81 2000, Huntley House Museum Huntley House HH2104/61 Edinburgh 2005,#228 1317 MEQ MEQ 1105 1105 MEQ 1978 1297 MEQ p88 2002/3 H.1995.200 HH2104/62 Edinburgh Nicholas Shaw Catalog Winter Winter Catalog Shaw Nicholas 2000 p78 MEQ 695 MEQ 930 1968.492 1968.492 930 MEQ MEQ 694 middle middle Scotland of Museums National +HQU\5«.HOVR´´KW VLFDOVFHQHV´KW´GLEDVH +XQWOH\+RXVH0XVHXP thistles around the the around thistles ilver handle, chased with vine and grape decoration, decoration, grape and vine with chased handle, ilver silver mounts mounts silver Scotland of Museums National no details details no Scotland of Museums National no details details no Scotland of Museums National ´GL´GLEDVH engraved on the base "TMF", 9 7/8" ht 7/8" 9 "TMF", base the on engraved 1867/70 Crichton 1868/69 Marshall William 1869/70 Edinburgh Edinburgh Marshall William details no jug, 65.2oz Lidded "1869", with engraved panel work, strap with chased jug, Covered Edinburgh 5, April Olympia Sothebys 24.7oz ht, ½" 13 panels, zodiac with decorated shape, baluster jug, Claret Ca Shaw Nicholas Scotland of Museums National 1834/35 Wilkie Andrew 1841/42 Edinburgh Wilkie Andrew 1860/61 jug, Lidded Son & Edinburgh Robb Charles Edinburgh 32.4oz ht, ½" 8 1841, Brydon Adam Mr. to presented Wine jug, -RKQ3HDUV+XWWRQ details no jug, Claret (GLQEXUJK -DPHV0F.D\ -XJIRUZDWHUFKDVHGFODV Winter Catalog Shaw Nicholas (GLQEXUJK -XJIRUZDWHU3UHVHQWHGWR´5HY Scotland of Museums National 1831/32 Paton George Edinburgh jug, Claret 1825/26 Son & Gray Robert Glasgow s with jug, water Hot 1822/23 Fenwick George Edinburgh with chased jug, Lidded YEAR MAKER DESCRIPTION 1819/20 LOCATION Cunningham P & W Edinburgh details no jug, Lidded SOURCE Scotland of Museums National 1820/21 Howden Francis Edinburgh with jug, Wooden 189 Compendium of Scottish Silver DAG001052 DAG001052 Galleries AB Galleries 1968.492 930 MEQ YEAR MAKER DESCRIPTION 1877/78 LOCATION available Not Edinburgh unclear mm details, no wine, Jug, for SOURCE and Museums Aberdeen 1879/80 Inches & Hamilton Edinburgh details no jug, Lidded Scotland of Museums National 190 Plates PlatesPLATES Plate 22. One of a pair of Ashets (meat platters) 1821/22 by George McHattie, Edinburgh. Courtesy of a private collector. Photograph by Janice M Dietert. 191 Compendium of Scottish Silver 1968-15 1968-15 Private Collection Collection Private 6RWKHE\V2FWREHURU 1984 #225 Bell advertisement advertisement Bell Galleries $QWLTXHV0DJD]LQHYRO in Market the on Potentially 1968 in Scotland Wark, Huntington Library Book #272 p114, Silver Society Journal Jackson Marks p542 Collection Shaw 29, March Glasgow Christies R] V 7KH0DSOH6ZDQ&ROOHFWLRQ GHWDLOV $QWLTXHV0DJD]LQH a prancinghorse, arrow an pointingat its shoulders,above the motto ¾", 82oz 11 X ¼" 15 1822, 15, February assayed "Onward", ERUGHUHQJUDYHGZLWKDUPRULDOV$UPVIRU'UXPPRQGó´GL Collection, original set was at least 2 dozen plates plates dozen 2 least at was set original Collection, Meaux or Meux quartering 3 others, set was originally larger, see below, below, larger, see originally was set 3 others, quartering Meux or Meaux ô´GLR]HDFK Earl of Kinghorne, 12 described in a family inventory with maker A. S. S. A. maker with inventory a family in described 12 Kinghorne, of Earl Kinghorne, and Strathmore of the Lord of death the after C., sold E. deacon all 492 oz radiating ribbed leaves, flat handles shaped like the plumes of 5 feathers, feathers, 5 of plumes the like shaped handles flat leaves, ribbed radiating Edinburgh Meat plate/dish,ashet, oval with shaped edges and gadrooned border Dundee Museums and Art Edinburgh Edinburgh the for a coronet, below "K" with engraved each 36, of set plates, Dinner Edinburgh Edinburgh details no dish, Sweetmeat Bros Crichton Edinburgh Edinburgh 6 center, in flowers stylized with chased body, circular dish, Sweetmeat SERVING AND William Dempster or or Dempster William Davie William DINNER/TABLE Deacon Edward Edward Deacon I Cleghorne 3/$7(6± Deacon Adam Lamb OTHER DISHES -DPHV0F.D\ (GLQEXUJK 6RXSSODWHVVHWRIQRGHWDLO FD 3DWULFN5REHUWVRQ (GLQEXUJK 'LQQHUSODWHVVHWRIQR 1772/73 WD 1772/73 WD 1821/22 McHattie George Edinburgh of a crest with engraved borders, gadrooned type, Scottish pair, oval, Ashets, 1761/62 Ker Daniel Edinburgh molded with circular, shaped plate, dinner course second plate, Dinner 1722/23 Bethune Henry Edinburgh Library Huntingdon the in as set same the 6 from of set plates, Dinner 1671-73 Scott Alexander 1722/23 Bethune Henry Edinburgh of Arms of coat edge, gadrooned with circular 18, of set plates, Dinner YEAR MAKER DESCRIPTION LOCATION SOURCE Mylne 1644-46 John 7KRPDV&OHJKRUQH 192 Plates DQG NVS V-DPLHVRQDQG&DUU\ 1DWLRQDO0XVHXPVRI6FRWODQG 0(4 0(4 /\RQ 7XUQEXOO7KH0XUUD\ &ROOHFWLRQ$XJXVW 1REOH&ROOHFWLRQ 1LFKRODV6KDZ&DWDORJS $QWLTXHV0DJD]LQHYRO &OD\WRQ'LFWLRQDU\S 7KRPDV&DPSEHOO0XVHXP &DPGHQ1-86$ $EHUGHHQ 3RVVLEO\&KULVWLHVDVDVRXUFH &OD\WRQ&KULVWLHV%RRNS $SROOR$XJXVWYROS 1DWLRQDO0XVHXPVRI6FRWODQG 0(4DEDE 1DWLRQDO0XVHXPVRI6FRWODQG +0(4 QWKHOLG LQLDO$UPVRI DGURRQHGEDQG O¶VFRURQHW DWHVXSSRUWV LOYHUSDUWZRRGHQKDQGOH ERQ\WXUQHGKDQGOHVWHSSHGGRPHGFRYHU UPFKDVHGZLWKVFUROOVRQEDOODQGFODZIHHW LQWHULRUZLWKDQRWKHUFUHVW´GL´RYHUDOOR] HERQ\ILQLDOOLGHQJUDYHGZLWKDFUHVWDQGJDUWHUEHORZDQHDU FUHVWRIDQDQLPDO´ORQJR] WHUPLQDWLQJLQYROXWHGIHHWUHHGHGKDQGOHVGRPHGOLGZLWKJ DQGVFUHZRQURVHWWHRIOHDYHVIURPZKLFKLVVXHVDQDUWLFKRNHI 'XQGDVRI)LQJDVWRQERG\OLGZLWKFUHVWDQGPRWWRRI'XQGDVR ´KW´ORQJR] FRYHUZLWKSXPSNLQILQLDO´ZLGHR] (GLQEXUJK /LSSHGVDXFHSDQQRGHWDLOV 1DWLRQDO0XVHXPVRI6FRWO (GLQEXUJK 7XUHHQFLUFXODUERPEHIRUPJDGURRQHGULPRQIROL :HHPV (GLQEXUJK 6DXFHSDQEDOXVWHUIRUP9VKDSHGVSRXWSDUWV (GPRQVWRXQ TUREENS FRQWLQXHG LQLWLDOV³0:*´DQG³$&´ô´GLR] $OH[DQGHU FD :LOOLDP-DPLHVRQ *HRUJH0F+DWWLH $EHUGHHQ (GLQEXUJK 6DXFHSDQQRGHWDLOV &KDILQJGLVKODPSDQGVWDQG +XJKHVS .HU 'HPSVWHU (GLQEXUJK &KDILQJGLVKFLUFXODUIRUPH *HRUJH6FRWW (GLQEXUJK 6DXFHSDQQRGHWDLOV -DFNVRQ0DU -DPHV $OH[DQGHU*DLUGQHU (GLQEXUJK 6RXSWXUHHQRYDOERPEHIR 3DWULFN5REHUWVRQ YEAR MAKER DESCRIPTION LOCATION SOURCE FD 7KRPDV0RQFXU $EHUGHHQ 6ZHHWPHDWGLVKQRGHWDLOV 0HVVU 193 Compendium of Scottish Silver og Winter O 6ZDQ&ROOHFWLRQ V1<86$2FWREHU WLRQDO0XVHXPVRI6FRWODQG H0DSOH6ZDQ&ROOHFWLRQ (GZDUG 6RQV*ODVJRZ 1LFKRODV6KDZ&DWDORJ$XWXPQ S S 1LFKRODV6KDZ&DWDORJ:LQWHU S 1LFKRODV6KDZ&DWDORJ$XWXPQ S 0(4D 0(4 Bell advertisement advertisement Bell ([KLELWLRQYRO,S $UW,QVWLWXWHRI&KLFDJR DE KDQGOH WHPHUD)LGHV´DOVR RQOLRQSDZIHHWHQJUDYHGSUHVHQWDWLRQ OLRQ¶VSDZIHHWSUHVHQWDWLRQWR0U$OH[DQGHU RQVKHOODQGVFUROOIHHW$UPVRI7XUQEXOO UVRYDORQSDZIHHWô´ORQJR]ERWK 1LFKRODV6KDZ&DWD RGHWDLOV 1DWLRQDO0XVHXPVRI6FRWODQG XSWXUHHQQRGHWDLOV 7KH0DSOH ´ORQJR] +HQGHUVRQFRYHUVXUPRXQWHGE\KLVFUHVW´ORQJR] WR&UDZIRUG7DLW(VTRI+DUYLHVWRQò´KWR] DUPVRIWKHFLW\RI(GLQEXUJK´KW´ORQJRYHUWKH EXUJK 6RXSWXUHHQQRGHWDLOV (GLQEXUJK 6RXSWXUHHQZLWKFRYHUHQJUDYHGZLWK³+RF0HQULW,Q William Davie or or Davie William Dempster William *HRUJH0F+DWWLH (GLQEXUJK 6RXSWXUHHQERPEHRYDOIRUP *HRUJH)HQZLFN (GLQEXUJK 6DXFHWXUHHQVSDLUZLWKFRYH *HRUJH0F+DWWLH (GLQEXUJK &RYHUHGWXUHHQZLWKFUHVWQ -DPHV0F.D\ *HRUJH)HQZLFN (GLQEXUJK (GLQEXUJK 6R 6RXSWXUHHQERPEHIRUPRQ )UDQFLV+RZGHQ (GLQEXUJK &RYHUHG7XUHHQQRGHWDLOV 1D ** (GLQEXUJK 7XUHHQQRGHWDLOV $QWLTXHV0DJD]LQHYRO 0F+DWWLH )HQZLFN (GLQEXUJK -DPHV0F.D\ 6RXSWXUHHQQRGHWDLOV (GLQEXUJK &RYHUHGVRXSWXUHHQERPEHIRUP 7K 1782/83 WD script script YEAR MAKER DESCRIPTION 1782/83 WD LOCATION SOURCE :LOOLDP5REHUWVRQ (GLQEXUJK 7XUHHQQRGHWDLOV &KULVWLH 3* RUSRVVLEO\5* (GLQ 194 Flatware FlatwareFLATWARE Plate 23. A Scots Fiddle Pattern Tea Straining Spoon 1730ca by William Aytoun, Edinburgh. Courtesy of a private collector. Photograph by Janice M Dietert. 195 Compendium of Scottish Silver 196 Fish Slces FISH SLICES Plate 24. A Fish Slice 1807/08 by James Douglas, Edinburgh. Courtesy of The Phoenix Collection. Photograph by Janice M Dietert. 197 Compendium of Scottish Silver p76 DAG001306 DAG001306 VHXPVRI6FRWODQG HUGHHQ0XVHXPVDQG &KULVWLHV(GLQEXUJK1RYHPEHU -R\D$QWLTXHV:DVKLQJWRQ'& 1994 7KH3KRHQL[&ROOHFWLRQ 1987 Lot 239 239 1987 Lot Galleries AB Galleries MEQ 132 1976.42 1195 MEQ HH3462/69 Edinburgh p106 ORQJ XQPDUNHGò 5DELQRYLWFK9S HGJHGDQGFUHVWHGKDQGOH´ 5DELQRYLWFK,,, LDQNH\ERUGHUSLHUFHGVZDJVDYDFDQW LQLWLDO³&´RQWRSLQLWLDO³5´XQGHUQHDWK +XQWOH\+RXVH0XVHXP HRIDILVK 5DELQRYLWFK,9S GIUXLWZRRGKDQGOH 3ULYDWH&ROOHFWLRQ QHGLYRU\KDQGOH 3ULYDWH&ROOHFWLRQ GEULJKWFXWGHFRUDWLRQPPRQO\ 3ULYDWH&ROOHFWLRQ KVOLFHQRGHWDLOV 1DWLRQDO0X ZUHDWKUHHGHGILGGOHKDQGOHFUHVWDQGPRWWR([,QGXVWULD FLATWARE FLATWARE )LVKVOLFHQRGHWDLOV 1DWLRQDO0XVHXPVRI6FRWODQG Edinburgh Fish slice,no details Sothebys Gleneagles August Glasgow Glasgow (GLQEXUJK )LVKVOLFHòR] 1LFKRODV6KDZ&DWDORJ FISH SLICES William Dempster Dempster William Assayed Edinburgh & Sons 3HWHU0DWKLH (GLQEXUJK 2OG(QJOLVKILVKWURZHOIHDWKHU :LOOLDP'DYLHRU 3DWULFN5REHUWVRQFD (GLQEXUJKFD &KDUOHV-DPLHVRQ 6HUYLQJWURZHOQRGHWDLOV -DPHV(UVNLQH ,QYHUQHVV /RQJRYDOVHUYHULQWKHVKDS $EHUGHHQ &DNHVOLFHVHUYHUQRGHWDLOV $E $OH[DQGHU+HQGHUVRQ (GLQEXUJK )UDQFLV+RZGHQ 7URZHOZLWKSLHUFLQJDQ $OH[DQGHU6SHQFHFD (GLQEXUJK (GLQEXUJK )LVKVOLFHVPDOOZLWKWXUQH &KDUOHV)RZOHU )LVKVOLFHZLWKJUHHQVWDL (OJLQ )LV YEAR MAKER DESCRIPTION LOCATION SOURCE 5REHUW*UD\ 5REHUW.HD\, -DPHV'RXJODV 3HUWK 3DWULFN&XQQLQJKDP (GLQEXUJK )LVKVOLFHSLHUFHGFLUFOHV )LVKVOLFHZLWKILOOHGURXQGKDQGOH -DPHV'RXJODV (GLQEXUJK )LVKVOLFHEULJKWFXWZLWK*UHF 198 Fish Slces -183 -183 p182-183 p182-183 DAG001305 DAG001305 DAG001128 DAG001128 DAG001128 DAG001128 1962-701-1 1962-701-1 Rabinovitch V #73 pp182-183 pp182-183 #73 V Rabinovitch Birmingham Museum of Art 73.25 AB Galleries Galleries p106 p106 AB Galleries MEQ 783 AB Galleries script "B" "B" script Scotland of Museums National 12 ¼" long GHVLJQ´ORQJô´ZLGH Glasgow Glasgow long 11" monogrammed, dolphin, rear vertical by pierced slice, Acorn fish 234-235 pp #15 VI Rabinovitch Glasgow Fish slice,no details Dundee Museums and Art Assayed Edinburgh Assayed Edinburgh 1830 ca 1830 ca Whitecross William 1830/31 Aberdeen 1831/32 Sons & Gray Robert details no slice, Fish Glasgow 1833/34 Co & Howden James Edinburgh 1834/35 long 3/8" 12 squares, pierced blade, unreeded Arthur plain Peter with slice Fish no details slice, Fish AW Glasgow 182 pp #69 V Rabinovitch 11 5/8"long back, on initials script reeding, double handle, solid slice, Fish p #72 V Rabinovitch Edinburgh pierced, stars and circles lunettes, arched blade, reeded double with slice Fish and Museums Aberdeen 95 p622 vol Magazine Antiques YEAR MAKER DESCRIPTION 1810 ca LOCATION Son & Gray Robert SOURCE 1810/11 Son & Gray Robert 1811/12 Ziegler 1814/15 1815 ca Howden Francis Naughton & Jameson Edinburgh 1820-23 Edinburgh Inverness long 3/8" 11 handle, on "R" script slice, McHattie fish Kidney-shaped George 4.1oz long, ¼" 12 slice, Fish 4.1oz long, 5/8" 11 slice, Fish 1821/22 Edinburgh Forrest details no slice, Fish pp236-237 #17 VI Rabinovitch Edinburgh engraved server, Fish 2004 Catalog Shaw 2004 Nicholas Catalog Shaw Nicholas and Museums Aberdeen 1825 ca 1825 ca 1825 ca Jamieson William Jamieson Aberdeen William 1828/29 Aberdeen 12"long lines, cut bright fish, vertical with slice Fish McKay James details no slice, Fish Edinburgh shell in terminates handle design, leafy in blade pierced narrow, slice, Fish 178-179 pp #54 V Rabinovitch and Museums Aberdeen 199 Compendium of Scottish Silver DAG001378 DAG001378 DAG001294 DAG001029 MEQ 935 1968.497 1968.497 935 MEQ MEQ 935 AB Galleries AB Galleries 1990 USA AB Galleries details details Scotland of Museums National no details details no Scotland of Museums National YEAR MAKER DESCRIPTION 1834/35 LOCATION Howden James Edinburgh slice, Fish SOURCE 1834/35 Co & Elder Edinburgh no slice, Fish 1836 ca 1836 ca 1840 ca Turvey George Berry James 1840 ca Glasgow Son & Rettie M 1841/42 no details slice, Fish Aberdeen Aberdeen in shield AW no details slice, Fish 1842/43 ivory and silver slice, Fish McKay James Edinburgh no details slice, Fish Edinburgh no details slice, Fish 1992 NY Shrubsole and Museums Aberdeen and Museums Aberdeen TX, Antonio San Mall, Antiques and Museums Aberdeen 200 Forks ForksFORKS Plate 25. A pair of trefid Tableforks 1698/99 by Alexander Kincaid, Edinburgh. Courtesy of The Phoenix Collection. Photograph by Janice M Dietert. 201 Compendium of Scottish Silver Private Collection UK UK Collection Private Christies June 22, 1960 # 99 # 99 1960 22, June Christies Edinburgh of How Collection Private MEQ 937 Sothebys October 13, 1960 # 113 # 1960 13, October Sothebys Private Collection UK UK Collection Private Shrubsole Brad Inglis London Collection Phoenix The MEQ 22 L1946.50 L1946.50 HWZLWKPRWWR RQJHG´ORQJ 3ULYDWH&ROOHFWLRQ8. d dog nose, initials "A" and a thistle crest, 23.5oz 23.5oz crest, thistle a and "A" initials nose, dog d , 3 prongs , 3 prongs Scotland of Museums National details details Scotland of Museums National details details Scotland of Museums National ZLWKWKHFUHVWRIDVWDJ¶VKHDGLVVXLQJIURPD9LVFRXQW¶VFRURQ³+LQF+RQRUHW6DOXV´ monogram "CWM" "CWM" monogram total total ´ORQJ import mark, block initials "M" over "TE" "TE" over "M" initials block mark, import Edinburgh Forks, pair of dog nose, 3 pronged forks,later engraved "C"over "RB", Over struck by __B __B by struck Over FORKS 1704/05 Alexander Kincaid Kincaid 1704/05 Alexander 1709/10 Colin McKenzie Edinburgh Fork, no no McKenzie Fork, Edinburgh 1709/10 Colin 1710/11 -RKQ6HDWRXQ Ged William (GLQEXUJK Edinburgh )RUNVVHWRIGRJQRVHGSU 23oz motto, and crest pronged, 3 Hanoverian, 12, probably of set Forks, 1969 3, December Sothebys 1702/03 McKenzie Colin Edinburgh each engraved tablespoons, with pattern, 12, Hanoverian of set forks, Table 1704/05 McKenzie Colin 1706/07 Edinburgh Penman James crest a with forks pronged 3 nose, 3 dog of set Forks, Edinburgh mirrored and intertwined forks, pronged 3 nose, 4 dog of set Forks, 55 # 1960 28, April Sothebys 1698/99 Robert Bruce 1698/99 1699/1700 Bruce Robert Edinburgh available Not 1700/01 nose dog Fork, 1700/01 Edinburgh Seatoun John Haldane of motto and crest nose, 10 dog of set Forks, Seatoun John Edinburgh Edinburgh nose dog pronged 6, 3- of set Forks, struck over unclear, nose, 6 dog of set Forks, pronge 6, 3- of set Forks, 70 # 1, 1982 July Christies UK Collection Private 125 # 1960 13, October Sothebys 1698/99 Cleghorne Thomas Edinburgh no Fork, 1698/99 Kincaid Alexander Edinburgh Belgium later a with set, a larger of part prongs, 4 with trefids, of pair Forks, YEAR MAKER DESCRIPTION LOCATION SOURCE 202 Forks 79 # 137 # 79 # 156 # 156 How of Edinburgh Edinburgh of How MEQ L1946.3-4 368 Log 1935, Hancock's London London Hancock's #222 Spinks London 141 1964 # 85-88 1983 # 3KLOOLS(GLQEXUJK2FWREHU 99-101 1990 # #300 RQJó´ORQJ 3ULYDWH&ROOHFWLRQ8. RYHULDQ´ORQJR] 3KLOOLS(GLQEXUJK2FWREHU WKDFUHVW 3KLOOLS(GLQEXUJK0DUFK ´ORQJ 3ULYDWH&ROOHFWLRQ8. th 2- prongs prongs 2- th Scotland of Museums National YEAR MAKER DESCRIPTION 1712/13 LOCATION Yorstoun James Edinburgh initials with nosed, 3 dog of set Forks, SOURCE 99 # 22, 1960 January Christies 1715 ca 1715 ca Ged William 1715/16 1718/19 Campbell Colin Edinburgh 1719/20 Ged William Edinburgh Robertson of crest 3- pronged, of pair Forks, Bethune Henry 1719/20 pronged 3- nosed, dog Forks, Edinburgh Tait James Edinburgh "K" initial set, larger a of part pronged, 3- 3, Hanoverian of set Forks, 1719/20 -DPHV7DLW handles trefid pronged, 6, 3- of set Forks, Yorstoun Mungo 19 31, January Sothebys Edinburgh Edinburgh (GLQEXUJK wi Hanoverian, Fork, Scotland of Museums National motto and crest engraved Hanoverian, -pronged 6, 3 of set forks, Dessert )RUNVSDLU+DQRYHULDQZLWKSU 4, 1968 July Sothebys 55 # 1960 28, April Sothebys Sale Collection Breadalbane FD 1720 ca 5REHUW&UXLFNVKDQN 2OG$EHUGHHQ Cruickshank Robert )RUNVSDLUSURQJHG Old Aberdeen lot previous from initials different 3 pronged, Fork, +HQU\%HWKXQH +HQU\%HWKXQH (GLQEXUJK )RUNVVHWRISURQJHGZL 1721/22 (GLQEXUJK Ged William 1967 21, December )RUNVVHWRISURQJHG+DQ Sothebys 1721/22 Ged William Edinburgh Demi-lion of crest with Hanoverian, -pronged 3, 3 of set Forks, Edinburgh crest with pronged, 12, 3- of set Forks, 1993 23, April NY Sothebys 300 # 1993 23, April Sothebys 203 Compendium of Scottish Silver # 30 # 1971 1971 Christies July 27, 1966 #130 27, 1966 July Christies Wilson Walter 1972 15, March Christies #233 Private Collection UK UK Collection Private 1972 15, March Christies #126 354 1935 # a & 1955.193 1983.30 How of Edinburgh Edinburgh of How #107 Nicholas Shaw Catalog 2005 p89 2005 Catalog Shaw Nicholas # 291 "HA" 22oz 22oz "HA" ó´ORQJ Edinburgh Forks, set of 6 Hanoverian, crest andmotto of Campbell of Woodhall Noble Collection James Mitchelson Mitchelson James Edinburgh no details 3, forks, Table 1991, October NY Sothebys Edmonstoun I I Edmonstoun 1734/35 1738/39 Ker James 1741/42 & Edinburgh knives 12 with pronged, 12, 3- of set Forks, #96 1937 Edinburgh of How 1727/28 Aytoun William 1727/28 Edinburgh Ker James 1728/29 motto and crest pronged, 3- 12, Hanoverian, of set Forks, Bethune Henry 1728/29 Edinburgh Bethune Henry Edinburgh 1728/29 all 24.6oz pronged, 3- 12, Hanoverian, of set Forks, all 19.5oz 10, Hanoverian, of set Forks, Bethune Henry Edinburgh 1960 30, November Christies 1729/30 no details pair, Forks, Aytoun William Edinburgh details no 6, of set forks, Dessert Edinburgh oz 23.1 Fox, of crest and 1980, 6, November coronet with Sothebys pronged, 12, 3- of set Forks, 1965 28, April Christies Sale Collection Breadalbane Scotland of Museums National Scotland of Museums National 1732/33 Rollo John Edinburgh 23oz coronet, and motto and crest pronged, 3- 12, Hanoverian of set Forks, 10, November Christies 1733/34 Aytoun William Edinburgh initials and coronet a with engraved -pronged, 12, 3 of set forks, Dessert YEAR MAKER DESCRIPTION 1724/25 Alexander LOCATION SOURCE 1725 ca 1725 ca Bethune Henry 1725/26 Graham Patrick Edinburgh 1.8oz ¼", 7 stated, not date marked, fully pronged, 3- Fork, Edinburgh motto, a with thistle and rose intertwined of crest pronged, 11, 3- of set Forks, 2003 29, April Wallis & Woolley 204 Forks ry ry 1968 1968 1966 # 97 # 1966 D ecember 11, Sothebys Scone Palace, April 23, 70 1979 # #334 p143, Collection Sothebys April 11, 1968 # 7 # 1968 11, April Sothebys J Bourdon-Smith London K.1998.450 K.1998.450 Christies May 15, 1981 #63 15, 1981 May Christies 1982 21, May Edinburgh Phillips #118 PhillipsEdinburgh October 22, 1982 #107 FUHVWRIDILVWKROGLQJDUURZVPRWWR³8QLWH´ FUHVWRIDELUG´ORQJR]HDFK :DUN+XQWLQJWRQ/LEU details details Scotland of Museums National finial, swiveling hinge, 28" long long 28" hinge, swiveling finial, (Note: apparently another singleand a set 4 exist of withthe same crest and PRWWR ´ORQJ Edinburgh Edinburgh Talbot of motto and crest 3-pronged, 6, of set Forks, Collection Private Edinburgh Edinburgh details no fork, Serving Collection Swan Maple The Weems Edinburgh Forks, 3-pronged, withlater initial "M",6.4oz Sothebys February 24, Over striking another another striking Over William Dempster Dempster William 1781/82 Downie David : 3&XQQLQJKDP, (GLQEXUJK Edinburgh )RUNVSDLURISURQJHG no details fork, Toasting p550 Marks Jackson 1747/48 1749/50 Gordon Robert Lothian Edward Edinburgh "K" initial with pronged, 3- Fork, #137 1979 31, January Sothebys 1749/50 1750/51 Oliphant Ebenezer 1758/59 Edinburgh Robertson & Lothian Edinburgh Taylor 24oz William "M", initial with engraved 3-pronged, Fork, 23.8oz motto, and crest with Hanoverian, 3-pronged Forks, Edinburgh 13.2oz 7, 3-pronged, of set Forks, 1981 23, April Sothebys #58 1979 25, April Christies D Christies 1769/70 or Davie William 1770/71 Ker William Edinburgh silver with handle horn twisted tines, 4 bannock, or toast for fork, Toasting 1740/41 1741/42 Lothian Edward 1743/44 James Ker James Edinburgh 22.3oz knives, with 3-pronged 12, Hanoverian, of set Forks, Edinburgh 10oz 6, 3-pronged, of set Forks, #95 1937 Edinburgh of How no Gilliland Fork, Edinburgh 1765/66 James #184 1987 12, October Christies YEAR MAKER DESCRIPTION FD LOCATION 0LFKDHO)RUUHVW &DQRQJDWH )RUNSURQJHG+DQRYHULDQ SOURCE 205 Compendium of Scottish Silver XPVRI6FRWODQG 0XVHXPVRI6FRWODQG &HQWHU6DQ$QWRQLR7; LRQDO0XVHXPVRI6FRWODQG 0(4 0(4 0(4 12 1993 # (GLQEXUJK++ (GLQEXUJK++ (GLQEXUJK++ 86$ (GLQEXUJK++ 0(4 ´ORQJ +XQWOH\+RXVH0XVHXP VWDQGPRWWR´ORQJ +XQWOH\+RXVH0XVHXP KKHUDOGU\ 6:\OHU1< 1DWLRQDO0XVHXPVRI6FRWODQG UHVWDQGPRWWR´ORQJ +XQWOH\+RXVH0XVHXP ´ORQJ +XQWOH\+RXVH0XVHXP GHWDLOV 6RWKHE\V*OHQHDJOHV$XJXVW NVQRGHWDLOV 1DWLRQDO0XVH )RUNVQRGHWDLOV 1DWLRQDO (GLQEXUJK 7DEOHIRUNXSWXUQHGKDQGOH(QJOLVKILGGOHSDWWHUQ (GLQEXUJK 7DEOHIRUNQRGHWDLOV 6RWKHE\V*OHQHDJOHV$XJXVW -RKQ0F'RQDOGRU 0DWWKHZ&UDZ II FD )UDQFLV+RZGHQFD (GLQEXUJK -DPHV(UVNLQHca 1800 2\VWHUIRUNVSDLUQRGHWDLOV Erskine James $EHUGHHQ )RUNVVHWRIQRGHWDLOV -RKQ=LHJOHU Aberdeen motto and crest 6,, of set Forks, (GLQEXUJK 9HQLVRQIRUNVSURQJHGFUH 1DW August Gleneagles Sothebys $OH[DQGHU6SHQFH (GLQEXUJK 0& 7DEOHIRUNEULJKWFXW -DPHV0F.D\ : 3&XQQLQJKDP (GLQEXUJK 7DEOHIRUNVVHWRIVPDOOZLW - :0DUVKDOOFD (GLQEXUJK $QGUHZ'DYLGVRQ 7DEOHIRUNQRGHWDLOV $UEURDWK $QWLTXH YEAR MAKER DESCRIPTION LOCATION 3DWULFN5REHUWVRQ (GLQEXUJK 6HUYLQJIRUNSURQJHGF SOURCE FD -RKQ/HVOLH $EHUGHHQ )RU $OH[DQGHU+HQGHUVRQ (GLQEXUJK 7DEOHIRUNVVHWRIQR 206 Forks DAG11014 DAG11014 Noble Collection Collection Noble 2005 Catalog Shaw Nicholas p102 2005 Catalog Shaw Nicholas p102 Galleries AB Galleries 13.8oz 13.8oz Glasgow Glasgow no details pair, forks, Pudding and Museums Aberdeen MacKintosh MacKintosh (made David by Hyslop) 1840 ca 1840 ca Rennie Sellars John 1902/03 Charles Wick 15oz ½", 8 Sutherland, of motto and crest pattern, English 6, Old of set Forks, Collection Noble YEAR MAKER DESCRIPTION 1835 ca LOCATION Maxwell Richard Tain long, ¾" 7 "In Defense", motto and crest pattern, 6, fiddle of set Forks, SOURCE 207 Compendium of Scottish Silver 208 Knives KnivesKNIVES Plate 26. Two from a set of 12 1786-90 Dessert Knives by Patrick Robertson, Edinburgh. Courtesy of a private collector. Photograph by Janice M Dietert. 209 Compendium of Scottish Silver 210 Knives 937 #96 Lyon & Turnbull August Collection Murray The 195 # 2003 20, Christies Fingask Castle April April Castle Fingask Christies 1993 27, Collection Private 1974.407-409 1099-1101 MEQ Collection Private Christies Fingask Castle April April Castle Fingask Christies 1993 27, Collection Private Christies July 26, 1972 # 332 # 332 26, 1972 July Christies Edinburgh of How Private Collection UK UK Collection Private 1102 MEQ How of Edinburgh Edinburgh of How ò´ORQJ Table knives, 2, no details details no 2, knives, Table Scotland of Museums National truncated terminals, each engraved with crest and motto of Craig of of Craig of motto and crest with engraved each terminals, truncated 5LFFDUWRQRULJLQDOVWHHOEODGHVZLWKFXWOHU VPDUN%22* later blades marked "DUN" slender and maybe reconverted forks forks reconverted maybe and slender "DUN" marked blades later cutler's mark "Wight" "Wight" mark cutler's monogram, with 5 similar unmarked cheese knives knives cheese unmarked similar 5 with monogram, engraved "Mary Lady Hay Randerstone elder 1710", KNIVES 1730 ca 1730 ca II Lake Robert 1734/35 Ker James Glasgow 1740/41 1745 ca Lothian Edward grips silver 3, with Knives, Edinburgh Oliphant Lawrence 1760 ca Edinburgh handles on Edinburgh volutes capped leaf forks, with grip, 12, pistol of set knives, Table 1 Edinburgh of How forks with handles, volute plain grip, 12, pistol of set Knives, Robertson Patrick blades steel with handled, 12 ,pistol of set knives, Table Edinburgh flat almost with handles section ovoid tapering 6, plain, of set knives, Table #95 1937 Edinburgh of How Edinburgh of How Scotland of Museums National 1730 ca 1730 ca available Not Edinburgh above, knives with suit en handled, pistol voluted, tail, rat 6, of set Knives, 1720 ca 1720 ca 1730 ca available Not available Not Edinburgh Edinburgh "KH" initials handled, pistol 12, plain of set Knives, with blades steel original handles, pistol voluted 12, of set knives, Dessert Collection Private 1710 ca 1710 ca McKenzie Colin 1710/11 Edinburgh Coline McKenzie Edinburgh a with engraved blades steel handled, 9, pistol of set knives, Table 1709/10 Bruce Robert Edinburgh set, cutlery and flatware a larger of 8, part of set handled, cannon Knives, 1690 ca 1690 ca Seatoun John Edinburgh only mm ends, domed stepped handles, cylindrical tapering Knives, # 339 26, 1972 July Christies YEAR MAKER DESCRIPTION LOCATION SOURCE 211 Compendium of Scottish Silver ROOHFWLRQ 1978-697 1978-697 Dundee Museums and Art Galleries 6 1993 # Bell of Aberdeen 1968 Aberdeen of Bell Collection Private MEQ 845 reeded effect marked 1789/90 or 1790/91 by Patrick Robertson, handles unmarked, crest crest unmarked, handles Patrick Robertson, by 1790/91 or 1789/90 marked andmotto "Corda Serrata Pando" and viscount's coronet details no 4, of set Knives, Scotland of Museums National PLOWRQ ,QFKHV (GLQEXUJK %XWWHUNQLIHô´ORQJ 7KH3KRHQL[& 1873/74 Ha 1875/76 Chisolm & McKay Edinburgh no details pair, knives, Butter Collection Swan Maple The 1830 ca 1830 ca Ferguson William Elgin details no pattern, fiddle pair, knives, Butter August Gleneagles Sothebys 1800 ca 1800 ca Jamieson Charles Inverness a it give to lines incised parallel handle with blade, narrow knife, Dessert 1790 ca 1790 ca Robertson Patrick Edinburgh blades handles, silver filled and blades slender with 12, of set Tea knives, YEAR MAKER DESCRIPTION 1780 ca LOCATION Robertson Patrick Edinburgh SOURCE 212 Ladles LadlesLADLES Plate 27. A pair of Dundee Sauce Ladles 1790ca by James Douglas. Courtesy of The Phoenix Collection. Photograph by Janice M Dietert. 213 Compendium of Scottish Silver 26, 26, Hunt Antiques, San Antonio, TX TX Antonio, San Antiques, Hunt Collection Phoenix The 1988 #432 Woolley & Wallis Auction, Auction, Wallis & Woolley #742 2005 26, January a-b 1968.989 929-929 MEQ 2001 p80 Jackson Marks p519 #28 p 111 p106 #25 1990 21, UK Collection Private H.1996.33 H.1996.33 742 2005 # details details Scotland of Museums National 4" di cypher below a coronet, mm only 4x, 2oz 2oz 4x, only mm a coronet, below cypher LADLES 1765 ca 1765 ca 1765 ca Graham Adam Gordon James Glasgow Aberdeen details no English, Old ladle, Soup no details ladle, Soup 1994 London Bourdon-Smith J August Gleneagles Sothebys 1763/34 Gairdner Alexander 1765 ca Edinburgh Graham Adam details no pair, ladles, Soup 1765 ca Graham Adam Glasgow long ¼" 17 ladle, Punch Glasgow bowl 14" long, "H/EM", initials interlocking script, English Old ladle, Soup Scotland of Museums National Winter Catalog Shaw Nicholas YEAR MAKER DESCRIPTION LOCATION SOURCE 1704/05 Cumming Thomas Glasgow questionable form exact Ladle, 1911 of Exhibition Glasgow 1728/29 Graham Patrick 1733/34 Edinburgh Aytoun William 1745 ca no details ladle, Soup Edinburgh Johnston Alexander 1750 ca Dundee long ¼" 17 bowl, oval ladle, Punch Wildgoose Robert 1750 ca no details ladle, Punch Old Aberdeen no details Steven John ladle, Soup Dundee no ladle, Soup 2004 Catalog Shaw Nicholas I, vol 1911, Exhibition Glasgow November Edinburgh Christies Castle Antiques Grantully 1755 ca 1755 ca Dempster & Ker 1755/56 Edinburgh Dempster Ker & 2oz a coronet, below cypher engraved Hanoverian, ladle, sifter Sugar Edinburgh engraved bowl, drop, shallow double with Hanoverian ladle, Sugar sifter January Wallis & Woolley 214 Ladles 1978-696 1978-696 MEQ 425 The Phoenix Collection Collection Phoenix The Private Collection Collection Private USA 1966-27b 1966-27b USA Private Collection Collection Private H.1996.29 H.1996.29 2000 p89 Huntley House Museum Huntley House 3468/69 HH Edinburgh 2000 p89 MEQ 1218 1218 MEQ Galleries HVWDQGPRWWR´ORQJR] &DPSEHOO0XVHXP&DPGHQ1- SHGERZOWZLVWHGKDQGOHFUHVWDQGPRWWR´ details details Scotland of Museums National "B" also stamp of "Breadalbane" on handle, 14 ¾" long long ¾" handle, 14 on "Breadalbane" also stamp of "B" long long Edinburgh Soup ladle, Hanoverian, with shell bowl J Bourdon-Smith London Edinburgh Soup ladle, Hanoverianpattern, 7.2oz J Bourdon-Smith London Edinburgh Edinburgh no details ladle, Soup Edinburgh details no Ladle, p549 Marks Jackson Scotland of Museums National Edinburgh Edinburgh details no bowl, shell Ladle, Scotland of Museums National illiam Davie or or Davie illiam William Davie Davie William striking another) striking William Dempster Dempster William William Dempster or or Dempster William Davie William William Dempster Dempster William 1770/71 or Dempster William *LOOLODQG .HU (GLQEXUJK 6RXSODGOHFLUFXODUERZOFU 1771/72 (over Reid James 1772 ca 1772 ca 1772/73 Cornfute James or Davie William Perth set a large of part pattern, Hanoverian bowl, round ladle, Soup 66.32.99 Museum Brooklyn 1774/75 (block) WD 1775 ca 1775 ca Cornfute James 1775 ca Perth Cornfute James Perth 6.5oz long, 13/4" 13 "JP", initials English, Old ladle, Soup no ladle, Soup Winter Catalog Shaw Nicholas 1770 ca 1770 ca Gordon James 1770 ca W Aberdeen 6.1oz 1/8", 13 pattern, English Old ladle, Soup Winter Catalog Shaw Nicholas 1770 ca 1770 ca Campbell & Milne Glasgow initial script bowl, to attachment shell with pattern, Hanoverian ladle, Soup $OH[DQGHU*DLUGQHU (GLQEXUJK 6DXFHODGOHVSDLUVFDOOR YEAR MAKER DESCRIPTION 1765 ca LOCATION Craw William Canongate details no ladle, Soup SOURCE Art and Museums Dundee 215 Compendium of Scottish Silver DAG000903 DAG000903 1986-122 1986-122 HE\V*OHQHDJOHVS Nicholas Shaw Catalog Winter Winter Catalog Shaw Nicholas 2000 p89 AB Galleries Galleries Huntley House Museum Huntley House 2538/64 HH Edinburgh 1987 #238 403 1978 # 1990 #10 1988 #34 1993 #16 ³5´¶LQVFULSW English, no details details no English, Collection Private 14" long , 6.6oz 6.6oz , 14" long ´ORQJRYHUDOO Edinburgh Edinburgh details no ladle, Punch (GLQEXUJK 3XQFKODGOHVKHOOVKDSHGZRRGHQKDQGOHPRQRJUDPPHG Collection Swan Maple The William Dempster Dempster William William Davie or or Davie William Dempster William 1780 ca 1780 ca Leslie John 1780 ca Law William 1780/81 Aberdeen Welsh James no details Dundee ladle, Punch Edinburgh details no ladle, Soup Old ladle, Soup and Museums Aberdeen Art and Museums Dundee YEAR MAKER DESCRIPTION 1775/76 LOCATION or Davie William SOURCE 1776 ca 1776 ca script WD 1777/78 Mathie Peter 1779/80 Hewitt James 1779/80 Edinburgh Hewitt James no details ladle, Soup Edinburgh 1779/80 3DWULFN5REHUWVRQ 8.5oz "McM", engraved English, Old ladle, Soup Edinburgh 1780 ca Hewitt James (GLQEXUJK details no ladle, Sauce Smith James 6RXSODGOHQRGHWDLOV 1780 ca Edinburgh M W 1780 ca details no Aberdeen ladle, Soup Borthwick Thomas no details ladle, Soup 1780 ca 29, August Gleneagles Sothebys Inverness Scott William Edinburgh long ¾" 13 "GBM", initials English, Old ladle, Soup no details ladle, Soup Dundee August Gleneagles Sothebys praestar", prodestion "Praetio motto and crest edge, feather ladle, Soup August Gleneagles p549 Sothebys Marks Jackson 6RWK p549 Marks Jackson May House, Hopetoun Sothebys August Gleneagles Sothebys 216 Ladles ril 10, 10, ril S 3DODFH$SULO JD]LQHYROS 6:\OHU1< /RQGRQ&786$ /RQGRQ -%RXUGRQ6PLWK&DWDORJ $XWXPQS (GLQEXUJK++ JH´ORQJ /\PDQ$OO\Q$UW0XVHXP1HZ RWWRRI0DFNLQWRVK LJKWFXWVWHPVLOYHUJLOWIOXWHGERZOLQLWLDOV 6RWKHE\V6FRQH LQLWLDOV 6RWKHE\V6FRQH3DODFH$SULO G(QJOLVKSDWWHUQLQLWLDOV)RU7 3ULYDWH&ROOHFWLRQ DYHGLQLWLDO &KULVWLHV/RQGRQ2FWREHU OLVKSDWWHUQZLWKFUHVWDQGPRWWRR] 6RWKHE\V6FRQH3DODFH$ JUDYHG5& 6RWKHE\V*OHQHDJOHV$XJXVW DLOV &KULVWLHV/RQGRQ 11 ½" long, 3oz 11 ½" 3oz long, Edinburgh Edinburgh erasures with 3 motto, and crest with 2 5, of set ladles, Sauce , Antiques Walters William (GLQEXUJK 6RXSODGOHVSRLQWHG2OG(QJOLVKSDWWHUQFUHVWDQGP (GLQEXUJK 3XQFKODGOHZLWKERQHKDQGOHERZOZLWKVFDOORSHGHG (GLQEXUJK 6RXSODGOHEULJKWFXW´ORQJ +XQWOH\+RXVH0XVHXP William Dempster Dempster William *ODVJRZ 3UREDEO\-RKQ Edmonstoun William Davie or or Davie William Dempster William 3DWULFN5REHUWVRQ -DPHV'RXJODV (GLQEXUJK 3DWULFN5REHUWVRQ /DGOHORQJ (GLQEXUJK (GLQEXUJK $OH[DQGHU=LHJOHU 6DXFHODGOHVSDLUSRLQWHG2O 6RXSODGOH2OG(QJOLVKHQ (GLQEXUJK 6RXSODGOHSRLQWHG2OG(QJ $QWLTXHV0D -&ODUN RYHUVWUXFN (GLQEXUJK $OH[DQGHU*DLUGQHU (GLQEXUJK 6RXSODGOHQRGHWDLOV :LOOLDP'DYLHRU 6DXFHODGOHVSDLUQRGHW 7KRPDV%U\GHQRI -DPHV+HZLWW (GLQEXUJK 6RXSODGOH2OG(QJOLVKZLWKEU ,( )UDQFLV+RZGHQ (GLQEXUJK 6RXSODGOH2OG(QJOLVKZLWK YEAR MAKER DESCRIPTION 1780/81 LOCATION 1782/83 WD Aitchison Alexander Edinburgh no details ladle, Soup SOURCE Collection Swan Maple The -DPHV*LOOLODQG (GLQEXUJK 6RXSODGOH2OG(QJOLVKHQJU 217 Compendium of Scottish Silver p 111 #33 p 111 1878 #421 Woolley & Wallis January 26, 26, January Wallis & Woolley 212 2005 # Woolley & Wallis Auction, Auction, Wallis & Woolley #212 2005, 26, January Williamsburg MEQ 548 1987 #238 1993 #313 2006 #15 #14 #15 ir, no details details no ir, Scotland of Museums National 6oz 6oz sailing ship, 6oz 6oz sailing ship, Edinburgh Edinburgh .5oz long, ¼" 6 "G", initial script pattern, English Old pointed ladle, Sauce 14, January 7378438884 EBAY oval) oval) 1794/95 Howden Francis Edinburgh 6.7oz "JB", engraved English, Old ladle, Soup 29, August Gleneagles Sothebys 1793/94 Ziegler Alexander Edinburgh details no ladle, Soup I, vol 1911, Exhibition Glasgow 1790/91 Leslie John 1790 ca Leslie John Aberdeen no details ladle, Sauce Aberdeen pa ladles, Toddy Colonial - Collection Hyman 1790 ca 1790 ca Cornfute James 1790 ca Perth Pearson Joseph 1790 ca an in (conjoined Dumfries MK no details ladle, Soup 13" "RS initials English, Old ladle, Soup August Gleneagles, Sothebys August Gleneagles, Sothebys 1790 ca 1790 ca 1790/91 Clark William Christie George Greenock Edinburgh details no English, Old ladle, Soup initials, "RR" and crest ship sailing pattern, English Old pointed ladle, Soup 1994 London Bourdon-Smith J 1790/91 Christie George Edinburgh a of crest the below "RR" initials pattern, English Old pointed ladle, Soup YEAR MAKER DESCRIPTION 1789/90 LOCATION 1789/90 Douglas James Robertson Patrick Edinburgh Edinburgh details no ladle, Toddy pictured not 4, ladles, Sauce SOURCE 1988 October London Christies 550 p Marks Jackson 1790/91 Robertson Patrick 1790/91 Edinburgh Robertson William not pictured pair, ladles, Sauce Edinburgh pictured not pair, ladles, Sauce 1988 October London Christies 1988 October London Christies 218 Ladles 93 Antiques, NY 1993 #47 2003 21, August USA 1992 USA Collection Phoenix The The Phoenix Collection Collection Phoenix The 1, 1981 # 391 MEQ 953 1969.689 1969.689 953 MEQ # 111 1977 15, November 1992 USA M Rafael, NY 1995 NY Rafael, M Collection Phoenix The 2000 p82 QJOLVKSDWWHUQLQLWLDOV/+&´ORQJ +\GH3DUN&HQWHU1< English pattern, initials "SAR" "SAR" initials pattern, English Collection Private (QJOLVKSDWWHUQLQLWLDOVVFULSW³$*&´ORQJ -RQDWKDQ7UDFH tureen of same date date same of tureen Scotland of Museums National Soup ladle, Old English, 14"long 14"long English, Old ladle, Soup USA NY Center, Park Hyde motto in oval medallion, probably of Hunter 5 ½" long long ½" 5 Hunter of probably medallion, oval in motto another) another) 1800 ca 1800 ca Wilson Robert 1800 ca Cunningham P & W Edinburgh Edinburgh Fingast of Threipland Murray of crest with ladles, Toddy punch twist hand silver pair, Ladles, Sale Scottish The Bonham's 1993 Plus Silver 1799/1800 1799/1800 striking (over IG 1796/97 1797/98 Howden Francis Wilson Robert Edinburgh 1797/98 Old pointed ladle, Soup Howden Francis Edinburgh 5.4oz crest, a with ladle, Soup Edinburgh with use for Ladle, September Gleneagles Sothebys 1798/99 Howden Francis 1798/99 Edinburgh mark RW 6.5oz initials, English, Old ladle, Soup $OH[DQGHU+HQGHUVRQ (GLQEXUJK Edinburgh 6RXSODGOHSRLQWHG2OG crest English, Old ladle, Soup House Hopetoun Sothebys NY Antiques, Trace Jonathan 1795 ca 1795 ca Douglas James 1795/96 Cunningham William Dundee Edinburgh $OH[DQGHU*DLUGQHU details no pair, ladles, Sauce long 6 1/8" pattern, English Old (GLQEXUJK pointed ladle, Toddy 6DXFHODGOHSRLQWHG2OG( Winter Catalog Shaw Nicholas Collection Swan Maple The YEAR MAKER DESCRIPTION 1794/95 LOCATION 1795 ca mark _ L Douglas James Dundee and crest engraved, cut, bright pattern, English Old pointed pair, ladles, Sauce no details , English Old ladle, Soup SOURCE USA1993 NY Wyler, 219 Compendium of Scottish Silver MEQ 550 MEQ 546 MEQ 108 1993 #6 1993 #6 1987 #15 1987 #15 1987 #245 1988 #13 51 1999 p , no details details no , Scotland of Museums National no details details no Scotland of Museums National , no details details no , Scotland of Museums National Ladle,mark withanchor, an no details Sothebys London November Glasgow, or or Glasgow, Paisley 1800 ca 1800 ca Gillet Nathaniel Aberdeen ladle Toddy 1800 ca 1800 ca Erskine James Aberdeen pair ladle, Toddy YEAR MAKER DESCRIPTION 1800 ca LOCATION Henderson A Edinburgh pattern English Old pointed 6, ladles, Toddy SOURCE August Gleneagles Sothebys 1800 ca 1800 ca 1800 ca Cornfute James 1800 ca Hewitt James Perth 1800 ca thistle & mark JP Dumfries mark D R 1800 ca English Old ladle, Soup handle wood ladle, Punch H W 1800 ca Perth no details ladle, Punch Davie Thomas 1800 ca pictured not ladle, Soup Perth, Keith John Greenock 1800 ca 1800 ca details no ladle, Toddy Erskine James 1800 ca Banff Jamieson Charles Aberdeen Gray David Inverness 1800 ca no details ladle, Soup English Old ladle, Soup English Old ladle, Soup Erskine James 1992 London Bourdon-Smith J 1992 London Bourdon-Smith J Dumphries "PMcN" initials Aberdeen English, Old ladle, Sauce ladle, Toddy 1992 London Bourdon-Smith J November London Sothebys August Gleneagles Sothebys Autumn Catalog Shaw Nicholas 1994 London Bourdon-Smith J April House, Hopetoun Sothebys 1994 London Bourdon-Smith J 220 Ladles 1987-160 1987-160 K.1998.1140 K.1998.1140 1988 #12 MEQ 571 MEQ 255 MEQ93 MEQ891 MEQ93 MEQ 255 Galleries 1991 1973.244-249 1087-1092 MEQ 1991 Canada Collection Phoenix The 1988 #15 MEQ 1587-1589 1587-1589 MEQ 1999 p51 ones, no details details no ones, Scotland of Museums National ir, no details details no ir, Scotland of Museums National no details details no Scotland of Museums National y ladles, set of 6, no details details no 6, of set ladles, y Scotland of Museums National Edinburgh Edinburgh details no 3, ladles, Toddy Scotland of Museums National Edmonstoun II II Edmonstoun 1807/08 Son & Gray R 1808/09 Son & Gray Robert Edinburgh Edinburgh pictured not pair, ladles, Toddy no details ladle, Soup April House, Hopetoun Sothebys 130 p536 vol Magazine Antiques 1800 ca 1800 ca Sellar John Wick different 3 ladles, Toddy 1800 ca 1800 ca Lambert Peter 1802/03 Zeigler John Ziegler Montrose 1804/05 Todd Edinburgh 1804/05 John Henderson Alexander no details ladle, Soup Edinburgh Edinburgh 1805/06 no details ladle, Sauce 6.5oz Stirling, of motto and crest English, Old ladle, Soup Son & Gray Robert Edinburgh 1805/06 1805/06 long ¾" 13 crest, pattern, fiddle ladle, Soup I Cunningham P & W Edinburgh Canada Toronto Wine, Louis striking) (over IG 1806/07 Alexander long ¾" 6 disk, stag on of crest applied pattern, oar ladle, Sauce Collection Phoenix The no details ladle, Soup Art and Museums Dundee Toronto Antiques, Lorentz Collection Swan Maple The April House Hopetoun Sothebys 1806/07 Erskine James 1806/07 I Cunningham P & W Aberdeen Edinburgh ½"long 6 "AL", script with ladle, pattern, Toddy fiddle ladle, Sauce Autumn Catalog Shaw Nicholas YEAR MAKER DESCRIPTION 1800 ca LOCATION Erskine James Aberdeen pa ladles, Toddy SOURCE 221 Compendium of Scottish Silver 995 rdon-Smith London 1994 London rdon-Smith USA 181.48 USA 1999 p51 1999 p51 MEQ L.1962.689 L.1962.689 MEQ MEQ 109 1999 p51 822b MEQ MEQ 823 1965.1894 1965.1894 823 MEQ 1988 #436 Canada 1991 Canada -/òORQJR] 1LFKRODV6KDZ&DWDORJS the Trades Punch Bowl Bowl Punch Trades the Scotland of Museums National UQ´ORQJ &LW\0XVHXPRI6W/RXLV02 ttern, no details details no ttern, 1994 London Bourdon-Smith J pattern, no details details no pattern, Bou J no details details no Scotland of Museums National details details Scotland of Museums National tails tails Scotland of Museums National Soup ladle, no details no details ladle, Soup Toronto Antiques Lorentz Aberdeen Aberdeen 6" "JEM", initials pattern, fiddle ladle, Sauce Autumn Catalog Shaw Nicholas Booth Assayed Edinburgh FD 1815 ca -RKQ2UU Alexander & George *UHHQRFN 6RXSODGOH2OG(QJOLVKLQLWLDOV0 1810 ca 1810 ca 1810/11 Izat David Howden Francis Edinburgh Banff with use for ladle, Toddy pa fiddle ladle, Soup $OH[DQGHU+HQGHUVRQ (GLQEXUJK &UHDPODGOHILGGOHSDWWH 1810 ca 1810 ca Jamieson William 1810/11 Aberdeen de Ziegler 1810/11 Ziegler 13"long pattern, fiddle ladle, Soup no Ladle, Edinburgh Edinburgh crest, with Ladle Autumn Catalog Shaw Nicholas 1810/11 1810 ca D & R I Keay Robert 1810 ca Ewan John Perth Aberdeen no details 6, of set ladles, Toddy fiddle ladle, Soup "D" ladle, script Sauce August Gleneagles Sothebys 1994 Toronto, Gordin, V 1810 ca 1810 ca 1810 ca Howden Francis McQueen John Edinburgh ½"long 8 "M", initial script ladle, Toddy Banff no ladle, Toddy Collection Phoenix The YEAR MAKER DESCRIPTION 1809/10 LOCATION Henderson Alexander Edinburgh Horseburgh of motto and crest stem, angled pattern, fiddle ladle, Sauce 1 NY Shrubsole, SOURCE 1809/10 AR mark 1809/10 AR 222 Ladles H.1994.1076 H.1994.1076 p106 1994 Canada Williamsburg 1999 p51 1999 p51 1987 #15 1987 #15 1952.44 1991 #11 728-729 MEQ ir, no details details no ir, Scotland of Museums National details details Scotland of Museums National Aberdeen Aberdeen long 7" "G", initial pattern, fiddle ladle, Sauce Autumn Catalog Shaw Nicholas Dumphries Dumphries long ¾" 6 pattern, fiddle ladle, Sauce Collection Phoenix The Booth (with extra mark K) K) mark extra (with 1820 ca 1820 ca Booth George 1820 ca 1820 ca Jamieson William Aberdeen Jamieson Aberdeen William 1820 ca 7.9oz long, ½" 13 "M", initial pattern, fiddle ladle, Soup Aberdeen English Old ladle, Soup Jamieson William 1820 ca pattern fiddle long ladle, Sauce Aberdeen 1820 ca Frazer D details no 12, of set ladles, Toddy Alexander & George 2004 Catalog Shaw Nicholas Inverness English Old ladle, Soup Toronto Antiques, Lorentz 1993 Edinburgh Goodwin's, Colonial Collection, Hyman 1993 Edinburgh Goodwin's, YEAR MAKER DESCRIPTION 1816/17 LOCATION McDonald D no details plain, Ladle, SOURCE November London Sothebys 1820 ca 1820 ca PT 1817/18 1817/18 mm W A mm WM 1820 ca Peterhead Glasgow Mark Hinchsliffe no ladle, Sauce Edinburgh no details ladle, Soup 1820 ca no details ladle, Soup 1820 ca Camerson Alexander Dundee Rae Nathaniel shaped fiddle ladle, Sauce Aberdeen pa ladles, Toddy TX Antonio San Mall, Antiques August Gleneagles Sothebys 1991 House Hobart 1820 ca 1820 ca Simpson William Banff details no pair, Ladles, Scotland of Museums National 223 Compendium of Scottish Silver Catalog Autumn Autumn Catalog 1999 p51 1999 p51 1999 p51 1999 p51 1999 p52 1999 p52 1987 #245 Williamsburg 1999 p52 1999 p52 199 p52 1999 p61 1999 p52 1994 Canada Dundee Sauce ladle,no details The Maple Swan Collection Edinburgh assay YEAR MAKER DESCRIPTION 1820 ca LOCATION Cameron Alexander Dundee long 6" "M", initial pattern, ladle, fiddle Sauce Autumn Catalog Nicholas Shaw SOURCE 1820 ca 1820 ca Mark Hinchsliffe 1820 ca Dumphries Gray David 1820 ca long ¾" 6 "C", initial pattern, ladle, fiddle Sauce Whitecross William Dumphries Aberdeen long ¾" 7 "C", initial pattern, fiddle ladle, Toddy long 13" "ABD" engraved pattern, fiddle ladle, Soup Autumn Catalog Nicholas Shaw Autumn Catalog Shaw Nicholas Autumn Catalog Shaw Nicholas 1820 ca 1820 ca 1820 ca Davie Thomas McKay James 1820 ca Greenock Murray Charles Edinburgh 1820 ca English Old ladle, Soup no details 5, of ladles, set Toddy Perth Cameron Alexander Dundee no details ladle, Punch ½"long 14 well", "watch motto and a stag of crest pattern, fiddle ladle, Soup Shaw Nicholas August Gleneagles Sothebys 1992 Edinburgh Goodwin's, Colonial Collection, Hyman 1820 ca 1820 ca Clark William 1820 ca Murray Charles Greenock 1820 ca 13"long "M", Perth initial I pattern, Keay Robert fiddle ladle, Soup 1821/22 1821/22 Allen William Cameron Perth ¼"long 15 ladle, Punch I G 1822/23 Alexander Edinburgh long ½" 13 "H", initial ladle, soup pattern, Fiddle details no ladle, Sauce Autumn Catalog Shaw Nicholas Edinburgh 6 #5 & pattern fiddle pair, ladles, Syrup Autumn Catalog Nicholas Shaw Autumn Catalog Shaw Nicholas Toronto Antiques, Lorentz 130 p536 vol Magazine Antiques 224 Ladles inter 1959.587 1959.587 2000 p89 2000 p89 1999, p51 1999, 1134 MEQ 1999 p51 1999 p51 1999 p51 1961.10-11a 1961.10-11a USA 1993 USA DC USA 1993 USA DC 1994 USA details details Scotland of Museums National details details Scotland of Museums National Edinburgh Edinburgh 6.3oz long, 6" "M", initial pattern, king's 6, of set Ladles, Autumn Catalog Shaw Nicholas Edinburgh Edinburgh details no , pattern King's ladle, Soup TX Austin, Antiques, Whirligig Edinburgh Edinburgh pattern fiddle ladle, Soup Washington, Antiques, Getz M Edmonstoun Edmonstoun Son Son YEAR MAKER DESCRIPTION 1822/23 LOCATION Cunningham P & W Edinburgh 8.5oz long, 5/8" 13 shell, pattern, fiddle shaped, shell ladle, Soup W Catalog Shaw Nicholas SOURCE 1822/23 1823/24 McKay James 1824/25 Alexander McCallum B Edinburgh no details ladle, Punch Glasgow details no ladle, Soup p64 Luddington 1993 Plus Silver 1824/25 McHattie George 1825 ca Edinburgh Ross Peter 1825 ca details no ladle, Punch Keay Robert 1825 ca Aberdeen 1825 ca King Alexander Perth long ¼" 6 "JRSG", initials pattern, fiddle ladle, Sauce Keay R & R 1825/26 Petershead pattern IM fiddle ladle, Soup long 6" pattern, fiddle ladle, Sauce Perth long ¾" 6 "D", initial pattern, fiddle ladle, Toddy Autumn Catalog Shaw Nicholas Edinburgh no pair, ladles, Punch Scotland of Museums National Autumn Catalog Shaw Nicholas Autumn Catalog Shaw Nicholas p94 2005 Catalog Shaw Nicholas 1825/26 William Marshall & & Marshall 1825/26 William 1825/26 William Marshall & & Marshall 1825/26 William 1825/26 McKay James 1826/27 McKay James Edinburgh no details ladle, Sauce Edinburgh no ladles, Toddy DC Washington, Antiques, Joya's 225 Compendium of Scottish Silver DAG001045 DAG001045 MEQ 51 AB Galleries 1994 USA DC Washington p57 #43, 2001 Autumn 1987 #250 1999 p61 1999 p51 p57 #43 2001 Autumn USA 1993 USA USA1993 , no details details no , Scotland of Museums National y ladles, set of 4, with twisted stems, 6" long long 6" stems, twisted 4, with of set ladles, y Catalog Bourdon-Smith J Dundee Dundee details no ladle, Shifter Collection Swan Maple The Glasgow Glasgow pattern fiddle ladle, Sauce 1993 Antiques, Austin Elizabeth Edinburgh assay Mitchell Mitchell 1830 ca 1830 ca Cameron McQueen John 1832/33 Alexander Banff 1833/34 no details ladle, Punch Robert Gray 1834/35 C Raitt D 1836/37 Glasgow Co Elder & 1840/41 handle, 19" long wooden Punch ladle, Glasgow Strurrok John 1846/47 Edinburgh no details ladle, Punch Rait C D. long ½" Montrose 14 ladle, Punch long 6" pattern, fiddle ladle, Sauce Glasgow and Museums Aberdeen Todd Catalog J Bourdon-Smith August Gleneagles Sothebys Autumn Catalog Shaw Nicholas Autumn Catalog Shaw Nicholas 1833/34 C W Edinburgh no details initials, with ladle, Sauce Antiques, Arne & Milne YEAR MAKER DESCRIPTION 1826/27 LOCATION McDonald Angus Glasgow no details ladle, Punch SOURCE CA Francisco, San Argentum, 1826/27 1828/29 S & M 1829/30 L N mm JH 1829/30 Glasgow William Mitchell, A no details ladle, Soup Glasgow Edinburgh no details pair, ladles, Sauce no details , English Old Ladle, 1993 NY, Asprey, NH Center, Antiques Keene 1993 Plus Silver 1830 ca 1830 ca Davidson Andrew Arbroath ladle Toddy 226 Marrow Spoons and Scoops MarrowMARROW Spoons SPOONS AND & SCOOPS Scoops Plate 28. Four Marrow Scoops. Top – 1747/48 by Dougal Ged, Edinburgh ; 2nd from the top – 1840/41 Bone Marrow Club by WC, Edinburgh 2nd from the bottom – a twisted stem example 1815/16 by George McHattie, Edinburgh Bottom – an 1811/12 bulbous connection example by John Ziegler, Edinburgh Courtesy of a private collector. Photograph by Janice M Dietert. 227 Compendium of Scottish Silver 228 Marrow Spoons and Scoops 6KDZ&DWDORJ:LQWHU 1979-390 1979-390 1966-238-2 1966-238-2 1966-238-1 1966-238-1 Grantully Castle Antiques Antiques Castle Grantully Collection Private Galleries Private Collection Collection Private July Sale, Scottish The Bonham's #251 2002 18, $ 2001 p80 2001 p80 2001 #556 2001 #556 Galleries 1983 #58 1983 #58 Scotland of Museums National 1558 MEQ 2001 #555 Galleries 6HDFKLQDQHQJUDLOHGSXQFKWKH1LV backward in the town letter 8 ½" long ´ORQJR] MARROW SPOONS & SCOOPS 1760 ca 1760 ca Johnston Alexander FD Dundee &ROLQH$OODQ no details scoop, Marrow $EHUGHHQ 0DUURZVFRRSR] Art and Museums Dundee 1LFKRODV 1748/49 Aytoun William 1750 ca Edinburgh Gordon Robert FD drop, extended an with broad unusually end larger the scoop, Marrow $OH[DQGHU6KLUUDV Edinburgh %DQII Porterfield of motto and crest spoon, Marrow 0DUURZVFRRSPDUNV±%$1)$6 Scotland of Museums National 1745/46 Ged Dougal 1747/48 Ged Dougal Edinburgh crest with form spoon, conventional Marrow Edinburgh drop, tongued and ridged slightly a with end larger the scoop, Marrow 24, August Edinburgh Phillips 1735 ca 1735 ca Cooper George Aberdeen no details scoop/spoon, Marrow Art and Museums Dundee YEAR MAKER DESCRIPTION LOCATION SOURCE 1700/01 Kincaid Alexander Edinburgh spoon, 3oz Marrow 29, March Edinburgh Christies 1734/35 Ker James 1735 ca Cooper George Edinburgh Aberdeen Hopetoun of Earl the of cipher spoon, with Marrow no details scoop, Marrow 24, August Edinburgh Phillips Art and Museums Dundee 229 Compendium of Scottish Silver 2005 p57 p57 2005 DAG001009 DAG001009 WKH6FRWWLVK6DOH August 24, 2005 #52 #52 2005 24, August 1978 #351 1978 #351 1978 #133 1978 #133 1999 p57 Williamsburg Williamsburg 2001 p80 2001 p80 #333 or 1988 #33 #10 AB Galleries 1999 p57 2001 p80 2001 p80 S +\PDQ&ROOHFWLRQ±&RORQLDO Edinburgh Edinburgh 1.7oz catalog, the in spoon a called but scoop, Marrow 29, August Gleneagles, Sothebys Edinburgh Edinburgh details scoop, Marrow 10, April Palace Scone Sothebys, (GLQEXUJK 0DUURZVFRRSFRQYHQWLRQDOIRUP´ORQJ %RQKDP V William Dempster Dempster William William Dempster Dempster William William Davie or or Davie William Dempster William 1781/82 or Davie William 1782/83 or Davie William 1783/84 Robertson Patrick Edinburgh 1.8oz long, ¾" 8 a bull, with spoon, crested Marrow Autumn Catalog Shaw Nicholas 1778/79 script 1778/79 Mathie Peter 1780/81 WD Gilliland James Edinburgh Edinburgh long 8 5/8" scoop, Marrow long ¼" 8 drop, a slight with scoop larger the plain, scoop, Marrow Collection Private Collection Phoenix The 1775/76 Robertson Patrick Edinburgh 3DWULFN5REHUWVRQ scoop Marrow (GLQEXUJK 0DUURZVFRRSFUHVWRI6KDU August Gleneagles Sothebys 1770 ca 1770 ca Gordon James 1778 ca 1775 ca Argo John Aberdeen Gordon James 1775 ca no details scoop, Marrow Banff Scott William Aberdeen 1.4oz long, ½" 8 scoop, Marrow Dundee no details scoop, Marrow 1.9oz ¾", 8 scoop, Marrow and Museums Aberdeen Autumn Catalog Shaw Nicholas UK Collection Private Winter Catalog Shaw Nicholas YEAR MAKER DESCRIPTION 1767/68 LOCATION Robertson Patrick Edinburgh 2.1oz long, ¾" spoon, 8 Marrow SOURCE Winter Catalog Shaw Nicholas 1767/68 Gilliland James Edinburgh 1.2oz ½"long, 8 stem, short waisted, end slightly narrow scoop, Marrow Catalog Shaw Nicholas 230 Marrow Spoons and Scoops 1978-764 1978-764 16962-709-1 Q&ROOHFWLRQ±&RORQLDO Jackson Marks p550 p550 Marks Jackson Edinburgh HH3230/68 HH3230/68 Edinburgh MEQ 1057 1057 MEQ 2001 p80 2001 p80 Williamsburg Williamsburg MEQ 540 Galleries Galleries Nicholas Shaw Catalog 2005 p57 p57 2005 Catalog Shaw Nicholas #7 Nicholas Shaw Catalog 2001 p83 2001 Catalog Shaw Nicholas #103 ´ORQJ +XQWOH\+RXVH0XVHXP RGHWDLOV +\PD spoon, no details no spoon, details Marrow scoop,Marrow no details Dundee Museums and Art 9 ½" long, 1.4oz 1.4oz long, ½" 9 8 ¾" long 8 ¾" long , 1.8oz 0DUURZVSRRQQ Edinburgh Edinburgh details no scoop, Marrow Scotland of Museums National Edinburgh Edinburgh 1.9oz long, ¼" 10 scoop, Marrow Winter Catalog Shaw Nicholas Edinburgh Edinburgh details no scoop, Marrow Scotland of Museums National Jamieson & & Jamieson & Sons Marshall Marshall Co Co Assayed Edinburgh -RKQ0F'RQDOG (GLQEXUJK 0DUURZVFRRSFUHVWDQGPRWWR 1810/11 Patrick Cunningham Cunningham 1810/11 Patrick 1811/12 1815/16 Ziegler John 1815/16 McHattie George William & Edinburgh James Edinburgh connection retailer bulbous Heron a with scoop, stem, Marrow twisted a with scoop, Marrow Collection Private Collection Private 5REHUW*UD\ 6RQ *ODVJRZ 1820 ca 1820 ca William 1804/05 Simon Cunningham Edinburgh Marrow Marrow Edinburgh 1800 ca Cunningham Christie George 1804/05 Simon Edinburgh description confusing somewhat scoop/spoon, Marrow Art and Museums Dundee 1797/98 available Not 1799/1800 Leslie John Aberdeen no details scoop, Marrow 1991 USA CT House, Hobart 1790 ca 1790 ca 1792/93 Gairdner Alexander Edinburgh Robertson William Edinburgh "C" initial with scoop, Marrow in outline, merges that end smaller narrower stem, narrow scoop, Marrow 1993 London Bourdon-Smith J YEAR MAKER DESCRIPTION 1783/84 LOCATION Robertson Patrick Edinburgh 1.3oz , long ¼" 9 unclear, spoon, or scoop Marrow 2000 28, June Wallis, & Woolley SOURCE 1783/84 Robertson Patrick Edinburgh oval, bowl the terminal, the in scoop narrow a with stem spoon, the Marrow 231 Compendium of Scottish Silver UWV0RQWUHDO Williamsburg Williamsburg Canada Private Collection Collection Private 2001 p80 2001 p80 p108 7XUQEXOO +\PDQ&ROOHFWLRQ±&RORQLDO Andrew Rutherford, Club member 1872/73 D. D. * 0&ULFKWRQ (GLQEXUJK Edinburgh %RQHPDUURZFOXEVFRRSIRU- 1.8oz long, ¾" 7 pattern, fiddle scoop, Marrow p92 2005 Catalog Shaw Nicholas -0 *ODVJRZ 0DUURZVFRRS´ORQJ 0XVHHGH%HDX[$ YEAR MAKER DESCRIPTION 1820 ca LOCATION Jamieson William Aberdeen 1.3oz long, ½" 8 scoop, Marrow SOURCE Winter Catalog Shaw Nicholas 1825/26 Marshall William 1837/38 Edinburgh 1840/41 A. M. 1.5oz long, ½" 9 scoop, Marrow WC Glasgow Edinburgh scoop Marrow for made 1835, dated Edinburgh, of Club Marrow Bone scoop, Marrow 2004 Catalog Shaw Nicholas p92 2005 Catalog Shaw Nicholas 232 Skewers SkewersSKEWERS Plate 29. Top - one long skewer from a set of 4 1820/21 by George Fenwick, Edinburgh; Center - a tiny Skewer 1800ca by Robert Naughton, Inverness; Bottom – a leaf-decorated Skewer by Heron, Greenock, 1828/29 Glasgow assay; Courtesy of a private collector. Photograph by Janice M Dietert. 233 Compendium of Scottish Silver 1967-60 1967-60 1964.542 1964.542 A.1960.442 p120 #176 p120 #176 1991 St. Louis, Galleries Greenock Greenock decoration leaf with Skewer, Collection Private Assayed Glasgow SKEWERS 1828/29 Heron 1799/1800 1799/1800 Fenwick & McHattie Edinburgh 1800 ca details no Skewer, 1807/09 Naughton Robert T T. Inverness 1811/12 1820/21 H. W. no details small, Skewer, 1823/24 Fenwick George Edinburgh Sons Marshall & Edinburgh skewer Meat Edinburgh Edinburgh 4 of set end, ring a with skewers, Long motto and crest skewer, Meat A." M. "E. monogrammed skewer, Meat I, vol 1911, Exhibition Glasgow Collection Private Collection Private Scotland of Museums National 1991 USA CT, House Hobart Magazine, Antiques Sisler Janet 1830 ca 1830 ca Ferguson William Elgin details no skewer, Meat Scotland of Museums National 1770 ca 1770 ca Steven John Dundee tapered plain, Skewer, Art and Museums Dundee YEAR MAKER DESCRIPTION LOCATION SOURCE 234 Spoons StrawberrySpoonsSPOONS Bowls e 30. A pair of decorated trefid Spoons 1682ca probably by Marion Cleghorne (Edward Cleghorne I’s widow), Edinb Courtesy of The Phoenix Collection. Photograph by Janice M Dietert 235 Compendium of Scottish Silver 339 Collection Jackson National Wales Museum of Sothebys November 6, 1969 1969 6, November Sothebys #168 1978 28-29, August Sothebys #370 3KLOOLS(GLQEXUJK2FWREHU 325 Scotland of Museums National 139 H.MEQ 333 Scotland of Museums National H.MEQ 9 How Spoon Book, vol II, p336- II, vol Book, Spoon How 337 1983 March Glasgow Christies #63 London Asprey, National Museums of Scotland Scotland of Museums National MEQ 26 MEQ 1577 1577 MEQ of these of rd -DFNVRQ0DUNVS P LQLWLDOV³1*´RQ ,6(:´PDNHUDQG SRW5* 3ULYDWH&ROOHFWLRQ8. details details Scotland of Museums National spoons spoons Deacon could be reversed EDFNRIERZOHQJUDYHG&'WKHUHLVDQRWKHUDQGSRVVLEO\D Edinburgh Edinburgh top seal Spoon, Jackson The II p328- Vol Book, Spoons How Edinburgh Edinburgh (shaved) set 7 spoon ends, disk Spoons, Cunningham The II p332- vol Book, Spoons How (GLQEXUJK 7KH6DQGHUV6SRRQGLVFHQGHQJUDYHGZLWKLQLWLDOV³ &DQRQJDWH 7KH&DQRQJDWH6SRRQGLVNHQGLQLWLDOVEORFN³'00'´ *ODVJRZ 6SRRQGLVFHQGPDUNV±...EHLQJ ,.LQPRQRJUD Deacon William Cok Cok William Deacon Deacon Edwart Hairt Hairt Edwart Deacon SPOONS Deacon Thomas Thomas Deacon Annend I 1577-79 III Cok James FD 5REHUW*DLUG\QH, 'XQGHH1579-81 6SRRQVHDOWRSPDUNV±OLO\ II Heriot George YEAR MAKER DESCRIPTION LOCATION SOURCE 1572-74 1572-74 Cok William Edinburgh bowl a damaged with top, seal spoon, Cunningham The p324- II, vol Book, Spoon How 1583-85 Adam Craig Craig 1583-85 Adam 1589 ca 1589 ca Cunningham George 1600 ca 1600 ca mark AB Aberdeen no Spoon, -&UDXLIRUG (GLQEXUJK 6SRRQVHDOWRS -DFNVRQ0DUNVS FD -RKQDWKDQ.LUNZRRG 236 Spoons HXPVRI6FRWODQG 0XVHXPVRI6FRWODQG 0(4 Unclear where this is but it does does it but is this where Unclear exist 343 UK Collection Private 351 UK Collection Private 0(4 347 UK Collection Private UK Collection Private acquisition Ownership Private Sothebys Gleneagles August 29, 29, August Gleneagles Sothebys 1978 #370 1984 #70 1984 #70 Spink London II p340-341 vol Spoons How UK Collection Private VHWDVDERYHLQLWLDOV³1*´RQWKHEDFNRIWKH ³1*´RQWKHEDFNRIWKHERZO bowl, CD/1600 CD/1600 bowl, Edinburgh Edinburgh "EE" over "IH" initials end, disk pair, Spoons, 1952 Art Gallery, Glasgow George Crawford Crawford George marks (continued) (continued) FD *HRUJH5REHUWVRQ, (GLQEXUJK 6SRRQQRGHWDLOV 1DWLRQDO 1615 ca 1615 ca & I Reid Alexander 1625 ca Ker Robert Canongate disc on decoration pinwheel end, disc spoon, Oliphant The Spoon, #36 1991 Finlay 1608-10 Lindsay John 1609/10 Edinburgh Kirkwood Gilbert FD Spoon Palace Falkland The Edinburgh *LOEHUW.LUNZRRG top slip Spoon, (GLQEXUJK 6SRRQGLVFHQG p342- II, vol Book Spoons How ii, p350- vol Book Spoons How 1DWLRQDO0XV 1611-13 Crawford George 1612 ca Edinburgh Kirkwood Gilbert end disc Spoon, Edinburgh end disc Spoon, p 346- II, vol Book Spoons How II, p344-345 vol Spoons How 1600 ca 1600 ca Kirkwood Johnathan Glasgow initials above, others the as set same the from apparently end, disc Spoon, YEAR MAKER DESCRIPTION LOCATION SOURCE FD -RKQDWKDQ.LUNZRRG *ODVJRZ 6SRRQGLVFHQGIURPVDPH 237 Compendium of Scottish Silver KLELWLRQ RI6FRWODQG %RRNYRO,,S 0(4 *ODVJRZYRO,S +RZRI(GLQEXUJK Collection Private 1DWLRQDO0XVHXPVRI6FRWODQG 0(4 *ODVJRZ([KLELWLRQ 3KLOOLSV/RQGRQ$SULO 6RWKHE\V/RQGRQ-DQXDU\ 6WLUOLQJ0D[ZHOO&ROOHFWLRQ 1LFKRODV6KDZ&DWDORJS Private Collection UK UK Collection Private UK Collection Private ' 6RWKHE\V*OHQHDJOHV$XJXVW DWHLQLWLDOHG IWKHERZOLQLWLDOV0 GZLWKIROLDWHGHVLJQVDWWKHMRLQWGLVN (/´SRVVLEO\IRU/DG\(OL]DEHWK/\RQ ,6:´RQWKHERZOOHDIHQJUDYLQJRQWKHXSSHU LQLWLDOHG$*EDFNRIERZO(*´ ((RQWKHUHYHUVH VWHP ODWHUFUHVWóORQJR] ´ORQJ (GLQEXUJK 6SRRQGLVFHQGHQJUDYHGZLWKVW\OL]HGIROLDJHDQGG (GLQEXUJK 6SRRQGLVFHQG(GLQEXUJK 7ZRVSRRQVQRGHWDLOV +RZ6SRRQV%RRNYRO,,S -DFNVRQ0DUNVS (GLQEXUJK 6SRRQQRGHWDLOV -DFNVRQ0DUNVS (GLQEXUJK 6SRRQGLVFHQGGLVNLQLWLDOHG$/EDFNRIERZO0 (GLQEXUJK 6SRRQGLVFHQGLQLWLDO:´ORQJ +RZ6SRRQV (GLQEXUJK 6SRRQGLVFHQGHQJUDYHGLQLWLDOV$& RQWKHEDFNR 'HDFRQ$GDP/DPE 0DNHUDQG'HDFRQ Neilson Peter 'HDFRQ*HRUJH &OHJKRUQH $V'HDFRQDOVR 'HDFRQ$GDP/DPE Deacon John Scott Scott John Deacon Deacon John Scott Scott John Deacon FD 7KRPDV0RQFXU $EHUGHHQ 6SRRQGLVFHQG 1DWLRQDO0XVHXPV 0DNHUXQPDUNHG -RKQ6FRWW RU 1665-67 FD $OH[DQGHU6FRWW (GLQEXUJK 3XULWDQVSRRQ 5R\DO$FDGHP\([ 7KRPDV&OHJKRUQH, $GDP/DPE (GLQEXUJK 6SRRQGLVFHQGIURQWVWHPHQJUDYH FD -RKQ6FRWW GDWHG 7KRPDV/LQGVD\,, 'XQGHH 6SRRQ3XULWDQLQLWLDOV³: *HRUJH5REHUWVRQ *HRUJH&UDZIRUG YEAR MAKER DESCRIPTION FD LOCATION 5REHUW*DLUG\QH 'XQGHH 6SRRQGLVFHQGZLWKOHWWHU³/ SOURCE 238 Spoons Phillips November 1998 #205 #205 1998 November Phillips Sothebys Gleneagles, August 30, 30, August Gleneagles, Sothebys 1982 #483 357 UK Cambridge, #91 #16 p81 Clayton Edinburgh of How How Spoons Book, vol II, p 358- II, p vol Book, Spoons How 359 Scotland of Museums National MEQ 40 MEQ 616 1958.43 1958.43 1980 #268 1980 #268 355 UK Collection Private DYH³/:(´´ORQJ &KULVWLHV*ODVJRZ-XO\ ylized leaf decoration, back of terminal "RP" "RP" terminal of back decoration, leaf ylized details details Scotland of Museums National spoon spoon Scotland of Museums National LQLWLDOVEDFNRIERZ0%´ORQJ "OH/MD", 7 ½" long, 2oz 2oz long, ½" 7 "OH/MD", Edinburgh Edinburgh bowl of on back "RM" engraved spoon, Puritan # 33 1991 Finlay Edinburgh Edinburgh pitting some terminal, shaped with end, disc Spoon, June 24, Lennoxlove Sothebys Alexander Scott Scott Alexander Edinburgh spoon Puritan p356- II, vol Book Spoons How Deacon James James Deacon Symontoun Deacon James James Deacon Fairbairn George Cleghorne Cleghorne George Edinburgh Spoon Puritan 354- II p vol Book Spoons How 1653/54 1659-61 Or 1660 ca Borthwick Patrick FD Edinburgh 7KRPDV0RQFXU only mm spoon", Puritan Christchurch "The $EHUGHHQ 6SRRQVVHWRIGLVFHQGHQJU College, Christchurch 1665-67 Boig Reid Alexander 1665-67 David Edinburgh initials trefid, spreading flat bowl, oval with Spoon, #95 1960 22, June Christies 1667-69 Alexander Reid Reid Puritan Edinburgh 1667-69 Alexander 1670 ca AG or AC st with engraved trefid Spoon, 1651-53 Adam Burrell Burrell 1651-53 Adam 1651-53 1657-59 Or 1653 ca Cleghorne George Edinburgh back, on initials owner's with spoon, puritan Spoon", Barncleuch "The YEAR MAKER DESCRIPTION 1651 ca LOCATION Symontoun James Edinburgh no Spoon, SOURCE 239 Compendium of Scottish Silver ies February 11, February ies W HFHPEHU RQ0DUNVS FNVRQ0DUNVS &KULVWLHV6RXWK.HQVLQJWRQ 'HFHPEHU &KULVWLHV-XO\ National Museums of Scotland Scotland of Museums National 0(4 &KULVWLHV' 0(4 1961 MEQ 52 MEQ MEQ 141 1REOH&ROOHFWLRQ 6RWKHE\V*OHQHDJOHV$XJXVW 1994 )LQOD\ 1LFKRODV6KDZ&DWDORJS XQGHUDVHPLFLUFOHRQH %+ 1DWLRQDO0XVHXPVRI6FRWODQG GDOEDQHVWDPS 1DWLRQDO0XVHXPVRI6FRWODQG SUREDEO\GLIIHUHQWIURPWKHSDLUEHORZ 3KLOOLSVRU&KULV .&´ &KULVWLHV-XQH KHGDWHOHWWHULQLWLDOV³$+(6´SUREDEO\GDWHG WKIROLDJHRYHUWKHWRSRIWKHVWHPDQGEDFNRI HUJLOWR] &KULVWLHV2FWREHU IODWQRWFKHGWRSWUHILGVKDQGOHZLWKHQJUDYLQJ ern ern Scotland of Museums National ERZO EDVHGRQVLPLODUGDWHGVSRRQVZLWKWKHVDPHLQLWLDOV IRUPDOIROLDJH RIWKHHDUOLHVWNQRZQVHWV´ORQJR] /DUJHVSRRQQRGHWDLOV -DFNV /DUJHVSRRQQRGHWDLOV -D (GLQEXUJK 7KH3ULFH:RRGV6SRRQVVHWRIWUHILGVOHWWHU+ Deacon Alexander Reid $OH[DQGHU5HLG (GLQEXUJK 6SRRQVVHWRIWUHILGVLOY (GZDUG&OHJKRUQH (GLQEXUJK 6SRRQVWUHILGGHFRUDWHGZL FD $OH[DQGHU5HLG (GLQEXUJK 6SRRQWUHILGUHSDLUHGRYHUW *HRUJH5ROODQGFD (GLQEXUJK :0 3HUWK 7UHILGVSRRQZLWK%UHDGDOEDQHVWDPSLQLWLDOV $OH[DQGHU5HLG,,, (GLQEXUJK FD 5REHUW*DLUG\QH 3HUWK 6SRRQWUHILGLQLWLDOVDQGGDWH FD 5REHUW*DLUG\QH 3HUWK 6SRRQVSDLUWUHILGLQLWLDOV³ YEAR MAKER DESCRIPTION 1672-78 LOCATION AG Aberdeen patt trefid Spoon, SOURCE FD :0 3HUWK 6SRRQWUHILGLQLWLDOV³%+,´DOVRZLWK%UHD (GZDUG&OHJKRUQH 1675 ca 1675 FD Cleghorne Edward Edinburgh *HRUJH5ROODQG available Not (GLQEXUJK 6SRRQVVHWRIUDWWDLOHG #169 1965 23, April Christies 240 Spoons HV*ODVJRZ1RYHPEHU &KULVWLHV-XO\ &KULVWLHV1RYHPEHU +RZFROOHFWLRQ 6KDZ&ROOHFWLRQ &KULVWLHV*ODVJRZ0DUFK &KULVWLHV(GLQEXUJK0D\ +RZ&ROOHFWLRQ UK Collection Private 7HVVLHUV/RQGRQ Collection Phoenix The Christies South Kensington Kensington South Christies 'HFHPEHU &KULVWLHV2FWREHU &KULVWLHV1RYHPEHU OLDJHSUREDEO\SDUWRI GEDFNRIERZOVEORFN JLOWR]G &KULVWLHV0DUFK LWLDOV³$*6%´ 6RWKHE\V+RSHWRXQ+RXVH$SULO ,5´´DQGô´ORQJ &ULFKWRQ%URWKHUV RVVLEO\0RQWURVHLQLWLDOV &KULVWLHV)HEUXDU\ ´GLIIHUHQWIURPWKHUHSDLUHGVSRRQSRVVLEO\ LWLDOV0$%RYHU.5DOVROLVWHGDVDVLQJOH GHWDLOV -DFNVRQ0DUNVS VWHPGHFRUDWHGZLWKIROLDJHSRVVLEO\SDUWRIWKH Q 6RWKHE\V+RSHWRXQ+RXVH$SULO spoon spoon SDLUOLVWHGEHORZ LQLWLDOV*+()ORQJ a larger set set a larger part of the set of 5 that sold in 1966, 1.5oz 1.5oz 1966, in 5 that sold of the set of part 6SRRQWUHILGLQLWLDOV³$+(6 (GLQEXUJK 6SRRQVVHWRIWUHILGHQJUDYHGLQLWLDOV$+(6(GLQEXUJK 7UHILGVSRRQEDFNRIERZODQGVWHPGHFRUDWHGZLWKIR (GLQEXUJK 6SRRQVSDLUGHFRUDWHGWUHILGIROLDJHRQKDQGOHVDQ PDUN nd Cleghorne (2 Cleghorne $VVD\HU%RUWKZLFN Cleghorne $OH[DQGHU5HLG (GLQEXUJK 6SRRQWUHILG´ORQJ &KULVWL FD (GZDUGRU0DULRQ FD 1RWDYDLODEOH 1RWDYDLODEOH 6SRRQVSDLUWUHILGSDWWHU FD 1RWDYDLODEOH 0RQWURVH 6SRRQVVHWRIVKDSHGWRSVS 5REHUW%URFN *ODVJRZ 6SRRQVSDLUWUHILGLQLWLDOV³$* FD -DPHV&RFNEXUQ :LOOLDP/DZ (GLQEXUJKFD 6SRRQVVHWRIWUHILGVQR -DPHV&RFNEXUQ (GLQEXUJK (GLQEXUJK 6SRRQWUHILGGHFRUDWHGERZOLQ 6SRRQVVHWRIWUHILGVLQ 1681/82 Alexander Reid Reid 1681/82 Alexander (GZDUGRU0DULRQ (GZDUG&OHJKRUQH (GLQEXUJK 6SRRQVUDWWDLOHGERZODQG YEAR MAKER DESCRIPTION LOCATION $OH[DQGHU5HLG (GLQEXUJK SOURCE 241 Compendium of Scottish Silver xhibit 1930 #63 1930 950 #103 K 8 ecember 17, ecember 5, 1 How Spoons book vol II vol book Spoons How V, pl3 sect 29, March Glasgow Christies 1983 #44 1977 24, April London Phillips #24 Scotland of Museums National 1555 MEQ Collection How Nicholas Shaw Catalog 2005 p89 2005 Catalog Shaw Nicholas 1939 #420 1939 #420 How Spoons Book, vol II Ch V, sect V #45 1983 29, March Christies 1979 #78 Lumley of Provenance 9oz 15 d 15 9oz #49 18, 1942 February Christies HWWHU³,´LQLWLDOV³:*+%´ô´ORQJ 3ULYDWH&ROOHFWLRQ8. 1REOH&ROOHFWLRQ ILGVWHUPLQDOVLQLWLDOV³0,'$'´´ORQJ 3ULYDWH&ROOHFWLRQ top, shield tailed, rat 6, of set Spoons, YEAR MAKER DESCRIPTION 1685/86 LOCATION Bruce Robert Edinburgh trefids pair, Spoons, SOURCE D Christies 1685/86 Cochquin Matthew 1685/86 Ayr Stirling James pattern trefid Spoon, Glasgow long 1/3" 5 "AP", initials trefid, spoon, Dessert ca 1685 Stirling James 1685 ca Brock Robert Glasgow lot this of third one initial, tail, rat small Spoon, Glasgow V, ch II, vol Book Spoons How long ¾" 7 regilt, bowls, oval handles, trefid tailed, rat 6, of set Spoons, E Academy Art Scottish #45 1991 Finlay #62 1957 19, June Christies FD 5REHUW(OSKLQVWRQH ca 1686/87 ,QYHUQHVV Stirling James 7DEOHVSRRQVVHWRIWUH 1688/89 Glasgow (5) Law James "L" initials script trefid, spoon, Dessert 1690 ca -DPHV6WLUOLQJ Edinburgh Elder Scott William 19d 10oz "MC", over "WI" initials 6, trefids, of Spoons, set 1690 ca Banff *ODVJRZFD Walker George 6SRRQVHWRIWUHILGVGDWHO *HRUJH 242 Spoons Private Collection Collection Private 29, March Glasgow Christies 1983 #59 14, November Scotland Christies 1985 #270 1987 #52 MEQ 134 1976.7 1160 MEQ 1983 #62 1983 #62 MEQ 134 1936.256 1936.256 134 MEQ #492 Collection How Collection How C", 2oz 2oz C", 29, March Glasgow Christies WLDOV³50('´LQPRQRJUDPGLVWLQFWLYH id, no details details no id, Scotland of Museums National n, trefid, initials "AC" over "M over "AC" initials n, trefid, VW\OH´ORQJ ailable ailable trefid Spoon, Scotland of Museums National 1690/91 1691/92 Brock Robert Inglis Robert Glasgow 1691/92 Edinburgh terminal rounded tail, rat ribbed a with bowl of back trefid, Spoon, 19oz Appin, of Stewart for a unicorn of Inglis crest Robert trefids, 10, of set Spoon, 1693 ca Edinburgh of How available Not Collection Shaw Edinburgh details no Spoon, trefids of pair Spoon, p 544 Marks Jackson April House Hopetoun Sothebys 1690 ca 1690 ca 1690/91 Brock Robert Brock Robert Glasgow 5REHUW%URFN Glasgow lot the in 3 items of one initials, trefid, Large spoon, details no trefid, Spoon, *ODVJRZ 6SRRQWUHILGEURDGWHUPLQDOLQL #62 1957 19, June Christies Scotland of Museums National 1690 ca Cleghorne Thomas Edinburgh tref Spoons, YEAR MAKER DESCRIPTION 1690 ca LOCATION av Not SOURCE 1690 ca 1690 ca Scott William 1690 ca Aberdeen Scott William 1690 ca trefid Spoon, Bruce Robert Banff Edinburgh lot a of third one tailed, rat Spoon, Spoo #62 1957 19, June Christies 1932 Exhibition Treasures Art 243 Compendium of Scottish Silver 1912 1912 n ecember 17, 1967-23 1967-23 XQWOH\+RXVH0XVHXP Nicholas Shaw Catalog p 96 96 p Catalog Shaw Nicholas #117 Edinburgh HH3456/69 HH3456/69 Edinburgh Christies July 26, 1960 #146 26, 1960 July Christies Lumley of Provenance Scotland of Museums National Sothebys Hopetoun House April House Hopetoun Sothebys #51 1987 29, 25- November Scotland Christies #309 1997 27, L.396.12-12c #131 Collection How Phillips London July 24, 1997 24, 1997 July London Phillips Edinburgh of How Galleries century spoon Dundee Museums and Art th LGUHSDLUVDQGZHDULQLWLDOV³0+7%%´PDNHUDOLWWOH Hugh Thomson and Barbara Barr, He was ordained in 1691 in ordained was He Barr, Barbara and Thomson Hugh uncertain found forapair of unspecified maker spoonslisted earlier) 1695 ca 1695 ca available Not 1695 ca Yorstoun George Glasgow 7KRPDV.HU Edinburgh 5, trefids of set Spoons, long ½" 4 likely, most maker "I/TM", initials block nose, dog Teaspoon, (GLQEXUJK Collectio Phoenix The 'HVVHUWVSRRQWUHILGò´ORQJ D Christies + 1695 ca 1695 ca Lindsay William Aberdeen "Achnagat" engraved stem decorated, trefid, Spoon, Collection Noble 1693/94 1694/95 Yorstoun George Bruce Robert Edinburgh 1694/95 trefid Spoon, Brock Robert Edinburgh 1694/95 details no 4, of set Spoons, Glasgow 1695 ca Brock Robert Gilmour Andrew trefid Spoon, Glasgow Edinburgh initials engraved trefids, pair, Spoons, 17 elaborate an as described decorated, trefid, Spoon, Scotland of Museums National #130 1909 8, June Christies #17 1963 13, March Christies 1945 14, November Christies 1695 ca 1695 ca 1695/96 Robertson George Cleghorne Marion Aberdeen Edinburgh initialed later nose, dog Spoon, Revd. of initials foliage, stamped initial, script "MM" tailed, at pair, Spoons, #226 1970 30, July Sothebys 1695 ca 1695 ca Cleghorne Thomas Edinburgh 4, tref of set Spoons, YEAR MAKER DESCRIPTION 1693 ca LOCATION Forbes Alexander Edinburgh also was citation Sothebys this (Note: 1834, in a well in found trefid, Spoon, SOURCE 244 Spoons PVRI6FRWODQG PVRI6FRWODQG D\ *ODVJRZ0DUFK &ROOHFWLRQ Q0DUNVS DWH2ZQHUVKLS 6RWKHE\V1RYHPEHU 3ULYDWH&ROOHFWLRQ8. 0(4 MEQ 119 #58 1983 #61 1983 #61 0(4 L1983.33 L1983.33 1%ORRP$QWLTXHV ò´ORQJ 3ULYDWH&ROOHFWLRQ8. WHUPLQDOVHQJUDYHGó´ORQJ 3ULYDWH&ROOHFWLRQ8. PDUNHG±*:$%'±LQDQHQJUDLOHGSXQFK DOV0,7.<R] &KULVWLHV*ODVJRZ0DUFK KLQLWLDOV &KULVWLHV1RYHPEHU , no details details no , Scotland of Museums National QGRJQRVHLQLWLDOV³0$*,/´ WUDLQLQJVSRRQ 1DWLRQDO0XVHX WKHWHUPLQDOVKDYHLQLWLDOV³0,$,6´´ORQJ DLODEOH (GLQEXUJK 6SRRQGRJQRVH 1DWLRQDO0XVHX FDFD 6WHSKHQ$JDWH :LOOLDP6FRWW 2OG$EHUGHHQ -RKQ/XNH 7DEOHVSRRQVQRGHWDLOV $EHUGHHQ 7DEOHVSRRQVVHWRIZDY\HQG *ODVJRZ 6SRRQWUHILGQRGHWDLOV 3ULY &KULVWLHV0 $OH[DQGHU.LQFDLGFD (GLQEXUJK &ROLQ0F.HQ]LH 6SRRQVQRGHWDLOV (GLQEXUJK 7KRPDV.HU 6 $OH[DQGHU.LQFDLG (GLQEXUJK (GLQEXUJK 7DEOHVSRRQVFRRS 7DEOHVSRRQVVHWRIGRJQRVH -DFNVR &KULVWLHV FD *HRUJH:DONHU $EHUGHHQ 7DEOHVSRRQVVHWRIWUHILGV 1698/99 Penman James Edinburgh nose dog Spoon, &ROLQ0F.HQ]LH 1RWDY (GLQEXUJK 6SRRQVVHWRIWUHILGVZLW YEAR MAKER DESCRIPTION 1695/96 LOCATION Cleghorne Thomas Edinburgh trefid pair, Spoons, SOURCE Scotland of Museums National 7KRPDV.HU1697/98 7KRPDV.HU (GLQEXUJK Law William 6SRR -DPHV3HQPDQ (GLQEXUJK Edinburgh 6SRRQVVHWRIGRJQRVH (GLQEXUJK details no Spoons, 6SRRQVVHWRIWUHILGVLQLWL 3ULYDWH 544 p Marks Jackson 245 Compendium of Scottish Silver MEQ 19 #81 20, 1988 May Phillips 1943.314-316 1943.314-316 Lorentz Antiques Toronto Toronto Antiques Lorentz 1993 Canada Collection Phoenix The #156 1961 8, June Christies #14 5, 1972 July Christies Private Collection UK UK Collection Private Noble Collection Collection Noble p99 2001 Catalog Shaw Nicholas MEQ 28 #26 27 1990 vol +LQF+RQRUHW no details details no Scotland of Museums National details details Scotland of Museums National 13oz 13d 13d 13oz reverse later script initials "D", 17 ¼" long, 12 oz oz 12 long, ¼" 17 "D", initials script later reverse RIDVWDJ¶VKHDGLVVXLQJIURPD9LVFRXQW¶FRURQHWZLWKPRWWR³ 6DOXV´ 11.1oz 11.1oz 1704/05 1704/05 Seatoun John Jr Penman John Edinburgh Edinburgh details no spoon, tailed rat Spoons, arms of coat with tailed, rat Tablespoon, #159 1986 24, June Christies p 544 Marks Jackson 1704/05 John Seatoun Edinburgh Spoon, no no Seatoun 1703/04 Spoon, Edinburgh 1704/05 John Cleghorne Thomas Edinburgh no details Spoon, p544 Marks Jackson 1703/04 Seatoun John Edinburgh 3, of set Spoons, 1703/04 Ker Thomas Edinburgh worn, motto and crest worn, marks tailed, rat nose, 6 dog of set Tablespoons, 1702/03 1703/04 Ker Thomas McKenzie Colin Edinburgh Edinburgh 13.6oz motto, and crest nosed, dog or ended 6, wavy of set Tablespoons, on "LD", over "MN" over initials "M" block tailed, rat trefid, spoon, Hash #14 6, 1972 July Christies 1702/03 1702/03 Yorstoun Mungo 1702/03 Jr Luke John Edinburgh McKenzie Colin no details Spoon, Glasgow Edinburgh crest the with no details engraved nose, each dog 11, Hanoverian, Spoon, of set forks), (with Tablespoons p544 Marks Jackson 1990 Gleneagles Sothebys 1701/02 II Luke John 1702/03 Dunlop David Glasgow Canongate 2d 2oz "M/RM/ES", initials nose, dog Spoon, long, ¾" 7 "R.G.H.G", initials the with engraved nose, 6, dog of set Spoons, August Gleneagles Sothebys YEAR MAKER DESCRIPTION 1701/02 LOCATION Burdon William Edinburgh "IP" initials the with engraved nose, dog Spoon, Scotland of Museums National SOURCE 246 Spoons &KULVWLHV-XO\ &KULVWLHV-XO\ +RZ&ROOHFWLRQ 6RWKHE\V*OHQHDJOHV$XJXVW &KULVWLHV0D\ 6HSWHPEHU -DFNVRQ0DUNVS 'RYHUHGS 3ULYDWH&ROOHFWLRQ8. 3ULYDWH&ROOHFWLRQ8.FD 0(4 LQLWLDOV QLWLDOVZHUH V0:)0/UDWWDLOHG WKHOHIWDQGWKH* QRWUHYHUVHG RQWKH WWDLOHGWHUPLQDOVZLWKLQLWLDOV RRQV 1DWLRQDO0XVHXPVRI6FRWODQG ò´ORQJ &KULVWLHV*ODVJRZ1RYHPEHU JR] 0.OHLQ$XFWLRQ&KLFDJR GLIIHUHQWIURPWKHVHWRILQWKH1LFKRODV IOXWHGEDQGVUDWWDLOHGFDOOHGDODGOHLQWKH RURQHWDERYHVFULSWLQLWLDOV+$ RU-$ WDLOV -DFNVRQ0DUNVS Y\VSRRQVEXWZLWKGLIIHUHQWPDUNV-DFNVRQ GR]G &KULVWLHV-XQH QLWLDOV,%0%R] &KULVWLHV$SULO R]G WRSVRIVSRRQVPROGHGZLWKGURSVUHYHUVHRIVWHPZLWKHQJUDYHG R] *ULPGH[R]G ³,%0:´SUHVXPDEO\GLIIHUHQWIURPWKHRWKHUVHWRILIWKHL UHFRUGHGFRUUHFWO\ FDOOVLWDODUJHUDWWDLOHGEDVWLQJVSRRQ ULJKWLQLWLDOV³60´VWDPSHG%UHDGDOEDQH´ORQJ 6KDZFDWDORJ (GLQEXUJK 7DEOHVSRRQVVHWRIHDUO\PDNHGRJQRVHGLQLWLDO striking John Seatoun Seatoun John striking $VVD\HU-DPHV 3HQPDQ 5REHUW,QJOLVRYHU 0XQJR 247 Compendium of Scottish Silver 20, . '$* HFHPEHU EHUGHHQ0XVHXPVDQG Shaw Collection Collection Shaw &KULVWLHV*ODVJRZ0DUFK Edinburgh of How Private Collection UK UK Collection Private Private Collection UK UK Collection Private Williamsburg VA VA Williamsburg 2004 #259 2004 #259 :RROOH\ :DOOLV-XQH #105 1911 &KULVWLHV' Collection Girdwood -DFNVRQ0DUNVS *DOOHULHV$% ´ORQJ GZLWKFRQWHPSRUDU\LQLWLDOV³$0(+´ /\RQ 7XUQEXOO)HEUXDU\ HDUW'WRZQPDUN³K´GDWHPDUN´ORQJ 3ULYDWH&ROOHFWLRQ8 R] +\PDQ&ROOHFWLRQ± GWHUPLQDOVHQJUDYHG³$,´EHVLGH³6´HQ QGWHUPLQDOVHQJUDYHGZLWK³$,´EHVLGH³6´ WDLOHGGRJQRVHGR]G &KULVWLHV0D\ forks, dog nosed, crest crest nosed, dog forks, Glasgow Exhibition Scottish tailed, no details details no tailed, 1901 Exhibition Glasgow XQVFUHZLQJDQGFRQWDLQLQJDZRRGHQVSLUWOHLQLWLDOV³,07´ suite with similar onesGeorge by Robertson in the same collection HQVXLWHZLWKVLPLODURQHVE\6LPRQOH5HYLHU2OG$EHUGHHQô Inverness Inverness knop, fluted spiral handle, tapering tubular tail, rat applied spoon, Hash LOOLDP0F/HDQ 1710 ca 1710 ca W FD 6LPRQOH5HYLHU $EHUGHHQ 7DEOHVSRRQVVHWRIZDY\HQ FD -RKQ/XNH *ODVJRZ 7DEOHVSRRQVUDWWDLOERZOVHQJUDYH 1708/09 Ker Thomas 1709/10 Seatoun John Edinburgh 3DWULFN0XUUD\ 2oz long, 8" "JB/JB", initialed terminal nose, dog Tablespoons, Edinburgh -DPHV6HDWRXQ (GLQEXUJK motto and spur a winged of crest with nose, 4, dog of set Tablespoons, (GLQEXUJK 'HVVHUWVSRRQVVHWRIUDW Edinburgh of How UK Collection Private 7DEOHVSRRQVVHWRIZLWK FDFD -RKQ/XNH,, -DPHV)DOFRQHU *ODVJRZ *ODVJRZ +DVKVSRRQVSDLUPDUNV±,/LQK 6SRRQUDW FD *HRUJH5REHUWVRQ $EHUGHHQ &KRFRODWHVSRRQQRGHWDLOV $ FD *HRUJH5REHUWVRQ $EHUGHHQ 7DEOHVSRRQVVHWRIZDY\H YEAR MAKER DESCRIPTION 1707/08 LOCATION Tait James -DPHV7DLW Edinburgh (GLQEXUJK Breadalbane spoon, Hash +DVKVSRRQUDWWDLOVKLHOGWRS SOURCE #427 1990 April NY Sothebys 248 Spoons M Rafael, NYC 1995 NYC Rafael, M Collection Phoenix The MEQ 2021 2021 MEQ MEQ 149 1955.192-a Antiques Castle Grantully Bonham's July 18, 2002 #250 2002 18, July Bonham's 1935 #358 Bonhams The Scottish Sale, Sale, Scottish The Bonhams #56 2003 21, August Private Collection UK UK Collection Private L.396.32-21e UDWWDLOHGZLWKLQLWLDOV:0RU:,´RU QJUDYHG-+0´ORQJ 3ULYDWH&ROOHFWLRQ8. HGFUHVWRIDERDU VKHDG´ORQJ 3ULYDWH&ROOHFWLRQ8. itials removed, later crest of an ostrich head and 2 2 and head an ostrich of crest later removed, itials tailed, Hanoverian Hanoverian tailed, Scotland of Museums National no details details no Scotland of Museums National no details details no Scotland of Museums National Hanoverian, rat tailed, script initials "ME", 4 5/8" long long 5/8" 4 "ME", initials script tailed, rat Hanoverian, Collection Phoenix The oon, no details details no oon, 545 p Marks Jackson later below "RC", 8" long long 8" "RC", below later feathers, 2 oz ´,: (continued) (continued) 1715/16 Kincaid Alexander Edinburgh reverse, the on CB" "JD, initials script , tailed, rat Hanover, Tablespoons, 1713/14 McKenzie Colin 1714/15 Edinburgh Mitchelson James 1715 ca details no pair, Spoons, Edinburgh 1715 ca Robertson George 12.3oz crested, nosed, dog end or 6, wavy of set Tablespoon, Aberdeen Yorstoun Mungo Edinburgh Teaspoon, rat pair, Teaspoons, #246 1967 3, August Sothebys Scotland of Museums National 1712/13 1713/14 Ker Robert Kincaid Alexander pair, Edinburgh Edinburgh 1713/14 3DWULFN0XUUD\ McKenzie Spoons, Edinburgh 13.5oz rat tailed, 6 of set Spoons, sp Large Duncan Charles 1713/14 Colin (GLQEXUJK Edinburgh 7DEOHVSRRQVVHWRIGRJQRV ID" "IS initials tailed, rat 6, Hanoverian of set Spoons, available Not Sale Collection Breadalbane 1712/13 Seatoun John Edinburgh in nose, dog Tablespoons, YEAR MAKER DESCRIPTION LOCATION SOURCE 1711/12 -RKQ6HDWRXQ Tait James (GLQEXUJK -DPHV7DLW 7DEOHVSRRQGRJQRVHWHUPLQDOH Edinburgh 6, of set Spoons, (GLQEXUJK 7DEOHVSRRQVVHWRI+DQRYHULDQ 249 Compendium of Scottish Silver #276 2 #10 2 #10 Sothebys Scone Palace April 14, 1980 #59 MEQ 123 #378 #32 1935, #357 #357 1935, tailed tailed Scotland of Museums National lson lson Edinburgh crest and initials Hanoverian, Tablespoon, 1979 13, September Sothebys 1717/18 1717/18 Ure William 1718 ca Seatoun John Edinburgh Walker J. 1718/19 Edinburgh details no tailed, rat Spoon, Turnbull Patrick 1718/19 6d 24oz tailed, rat 11, of set Tablespoons, Aberdeen Edinburgh 1719/20 Mitchelson James long 1/3" 15 tailed, rat1719/20rat spoon, Hash Teaspoon, Aytoun William Edinburgh 1719/20 Yorstoun Mungo no details tailed, rat spoon, Hash Edinburgh Mitche 1719/20 Sympsone Alexander Edinburgh motto and crest tailed, rat 5 Hanoverian, Edinburgh Tablespoons, 1719/20 James Inglis James no details set, tailed, rat Spoon, no details set, tailed, rat Spoon, #29 14, 1934 February Christies Edinburgh details no tailed, rat Spoon, 545 p Marks Jackson 1993 Catalog Bourdon-Smith J 1947 1, November NY Sothebys 545 p Marks Jackson 546 p Marks Jackson 546 p Marks Jackson 546 p Marks Jackson YEAR MAKER DESCRIPTION 1715/16 LOCATION 1716/17 Ker Thomas 1716/17 Seatoun John McKenzie Kenneth Edinburgh Edinburgh Edinburgh no details tailed, rat Spoons, 9.3oz tailed, rat spoon, Hash no details tailed, rat Spoons, SOURCE 545 p Marks Jackson Sale Collection Breadalbane p545 Marks Jackson 1716/17 1716/17 Inglis Robert 1716/17 Bethune Henry Edinburgh Seatoun John Edinburgh oz 30 a lot, of part MF", F "MF initials 4, engraved of set Tablespoons, no details tailed, rat Spoons, Edinburgh 5, 197 July Christies 6d 15oz crest, a with engraved tops tailed, rat 6, of set Tablespoons, 1937 17, June Christies 545 p Marks Jackson 250 Spoons S VS HPEHU 7KH3KRHQL[&ROOHFWLRQ 7KH3KRHQL[&ROOHFWLRQ 3ULYDWH&ROOHFWLRQ8. 0(4 0(4 &KULVWLHV1RYHPEHU YRO RYHU03´ORQJ &RQQHFWLFXW6KRS PLQDOZLWKLQLWLDOV³:'(3´ QJ 6RWKHE\V$SULO OHGFUHVWDQGPRWWR9HUWXWLV*ORULD0HUFHV DLOHG 1DWLRQDO0XVHXPVRI6FRWODQG RQJR]ZW &KULVWLHV*ODVJRZ0DUFK ORQJ -RQDWKDQ7UDFH,QF1< +DQRYHULDQORQJ 7KH3KRHQL[&ROOHFWLRQ DQGPRWWRRI3LWFDLUQRIWKDW,ONôORQJR] 6RWKHE\V1RY PDUULDJHLQLWLDODQGODWHUFUHVWDQGPRWWRDERYH WDLOHGR] 6RWKHE\V*OHQHDJOHV$XJXVW ORQJ ô´ORQJ óORQJR] 'XQGHH 7DEOHVSRRQ+DQRYHULDQUDWWDLOHGVFULSWLQLWLDOV-7 'XQGHH 7DEOHVSRRQVVHWRI 1DWLRQDO0XVHXPVRI6FRWODQG DP6FRWW %DQII 7DEOHVSRRQUDWWDLOHG+DQRYHULDQSDWWHUQWHU &KDUOHV'XQFDQ &KDUOHV'XQFDQ FD -DPHV&ODUNH &KDUOHV'LFNVRQ,RU (GLQEXUJK 6SRRQQRGHWDLOV -DFNVRQ0DUNV .HQQHWK0F.HQ]LH (GLQEXUJK 'HVVHUWVSRRQVVHWRIUDW +HQU\%HWKXQHFD &ROLQ&DPSEHOO (GLQEXUJKFD 6LPRQ0F.HQ]LH 'U\VGDOH 7DEOHVSRRQVSDLUUDWWDLOHG 6LPRQ0F.HQ]LH ,QYHUQHVV 6SRRQQRSLFWXUHV ,QYHUQHVV +DVKVSRRQUDWWDLOHGò +DVKVSRRQWXEXODUO &ULSSVS 'DYLG0LWFKHOO (GLQEXUJK 7DEOHVSRRQ+DQRYHULDQUDWWDL FD 6LPRQ0F.HQ]LHFD ,QYHUQHVV &KDUOHV'LFNVRQ,RU 7DEOHVSRRQV+DQRYHULDQUDWW FDFD 5REHUW,QQHV :LOOLDP$\WRXQ (GLQEXUJK (GLQEXUJK 'DYLG0LWFKHOO +DVKVSRRQUDWWDLOHGòOR :LOOLDP$\WRXQ 6SRRQGDWHOHWWHULQGLVWLQFW (GLQEXUJK (GLQEXUJK 6SRRQQRGHWDLOV +DVKVSRRQUDWWDLOHGFUHVW -DFNVRQ0DUN YEAR MAKER DESCRIPTION 1720 ca LOCATION Willi SOURCE 251 Compendium of Scottish Silver ember 22, Y O0XVHXPVRI6FRWODQG 1974 #92 1974 #92 2000 #76 2000 #76 MEQ 72 /RXLVYLOOH.<86$ 1935 #135 1935 #135 6RWKHE\V6FRQH3DODFH$SULO 1979 #73 Edinburgh of How Sale Scottish the Bonhams #74 2003 21, August DOV³'3´´ORQJ HQJUDYHGZLWKLQLWLDO%òORQJR] &KULVWLHV/RQGRQ1R LDQ´ORQJ 7KH-%6SHHG$UW0XVHXP LDQWHUPLQDOZLWKLQLWLDOV 6RWKHE\V*OHQHDJOHV$XJXVW VWHUQLQLWLDOVR]G &KULVWLHV-XO\ 7.5oz 7.5oz 7DEOHVSRRQQRGHWDLOV 1DWLRQD Edinburgh Edinburgh 9oz Hanoverian, tailed rat Spoon, Hash Sale Collection Breadalbane Edinburgh Edinburgh 3d 9oz tailed, rat spoon, Hash #71 6, 1903 May Christies Edinburgh Edinburgh no details Tablespoons, *ODVJRZ +DVKVSRRQ+DQRYHULDQUDWWDLOHGWHUPLQDOZLWKLQLWL 546 p Marks Jackson &KDUOHV'LFNVRQ, Grimdex Grimdex Edmonstoun Edmonstoun McGilchrist) McGilchrist) 'DYLG0LWFKHOO (GLQEXUJK 1726/27 1726/27 Tait James Ker James Edinburgh 'DYLG0LWFKHOO Edinburgh no details Tablespoon, +HQU\%HWKXQH (GLQEXUJK pictured not Kincaid, J as listed spoon, Hash &KDUOHV'XQFDQRU (GLQEXUJK +DVKVSRRQUDWWDLOHGULEEHG +DVKVSRRQUDWWDLOHG+DQRYHU April House Hopetoun Sothebys 546 p Marks Jackson 'DYLG0LWFKHOO (GLQEXUJK 7DEOHVSRRQVVHWRI+DQRYHU 1725/26 1725/26 Ure Archibald not listed in Maker Edinburgh no details Tablespoon, 546 p Marks Jackson 'RXJDO*HG (GLQEXUJK +DVKVSRRQ+DQRYHULDQUDWWDLOHG YEAR MAKER DESCRIPTION 1723/24 LOCATION 1724/25 Alexander Blair Charles Edinburgh no details Tablespoon, SOURCE 546 p Marks Jackson 1725 ca 1725 ca (or Gilchrist Robert 252 Spoons ecember 1977 #141 MEQ 512 The Phoenix Collection Collection Phoenix The Christies January 30, 1978 #19 #19 30, 1978 January Christies MEQ 125 1933.337 1933.337 125 MEQ 182-183 MEQ MEQ 1045-1046 1971.267-268 1971.267-268 1045-1046 MEQ #177 MEQ 1023 1970.574 1970.574 1023 MEQ Collection Breadalbane 1974 #013 1974 #013 nose, block initials initials block nose, Scotland of Museums National no details details no Scotland of Museums National Tablespoon, no details details no Tablespoon, Scotland of Museums National gh gh details no Hanoverian Tablespoon, Scotland of Museums National Glasgow Glasgow long ½" 8 "TJ", over "JC" initial script Hanoverian, pair, Tablespoons, 1994 NJ Robinson, D Bilsings Bilsings 1730 ca 1730 ca Johan Gott-helf- 1730 ca 1730 ca Mitchelson James Edinburgh case a fitted in Hanoverian, pair, Tablespoons, D Christies 1729/30 1730 ca Aytoun William 1730 ca Aytoun William Edinburgh II Luke Robert 1730 ca Edinburgh details no Tablespoon, pattern fiddle Scots spoon, strainer Tea Cooper George Glasgow details no pair, Aberdeen Tablespoons, 2, Tablespoons, Collection Private 546 p Marks Jackson Scotland of Museums National 1728/29 1728/29 Graham Patrick Aytoun William Ure 1728/29 Edinburgh Edinburgh Edinburgh 1729/30 Archibald Ker James no details Tablespoon, motto and crest tailed, rat forks, 12, with of set Tablespoons, Edinburgh forks with tailed rat 6, of set Tablespoons, 1960 30, November Christies #98 3, 1954 February Christies 564 p Marks Jackson 1727/28 Graham Patrick 1728/29 Edinburgh Kincaid Alexander Edinburgh details no Tablespoon, dog pair, Tablespoons, 150 p Cripps YEAR MAKER DESCRIPTION 1727/28 LOCATION Tait James Edinburgh 7.8oz tailed, rat Hanoverian, spoon, Hash SOURCE 29, August Gleneagles Sothebys 1727/28 Patrick Graham Graham Edinbur 1727/28 Patrick 253 Compendium of Scottish Silver 9, 9, nd nd MEQ 1516 1516 MEQ 1983 #57 1983 #387 1983 #387 Williamsburg Williamsburg Private Collection UK UK Collection Private 1979 #217 1979 #217 Sothebys August 24, 1974 #93 1974 24, August Sothebys 1983 #93 MEQ 346 1956-848 1956-848 346 MEQ 1911 vol I, p 103, #14 103, p I, 1911 vol with different different with th rian, no details details no rian, Scotland of Museums National GURSHDFKZLWK³6´EHORZDQ(DUO¶VFRURQHW initials, 13.1oz 13.1oz initials, Edinburgh Edinburgh details No Spoon, at Silver English Davis, Edinburgh Edinburgh 14.8oz "AD/ED", initials Hanoverian, 6, of set Tablespoons, 27, August Gleneagles Sothebys Edinburgh Edinburgh details no pair, Tablespoons, Exhibition Glasgow Smith B W $VVD\HU±$UFKLEDOG Ure Or Charles Duncan Charles Dickson I Dickson Charles 1732/33 1733/34 Forbes George Gordon Hugh 1733/34 Edinburgh Lothian Edward no details Tablespoons, Edinburgh 10d 7oz long, 18" 16 cypher, a with Edinburgh engraved Hanoverian, spoon, Hash a coronet below initial an with engraved Hanoverian, Tablespoons, 29, March Glasgow Christies 2 August Gleneagles Sothebys 547 p Marks Jackson 1734/35 William Marshall I Marshall 1734/35 William 1734/35 1734/35 Mitchelson James Mitchelson James Edinburgh Edinburgh no details 3, of set Tablespoons, 6 initials, identical with 5 6, Hanoverian, of set Tablespoons, #80 1976 16, December Sothebys 1731/32 I Dickson Charles 1731/32 1732/33 Mitchelson James oval an in WI) (or IM Edinburgh Edinburgh crest a 5, with of set Tablespoons, Main John possibly or Jamieson William by probably Teaspoon, Scotla of Museums National 17, 1960 February Christies 1735 ca 1735 ca 1735/36 Rollo John Mitchelson James Edinburgh Edinburgh initials with terminals 6 Hanoverian, of set Tablespoons, "MC" initials fiddle, Scots pair, Teaspoons, 29, August Gleneagles Sothebys Collection Private YEAR MAKER DESCRIPTION 1730 ca LOCATION Mitchell Colin Canongate Hanove Tablespoon, SOURCE 1730/31 or Duncan Charles 1730/31 Mitchelson James Edinburgh strap double with bowls of backs pattern, 12, Hanoverian of set Tablespoons, 254 Spoons ition ition April 14, 14, April H.1996.11-12 H.1996.11-12 1980, #121 #121 1980, 1911, vol I, p116, #100 p116, I, vol 1911, Sothebys Gleneagles August 25, 25, August Gleneagles Sothebys 1997 #28 Sothebys Scone Palace April 14, 1980 #17 H.1996.13.1-5 H.1996.13.1-5 Collection Phoenix The M Rafael, NY 1993 NY Rafael, M Collection Phoenix The 1987 #231 no details details no Scotland of Museums National later initialed "N", 24.9oz 24.9oz "N", initialed later 25oz 25oz decorated on both sides with scrolls, flowers, and leaves, empty scroll scroll empty leaves, and flowers, scrolls, with sides both on decorated long 8" reverse, the on medallion Weems Edinburgh Teaspoons, pair,no details Smith W B Glasgow Exhib 1739/40 1739/40 Ker James Tait James Edinburgh Edinburgh no details Spoon, 13.2oz "MF", initials the with terminal 6, Hanoverian, of set Tablespoons, Palace, Scone Sothebys 547 p Marks Jackson 1738/39 Aytoun William Edinburgh details no 4, Tablespoons, Scotland of Museums National 1738/39 James 1738/39 James 1738/39 Oliphant Lawrence Edinburgh were 2 "Firm", motto and rack a of crest 8, Hanoverian, of set Tablespoons, 1737/38 Ker James 1737/38 1738/39 Lothian Edward Edinburgh Ker James Edinburgh 8" long "SH", over initials "GH" 3 Hanoverian, Tablespoons, no details 3, Spoons, Edinburgh crest, a with engraved lightly terminals 11, Hanoverian, of set Tablespoons, 1993 , Edinburgh Goodwin's unclear source Auction, 1735/36 1735/36 Rollo John Ker James 1736/37 Edinburgh 1736/37 Penman Hugh 1737/38 Edinburgh no details Spoon, McKenzie Kenneth Edinburgh Edinburgh not pictured 6, Hanoverian, of Ged set Dougal Tablespoons, no details Spoon, long 3/8" 8 Hanoverian, pair, Tablespoons, Edinburgh 5, of set Tablespoons, August Gleneagles Sothebys Collection Phoenix The 547 p Marks Jackson p547 Marks Jackson YEAR MAKER DESCRIPTION 1735/36 LOCATION Ker James Edinburgh chased, spoon, shortened one plus 7 Hanoverian, of set spoons, Dessert SOURCE 255 Compendium of Scottish Silver S DUNVS 6SRRQV%RRN LRQDO0XVHXPVRI6FRWODQG 6RWKHE\V+RSHWRXQ+RXVH0DUFK %UHDGDOEDQH&ROOHFWLRQ *HEHOHLQ V(DVW$UOLQJWRQ97 1991 7KH3KRHQL[&ROOHFWLRQ 6DQGUD/LSWRQ/RQGRQ 7KH3KRHQL[&ROOHFWLRQ 1991 #14 1991 #14 0(4 0(4 + RYHUVWULNLQJVHOI 6FKUHGG V$QWLTXHV/RQGRQ ZDY\VWHPPPRQO\PLGGOHPDUNHG V 1DWLRQDO0XVHXPVRI6FRWODQG DQFUHVWRI+XQWHUPDUNVLQFOXGHVFULSW. 0DU\&RRNH/RQGRQ HULDQFUHVWDQGPRWWR1RQ'HJHQHUIRU LGGOHZLWKXQXVXDOO\EURDGVWHPV 3ULYDWH&ROOHFWLRQ V 1DWLRQDO0XVHXPVRI6FRWODQG VFULSWLQLWLDOV:0,ORQJ :HGGHUEXUQ (GLQEXUJK 7HDVSRRQ+DQRYHULDQPPRQO\PLGGOHPDUNHG 3LFNIRUG (GLQEXUJK 7DEOHVSRRQVQRGHWDLOV 6RWKHE\V*OHQHDJOHV$XJXVW (GLQEXUJK +DVKVSRRQ+DQRYHULDQZLWKLQLWLDOV,0,5R] (GLQEXUJK 7DEOHVSRRQVVHWRI+DQRYHULDQLQLWLDOV7-&PP s Hally Hally s 7DLW $VVD\HU±'RXJDO Ged $VVD\HU±'RXJDO Ged $VVD\HU±'RXJDO Ged FD $7SUREDEO\$GDP FD $OH[DQGHU-RKQVRQ 'XQGHH 7DEOHVSRRQVVHWRI+DQRYHUL -DPHV.HU (EHQH]HU2OLSKDQW (GLQEXUJK (GLQEXUJK 6SRRQQRGHWDLOV 6SRRQQRGHWDLOV -DFNVRQ0 -DFNVRQ0DUNVS FD 'RXJDO*HG (GLQEXUJK 7HDVSRRQV6FRWVILGGOHSDWWHUQ 1739/40 James Mitchell Mitchell YEAR MAKER DESCRIPTION 1739/40 James LOCATION SOURCE FD *HRUJH&RRSHUFD1740/41 Jame 3DWULFN0XUUD\,, $EHUGHHQ (GLQEXUJK 7DEOHVSRRQVVHWRIQRGHWDLO 7HDVSRRQVVHWRI6FRWVI &KDUOHV'LFNVRQ,, (GLQEXUJK &KDUOHV'LFNVRQ,, 7DEOHVSRRQQRGHWDLOV (GLQEXUJK 7DEOHVSRRQVQRGHWDLO 1DW 1740/41 James Ker 1740/41 James -DPHV0LWFKHOVRQ (GLQEXUJK 7DEOHVSRRQVVHWRI+DQRY 256 Spoons tion tion H.1996.17 H.1996.17 #53 14, 1934 February Christies 1935 #354 1976 #29 1977 #65 1977 #65 Bonhams December 20, 1979 #275 KLQLWLDOV³-0)´R] 6RWKHE\V6FRQH3DODFH$SULO ased, Hanoverian pattern pattern Hanoverian ased, Scotland of Museums National crest, 6oz 9d 9d 6oz crest, terminals with initials initials with terminals Edinburgh Edinburgh shells, and scrolls with chased top back, at support hook with spoon, Hash Edinburgh long ½" 8 "MJ", initials with Hanoverian, Tablespoon, Collection Phoenix The $VVD\HU±'RXJDO Ged I Over striking Robert Low 1741/42 James Ker 1741/42 James 1741/42 1741/42 Ker James 1741/42 Oliphant Lawrence Edinburgh 1743/44 Aytoun William Edinburgh Aitchison 1743/44 no details spoon, Hash Aytoun William Edinburgh wt 10d handles, 27oz ribbed 12, plain, of set Tablespoons, 1743/44 Alexander Oliphant Lawrence Edinburgh details no Spoon, Edinburgh 5.9oz long, 13" spoon, hash Hanoverian long 8 3/8" "GT/ED", initials script with Hanoverian, pair, Tablespoons, #10 2, 1946 January Christies Collec Phoenix The 1744/45 Lothian Edward 1745 ca FD Edinburgh Steven John p92 2005 Catalog Shaw Nicholas 3 Hanoverian of set Tablespoons, -RKQ6WHYHQ 547 p Marks Jackson Dundee 'XQGHH Tealing of Scrymsoure of crest the with engraved spoon, Hash 547 p Marks Jackson +DVKVSRRQ+DQRYHULDQWHUPLQDOZLW Collection Private 13, April Palace Scone Sothebys 1743/44 1744/45 Campbell Alexander Edinburgh Aytoun William long 1/8" 8 "E", initial script with Hanoverian, Tablespoon, Edinburgh 3.3oz Hanoverian, probably pair, Tablespoon, Collection Phoenix The Sale Collection Breadalbane 1741/42 Oliphant Ebenezer Edinburgh 6, ch of set Tablespoons, YEAR MAKER DESCRIPTION 1741/42 LOCATION Mitchelson James Edinburgh Tait, James by spoon earlier one with sold 3, Hanoverian, of set Tablespoons, SOURCE 257 Compendium of Scottish Silver 1694-60 1694-60 MEQ 34 1923.365 1923.365 34 MEQ Dundee Museums and Art Galleries Collection Phoenix The MEQ 188 1988 #7 #33.120.92 AC #356 L.1983.328-i MEQ #48 2003 21, August Koopman London 1993 1993 London Koopman details details Scotland of Museums National set of 9 of set Scotland of Museums National acquired in 1964 acquired lasgow lasgow details no Tablespoon, Scotland of Museums National Edinburgh Edinburgh long 15" weight, scratch arms, Hanoverian, spoon, Hash 1993 NY Antiques Rothstein William Dempster Dempster William 1746/47 1747 ca Welsh John Telfer Samuel Edinburgh Glasgow no details Hanoverian, Tablespoon, no details Tablespoon, 1996 London Antiques Shredd's p569 Marks Jackson 1745 ca 1745 ca 1745 ca Ged Dougal Glen James 1745 ca Edinburgh Glen James 1745 ca Glasgow "MC" initials with fiddle, Scots Teaspoon, 1745 ca Oliphant Ebenezer long ¼" 8 "MM", over "JC" initials script Hanoverian, pair, Tablespoons, G Edinburgh Glen James 1745 ca 1993 CT House, Hobart long ¼" 5 "A", initial script with fiddle, Scots Teaspoon, Glen James 1745 ca Glasgow Lothian Edward Lothian Tablespoons, Edinburgh 1745 ca not pictured 20 Hanoverian, of set Tablespoons, Glasgow 1745/46 Edward Edinburgh Glen James Collection Private Hanoverian Collection Phoenix The spoon, Hash no details spoon, Hash 1746/47 Glasgow Penman Hugh 1746/47 long 14" "DK", initials script with spoon, hash Hanoverian or Davie William Edinburgh April House, Hopetoun Sothebys "HJ/L" initials the with Hanoverian, pair, Tablespoons, Collection Phoenix The Sale Scottish the Bonham's NYC Museum Metropolitan 1982 27, October NY Sothebys 1746/47 Ged Dougal Edinburgh no spoon, Hash YEAR MAKER DESCRIPTION 1745 ca LOCATION Steven John Dundee as one initialed the from different probably Hanoverian, plain, spoon, Hash SOURCE 258 Spoons ition ition DAG000906 DAG000906 1911, vol I, p 116, #101 #101 p 116, I, vol 1911, 1935 #374 #65 Collection Morris 1974 #96 J Bourdon-Smith London MEQ 784 H.1996.10 H.1996.10 AB Galleries #127 ir, (conversions) (conversions) ir, Scotland of Museums National 3 of set Tablespoons, Scotland of Museums National Edinburgh Edinburgh long ½" 8 "AO", initials script with Hanoverian, Tablespoon, Collection Phoenix The Weems Edinburgh Teaspoons, pair,no details Smith W B Glasgow Exhib James McKenzie Or James Mitchelson 1749/50 Dempster Ker & 1749/50 Edinburgh II Dickson Charles 1749/50 6, Edinburgh 13.5oz of set Tablespoons, 12, 27.5oz Low Robert of set Tablespoons, 1749/50 Mitchell James Edinburgh 1749/50 initials with engraved spoon, Hash rectangle a Edinburgh in IM pa spoons, Apostle Sale Collection Breadalbane 1984 3, July Glasgow Christies 29, August Gleneagles Sothebys 1749/50 James Mitchell Mitchell Edinburgh 1749/50 James 1749/50 1750 ca Gordon Hugh Coline Allan 1750 ca Edinburgh conjoined HR 6 Hanoverian of ,set Tablespoons Aberdeen no details spoon, Mote Tain rays and surface pierced with handle, narrow long spoon, Mote New Museum, Art Allyn Lyman 1996 London Antiques Shredd's and Museums Aberdeen YEAR MAKER DESCRIPTION 1747/48 LOCATION 1748/49 mark maker's CL Gordon Robert Edinburgh no details Spoon, Edinburgh 2d 30oz motto, and crest Hanoverian, 12, of , set Tablespoons 1980 6, November Sothebys SOURCE 547 p Marks Jackson 1748/49 1748/49 Gilchrist William 1748/49 James Gordon Robert Edinburgh details no Spoon, Edinburgh long 3/8" 8 MF", & "R initials script with Hanoverian, Tablespoon, Collection Phoenix The 547 p Marks Jackson 259 Compendium of Scottish Silver PDQ&ROOHFWLRQ± London, CT USA 1948.11 1948.11 USA CT London, MEQ 507 p91 1987 #233 VA Williamsburg Collection How Sothebys #23 2003 10, November Edinburgh #397 1933.338 128 MEQ 1993 #18 1935 #361 details details Scotland of Museums National Possibly Hugh Ross Possibly HughRoss Tain of YEAR MAKER DESCRIPTION LOCATION SOURCE 1750 ca 1750 ca Allan Coline Aberdeen no spoon, Hash 1750 ca 1750 ca Ross Hugh 1750 ca Glen James FD Tain -DPHV*OHQ Glasgow 1750 ca long 5/8" 4 "IP", initials with fiddle, Scots Teaspoon, Ross Hugh no details spoon, Serving *ODVJRZ 1750 ca Shirras Alexander 6HUYLQJVSRRQFUHVWDQGLQLWLDOV 1750 ca Tain Banff 1750 ca Taylor William Steven John 2002/03 Catalog Shaw Nicholas Edinburgh 6, Hanoverian of set 5d Tablespoons, 7oz long, ½" 15 spoon, Hash 1750/51 ¾" 4 "M/RM", initials , block fiddle Scots Teaspoon, 1750l/51 Lothian Edward Dundee Hewitt James 1750/51 Edinburgh "A" initial with Hanoverian, Tablespoon, no details Dempster Ker & Tablespoon, Edinburgh 1751/52 August Gleneagles Sothebys details no Edinburgh Tablespoon, +\ Robertson & Collection Lothian Phoenix The Edinburgh "A" initial 12, Hanoverian, of set Tablespoons, 6, 14.5oz of set Tablespoons, 1983 Annual Review Lyle 1983 March Glasgow Christies Sale Medcalf & Roddick Thomas August Gleneagles Sothebys Collection Swan Maple The Scotland of Museums National Sale Collection Breadalbane 260 Spoons on Canada 977.227.6 a-f a-f 977.227.6 Canada 1974 #100 Sothebys Gleneagles August 25, 25, August Gleneagles Sothebys 1997 #27 1935 #362 #50 2003 21, August 1974 #95 1974 #95 Catalog Bourdon-Smith J London Collection Private LDOVLQVFULSW³,0'´´ORQJ 5R\DO2QWDULR0XVHXP7RURQWR Earl of Hopetoun Hopetoun Earl of nd coronet for the 2 the for coronet Teaspoon, Scots fiddle, 4 5/8" long long 4 5/8" fiddle, Scots Teaspoon, Collection Phoenix The Edinburgh Edinburgh no details Tablespoon, 548 p Marks Jackson Edinburgh Edinburgh "JL" initials script with fiddle, Scots Teaspoon, Collection Phoenix The Weems Edinburgh Hash spoons,no details Jackson Marks 548 p Alexander Aitchison mark James McKenzie or James Mitchelson 1753/54 Dempster Ker & 1753/54 Edinburgh Dempster Ker & motto and crest with 11, Hanoverian, of set Tablespoons, Edinburgh with Infract" Spes "At motto with crested 12 Hanoverian, of set Tablespoons, 29, August Gleneagles Sothebys 1754/55 Low Robert Edinburgh Hanoverian spoon, Hash Sale Collection Breadalbane 1753/54 James 1753/54 James 1754/55 Robertson & Lothian 1755 ca Edinburgh 1755 ca in catalog 1740 as misdated Robertson & Lothian Tablespoon, Edinburgh AIT 1755 ca motto and crest lion with #5, "CS" initials with fiddle, Scots Teaspoon, maker's W I (dot) Collecti Private Sale Scottish the Bonhams YEAR MAKER DESCRIPTION 1752/53 LOCATION rectangle a in IM SOURCE 1752/53 1752/53 Ged Dougal Dempster Ker & Edinburgh Edinburgh pictured not Spoons, monogram a with engraved spoon, Hash 29, August Gleneagles Sothebys p 150 Cripps 1752/53 Robertson & Lothian Edinburgh 8oz (EHQH]HU2OLSKDQW long, ½" 16 JR", Domo "Ex with engraved terminal spoon, Hash (GLQEXUJK London Cooke Mary 7DEOHVSRRQVVHWRILQLW 261 Compendium of Scottish Silver ouse t Arlington, VA USA Collection Phoenix The #183 1994 Canada, Collection Phoenix The #128 #282 1935 #153 #50 2003 21, August #25 H.1993.32-33 H.1993.32-33 November 15, 1977 #103 1977 15, November ir, Hanoverian Hanoverian ir, Scotland of Museums National 1756/57 Robertson & Lothian 1756/57 Edinburgh 1757/58 Gordon Robert wt 7oz picture not hash spoon, Hanoverian Gilliland James Edinburgh 1757/58 Edinburgh no details Spoon, 1757/58 Clark James long ¼" 8 Hanoverian, pair, Tablespoons, Gordon Robert 1757/58 Edinburgh Clark John Edinburgh 1758/59 no details Spoon, 1987 18, June London Sothebys wt 16d 29oz motto, and crest 12, Hanoverian, of set Tablespoons, Robertson & Lothian 1758/59 Edinburgh Edinburgh Gilliland James 7oz spoon, Hash "BE" over "JH" engraved pattern, Hanoverian Tablespoon, 1980 6, November Sothebys Edinburgh Ottawa, Antiques, Donahoue catalog the in wrong date Hanoverian, Tablespoon, 2005 20, April Wallis & Woolley p548 Marks Jackson Sale Scottish the Bonhams 548 p Marks Jackson Sale Collection Breadalbane YEAR MAKER DESCRIPTION 1755 ca LOCATION 1755 ca Hewitt James Johnston Thomas Edinburgh Montrose long 5/8" 4 "IMT", initials block fiddle, Scots 4, of set Teaspoons, 8oz long, ½" 14 spoon, Hash Collection Phoenix The SOURCE 1983 March Glasgow Christies 1755/56 1755/56 Dempster Ker & Cuthberton Peter Edinburgh Canongate no details Spoon, pa Tablespoons, 548 p Marks Jackson 1756/57 Robertson Patrick Edinburgh 28oz Dunbar, of motto and crest with 12 Hanoverian, of set Tablespoons, H Hopetoun Sothebys 1756/57 Robertson & Lothian Edinburgh 3/8" crest, 8 below "H" initials script and crest tablespoon, Hanoverian Eas Gebelein's, 262 Spoons RWODQG HV$XJXVW NVS \V1<$SULO H0DSOH6ZDQ&ROOHFWLRQ RRGZLQ V$QWLTXHV(GLQEXUJK -%RXUGRQ6PLWK 2003 #286 2003 #286 1976 #110 1976 #110 1992 0(4 p91 óORQJR]G 1RWDYDLODEOH ULSW:$& 0DU\&RRNH/RQGRQ ORQJ 7KH3KRHQL[&ROOHFWLRQ WLDOVVFULSW5& 6DQGUD/LSWRQ/RQGRQ QLWLDO-ôORQJ 7KH3KRHQL[&ROOHFWLRQ ORQJ 1LFKRODV6KDZ&DWDORJ LWLDOV-/ôORQJ 7KH3KRHQL[&ROOHFWLRQ HVWDQGPRWWRRI%XFKDQQDQ -%RXUGRQ6PLWK ILGGOH 1DWLRQDO0XVHXPVRI6F (GLQEXUJK +DVKVSRRQPDNHURYHUVWUXFNODWHU 6RWKHE\V*OHQHDJO (GLQEXUJK 6SRRQGDWHOHWWHURYHUVWUXFNE\LQLWLDO* 7D\ORU (GLQEXUJK 7DEOHVSRRQVVHWRI+DQRYHULDQLQLWLDOVVF DP1DSLHU *ODVJRZ 7HDVSRRQ6FRWVILGGOHEORFNLQLWLDO, $VVD\HU±+XJK Gordon 2YHUVWUXFNE\ Gordon YEAR MAKER DESCRIPTION 1758/59 LOCATION Gordon Robert Edinburgh 5oz motto, and crest leaves, crossed with Spoons, 29, April Wallis, & Woolley SOURCE 1758/59 Dougal Ged Ged 1758/59 Dougal 1758/59 /RWKLDQ 5REHUWVRQ (GLQEXUJK Ure Archibald +DVKVSRRQQRGHWDLOV 7K 1759/60 William 'RXJDO*HGFD (GLQEXUJKFD 5HLGPDUN 7DEOHVSRRQVSDLU+DQRYHULDQLQL FD -6WHYHQFD &ROLQH$OODQ (GLQEXUJK 7HDVSRRQ6FRWVILGGOHVFULSWLQ 0LOQH &DPSEHOO 'XQGHH $EHUGHHQ *ODVJRZ 7DEOHVSRRQV+DQRYHULDQ 7DEOHVSRRQV+DQRYHULDQZLWKLQLWLDOV 7DEOHVSRRQV+DQRYHULDQ * 6RWKHE -DPHV*LOOLODQG (GLQEXUJK 6SRRQQRGHWDLOV -DFNVRQ0DU FDFD 0LOQH &DPSEHOO *ODVJRZ 00PDUN 7DEOHVSRRQV+DQRYHULDQFU 7HDVSRRQ6FRWV FD -RKQ%DOOLH 1760 ca FD Willi ,QYHUQHVV &ROLQH$OODQ 0DVNLQJVSRRQLQLWLDOV,6 $EHUGHHQ 7DEOHVSRRQ2OG(QJOLVKVFULSWL 263 Compendium of Scottish Silver Nicholas Shaw Catalog 1999 p57 1999 Catalog Shaw Nicholas 1982 #461 1982 #461 #25c 1984 27, #52 2003 21, August Private Collection Collection Private MEQ 192 #4 details details Scotland of Museums National 7.6oz 7.6oz only, 5 3/16" long 5 3/16" only, Edinburgh Edinburgh no details Tablespoon, Edinburgh 12.8oz initials, with Hanoverian, 6 of set Tablespoons, 30, August Gleneagles Sothebys 548 p Marks Jackson William Davie Davie William William Davie Davie William 1761/62 1761/62 Robertson & Lothian Edinburgh or Dempster William chased Hanoverian, pair, spoons, Dessert #252 18, 2002 July Bonhams 1761/62 or Dempster William 1762/63 Gordon Robert 1762/63 Dempster & Ker Edinburgh 1762/63 29.7oz "G", initial 12, with of set Tablespoons, Edinburgh Ker & Gilliland pattern English Old Tablespoons, Edinburgh 1767/68 as Jackson in misdated Tablespoon, March House Hopetoun Sothebys 549 p Marks Jackson Sale Scottish the Bonhams 1760 ca 1760 ca Warnock David 1760/61 Glasgow Robertson & Lothian 1760/61 Edinburgh 1760/61 no spoon, Hash Somervail James 7.5oz long, 1/8" 16 Hanoverian, spoon, Hash 1760/61 Robertson & Lothian Edinburgh Edinburgh Gairdner Alexander no details Tablespoons, 7.5oz long, 1/8" 16 Hanoverian, spoon, Hash Edinburgh long, ¼" 15 "DL/CR", initials the with engraved Hanoverian, spoon, Hash p92 2005 Catalog Shaw Nicholas p02 2005 Catalog Shaw Nicholas 548 p Marks Jackson YEAR MAKER DESCRIPTION 1760 ca LOCATION 1760 ca Clark James 1760 ca Welsh James 1760 ca (conjoined) IMC Edinburgh 1760 ca Edinburgh W (dot) J long 5/8" 4 "L", initial script with fiddle, Scots Teaspoon, Edinburgh long 5/8" 4 "W/EK", initials script Clark John with fiddle, Scots Teaspoon, long 4 5/8" initials, script remnant with fiddle Scots Teaspoon, Glasgow Edinburgh Collection Phoenix The long ¾" 8 "TP", initials script with Hanoverian, Tablespoon, Collection Phoenix The mm Collection "E", Phoenix The over initials "DE" the with form, slender of 6, of set Teaspoons, SOURCE Collection Phoenix The 264 Spoons August 29, 29, August 1DWLRQDO0XVHXPVRI6FRWODQG 1943.308-309 1943.308-309 1943.307 Nicholas Shaw Catalog 2000 p89 2000 Catalog Shaw Nicholas March/April 2004 2004 #132 March/April #S1161 Antiques Leopard Bonhams the Scottish Sale Sale Scottish the Bonhams #55 2003 21, August 1974 #95 J Bourdon-Smith London p15 #38 p15 #38 1911 vol I, p110, #7 p110, I, 1911 vol 1008 #31 1968 #179 Collection Private (QJOLVKHUDVHGLQLWLDOVò´ORQJ 7KH)LQLDO3RVWDO$XFWLRQ pair, no details details no pair, Scotland of Museums National VOTUM", 8 ½" long, 14.4oz 14.4oz long, ½" 8 VOTUM", motto "Super Totum" Totum" "Super motto Edinburgh Edinburgh 8.5oz long, 16" a crest, with spoon, Hash 1996, Catalog Bourdon-Smith J William Dempster Dempster William )UDQFLV+RZGHQ (GLQEXUJK $SRVWOH VVSRRQQRGHWDLOV /RWKLDQ 5REHUWVRQ (GLQEXUJK 7DEOHVSRRQSRLQWHG2OG 1763/64 1764/65 Clark John Lothian Edward Edinburgh Edinburgh long ½" 8 "JM/AT", initials script with Hanoverian, spoons, of Apostle pair Tablespoons, Collection Phoenix The 1763/64 Dempster Ker & 1763/64 Edinburgh 1763/64 Clark John monogram a with engraved spoon, Hash 1763/64 Taylor John or Davie William Edinburgh Edinburgh initials 1759, 5, one of set Tablespoons, no details spoon, Hash 29, August Gleneagles Sothebys 1995 London Lipton, Sandra 549 p Marks Jackson 1763/64 Gordon Robert Edinburgh SIDERA "SUPER motto and crest with 6 Hanoverian, of set Tablespoons, YEAR MAKER DESCRIPTION 1762/63 LOCATION Taylor William Edinburgh details no pair, Tablespoons, SOURCE Exhibition Glasgow Smith WB 1763/64 available Not 1763/64 Ker & Gilliland Edinburgh 1763/64 6.9oz Edinburgh long, ¼" 15 indistinct, mark mm spoon, Hash Gordon Robert motto and hourglass crest winged with 6 Hanoverian, of set spoon, Dessert Gleneagles Sothebys Edinburgh a starfish, over heart a flaming of crest 6 Hanoverian, of set Tablespoons, 25, August Gleneagles Sothebys 265 Compendium of Scottish Silver ational Museums of Scotland Scotland of Museums ational MEQ 1274 1274 MEQ 1970.543 992 MEQ 1979 #48 1982 3462 1, 1981 #419 1943.310-313 1943.310-313 MEQ 189 MEQ 295 Edinburgh HH1800/58 HH1800/58 Edinburgh ³-0´RQUHYHUVH´ORQJ +XQWOH\+RXVH0XVHXP ots fiddle fiddle ots Scotland of Museums National alt shovel, Scots fiddle fiddle Scots shovel, alt N gow gow details no 6, of set Tablespoons, Scotland of Museums National Edinburgh Edinburgh foliage with chased Hanoverian, spoon, Mustard #262 2002 18, July Bonhams Edinburgh long ½" 8 crest, with Hanoverian, Tablespoons, Collection Phoenix The illiam Davie or or Davie illiam William Dempster Dempster William Dempster William Francis Howden Howden Francis Edinburgh year each from 2 4, of set spoons, Apostle's Scotland of Museums National 1765 ca 1765 ca Welsh James 1765 ca W Edinburgh S 1765/66 Gilliland James 1765/66 Edinburgh Dempster & Ker 1765/66 12.7oz initials, with Hanoverian, Tablespoons, Edinburgh probably D (star) W motto and crest a with engraved pattern, Onslow spoons, Gravy September Gleneagles Sothebys 30, August Gleneagles Sothebys 1765 ca 1765 ca 1765 ca Dempster James Robertson Patrick Edinburgh Edinburgh initials "JC" with fiddle, Scots spoon, Masking 6.5oz monogram, with engraved Hanoverian, spoon, Hash 10, April Palace Scone Sothebys Collection Private YEAR MAKER DESCRIPTION & 1764/65 1767/68 LOCATION SOURCE 1764/65 1764/65 Campbell & Milne 1765 ca Glasgow Gilliland James Graham Adam no details spoons, Hash Edinburgh English 6 Old Tablespoons, Glas 549 p Marks Jackson 1993 Plus Silver 1765 ca 1765 ca Scott William FD :LOOLDP&UDZ Perth &DQRQJDWH stamp Breadalbane with spoon, Hash 7DEOHVSRRQVVHWRILQLWLDOV Scotland of Museums National 1765 ca 1765 ca conjoined MK Edinburgh Sc Teaspoons, 266 Spoons p89 Sothebys Gleneagles September 1, 1981 #405 #46 1977 15, November The Phoenix Collection Collection Phoenix The #6576445868 NYS NYS #6576445868 p118 #144 August 21, 2003 #72 #72 2003 21, August MEQ 519 1954.265 1954.265 Jackson Marks p 549 p Marks Jackson ´ORQJR] %RQKDPVWKH6FRWWLVK6DOH no details details no Scotland of Museums National lespoons, set of 6, no details details no 6, of set lespoons, Scotland of Museums National 13.4oz 13.4oz 8 1/8" long 8 1/8" details details Edinburgh Edinburgh pattern Onslow spoon, Serving 2005 5, November eBay Edinburgh Tablespoons, (Note:this mark was probably used by Dempster or Davie),no 7D\ORU (GLQEXUJK +DVKVSRRQ+DQRYHULDQZLWKODWHULQLWLDOV William Dempster or or Dempster William Davie William William Drummond Drummond William 1768/69 Robertson Patrick 1768/69 Edinburgh 1768/69 Ziegler Alexander 21.8oz crests, with 11 Hanoverian, of set Tablespoons, 1768/69 Robertson Edinburgh & Lothian Edinburgh Robertson Patrick no details Tablespoon, mottos and 2 crests Hanoverian, pair, Tablespoons, Edinburgh no details Tablespoon, House Hopetoun Sothebys 1995 London Lipton, Sandra #253 18, 2002 July Bonhams 549 p Marks Jackson 1766/67 1767/68 Steven John script WD Dundee no details Tablespoon, 549 p Marks Jackson 1767/68 1767/68 Gilliland James 1766/67 Tait Benjamin Edinburgh Robertson Patrick 1767/68 William 12.2oz long, 1/8" 8 "H", initial 5 Hanoverian, of set Tablespoons, Edinburgh Edinburgh no details Tablespoon, 2 spoons, Dessert 2000 Catalog Shaw Nicholas 549 p Marks Jackson I, vol 1911, Exhibition Glasgow 1768/69 Gilliland James Edinburgh another spoon, with "W" initial with 6 Hanoverian, of set Tablespoons, 1766/67 conjoined MK Edinburgh McKenzie, James possibly monogram, script Hanoverian, Tablespoon 1765/66 be) to (said WD 1766 ca 1766 ca Gordon James Aberdeen Tab YEAR MAKER DESCRIPTION 1765/66 LOCATION Dempster & Ker Edinburgh spoon, Serving SOURCE 267 Compendium of Scottish Silver 2001 p69 2001 J O0XVHXPVRI6FRWODQG DO0XVHXPVRI6FRWODQG Woolley & Wallis, June 28, 2000 2000 28, June Wallis, & Woolley #44 The Phoenix Collection Collection Phoenix The 1956.851-853 349-351 MEQ Jackson Marks p591 MEQ 363 1956.865 1956.865 363 MEQ 1987 #235 1987 #237 H.1996.14 (1-3) H.1996.14 August 24, 2005 358 358 2005 24, August KSDWWHUQ 1DWLRQDO0XVHXPVRI6FRWODQG LFWXUHG 6RWKHE\V*OHQHDJOHV$XJXVW RQJR] %RQKDPVWKH6FRWWLVK6DOH KLQLWLDO0RQWKHEDFNORQJR] 1LFKRODV6KDZ&DWDOR , no details details no , 549 p Marks Jackson back, 8 ¼" long long ¼" 8 back, DWH +DVKVSRRQQRGHWDLOV 1DWLRQ Z 7DEOHVSRRQVVHWRI 1DWLRQD Cluny Cluny no Spoon, details Cripps p151 Gordon 1770 ca 1770 ca Robertson- Patrick YEAR MAKER DESCRIPTION 1769/70 LOCATION 1770/71 Ker Daniel mark B J Edinburgh details no spoon, Salt Edinburgh spoon Sugar SOURCE 659 p Marks Jackson 1770 ca 1770 ca 1770 ca JL JL Glasgow Glasgow 8 of a set actually "C", script initial English, Old of pair Tablespoons, long 7" above, tablespoons matching English, Old set, spoon, Dessert 1995 London Antiques, Shredds 1996 London Antiques, Shredds FD -RKQ$UJR 1770 ca Spaulding Peter FD %DQII Canongate 0LFKDHO)RUUHVW pattern fiddle Scots 3, of set Teaspoons, 7DEOHVSRRQPDUNV±%$,$±2OG(QJOLV &DQRQJ 1901 Exhibition Glasgow FD %D\QH 1DSLHU 1770 ca *ODVJRZ Graham Adam FD 6HUYLQJVSRRQ+DQRYHULDQQRWS 0LOQH &DPSEHOO Glasgow *ODVJR not pictured spoon, Serving August Gleneagles Sothebys FD $OH[DQGHU7KRPSVRQ $EHUGHHQ +DVKVSRRQ+DQRYHULDQZLW -DPHV*LOOLODQG1771/72 (GLQEXUJK Robertson Patrick Edinburgh +DVKVSRRQ+DQRYHULDQ´O the on "Richmond" with inscribed drop, single Hanoverian, Tablespoon, 268 Spoons 1996.15 1996.15 Williamsburg Collection Phoenix The 1994 USA 1994 1935 #143 1935 #143 MEQ 933 Canada 1991 Canada #220 1935 #367 spoons, 4 spoons, Scotland of Museums National URO" URO" and "VIRTUTE ET VALORE", 8 ½" long Edinburgh Tablespoon, feather NON English, edged,and mottos Old "LUCIO crest Edinburgh 6.5oz Hanoverian, 6 of set spoons, Dessert Edinburgh motto and crest with Hanoverian, 6 of set spoons, Dessert Sale Collection Breadalbane Collection Private Edinburgh Edinburgh English Old pierced spoon, Serving Scotland of Museums National Edinburgh Edinburgh details no Tablespoon, Toronto Antiques, Lorentz & Son Dempster William William Dempster Dempster William Davie or Dempster William Dempster Dempster William 1773/74 Aitchison Gilliland James 1774/75 Alexander Edinburgh 1775 ca border feathered spoon, Hash 1775 ca Thompson Alexander Aberdeen Thompson Alexander 1775 ca Aberdeen no details Spoon, Taylor John end bowl worn Tablespoon, 1775 ca 1775 ca Scott William Greenock 1775/76 Downie David Dundee end worn Tablespoon, or Davie William Edinburgh 5.9oz long, 15" stamp, Breadalbane with English, Old spoon, Hash fiddle Scots Teaspoon, Colonial - Collection Hyman p57 1999 Catalog Shaw Nicholas Jersey New Antiques, Medford 145 p Luddington USA Jersey New Robinson, D Collection Private 1775/76 or Davie William 1775/76 William script WD YEAR MAKER DESCRIPTION 1772/73 LOCATION or Davie William SOURCE 1772/73 Welsh James 1773 ca Auld Dessert/fruit Edinburgh Taylor James 1773/74 George Edinburgh Hanoverian of pair Tablespoon, Glasgow 10.2oz another, with sold spoon, Hash 1982 14, April NY Sothebys Sale Collection Breadalbane 269 Compendium of Scottish Silver 1911 vol I, p110 #18 #18 p110 I, 1911 vol Collection Phoenix The 1994 Canada, Collection Phoenix The 1978 #376 1978 #376 1987 #242 1988 #11 Edinburgh Edinburgh long 12" spur, singed a double of crest pattern, Onslow spoon, Serving Edinburgh Collection Phoenix The details no spoon, Sugar p549 Marks Jackson Edinburgh Edinburgh motto and crest a with English, Old edged, feather 4, of set spoons, Dessert 29, August Gleneagles Sothebys Davie or Dempster William Dempster Dempster William William Dempster Dempster William YEAR MAKER DESCRIPTION 1776/77 LOCATION William script WD SOURCE 1776/77 or Davie William 1776/77 Robertson Patrick Edinburgh no details Tablespoon, Exhibition Glasgow Hyslop DW 1777 ca 1777 ca 1777/78 Hamilton & Taylor Glasgow mark S W 1777/78 3.4oz long, 11" Hanoverian, spoon, Serving 1778/79 Dempster James Edinburgh Robertson Patrick Edinburgh 1778/79 English Edinburgh 6 Old Tablespoons, no details Tablespoon, 1778/79 Aitchison Alexander 12" an orb, holding arms 2 English, Old spoon, Serving Edinburgh 1778/79 Hewitt James English 5 Old Tablespoons, 1780 ca Hewitt James Edinburgh 1780/81 p79 2001 Catalog Shaw Nicholas Ziegler Alexander Coutts of motto Edinburgh and crest the with pair, spoons, Gravy or Davie William Edinburgh Toronto, Antiques, Lorentz 12 of set spoons, Dessert fiddle Scots Teaspoon, 1994 Canada, Toronto Wine, L Collection Private 549 p Marks Jackson 1991 Canada, Toronto Wine, L Collection Private Collection Private 1780/81 1780 ca Cunningham P & W Edinburgh Scott William 1780 ca no details Tablespoon, Campbell & Milne Dundee Glasgow details no spoon, Hash not pictured 6, Tablespoons, 550 p Marks Jackson April House, Hopetoun Sothebys August Gleneagles Sothebys 270 Spoons August 24, 2005 #49 #49 2005 24, August Collection Private 1983 #385 1935 #146 MEQ 526 1921.482-483 920-921 MEQ MEQ 526 L.396.33-33g 1978 #106 H.1996.8 H.1996.8 Nicholas Shaw Catalog 2000 p89 2000 Catalog Shaw Nicholas K.2003.1048 K.2003.1048 details details Scotland of Museums National ir, Onslow pattern pattern Onslow ir, Scotland of Museums National , no details details no , Scotland of Museums National , set of 3 of set , Scotland of Museums National Tablespoons, set of 3 of set Tablespoons, Scotland of Museums National and motto motto and PRUDENTIA", 8 ¾" long, 25.5oz 25.5oz long, ¾" 8 PRUDENTIA", Edinburgh Edinburgh crest head stag's a with pattern, English Old pointed 4, of set spoons, Gravy William Davie Davie William 1782/83 1782/83 Howden Francis or Dempster William Edinburgh 1782/83 no details Spoon, Robertson Patrick 1782/83 Edinburgh Wright James 1783 ca 27.5oz motto, and crest with English, Old Tablespoons, Smith James Glasgow 1783/84 Gairdner Alexander 6, 12.7oz of set Tablespoons, Aberdeen Edinburgh pa spoons, Serving 29, August Gleneagles Sothebys 550 p Marks Jackson Sale Collection Breadalbane 1780/81 Cunningham P & W 1781/82 Edinburgh Ochiltree Archibald details no 8, of set Spoons, 1781/82 Edinburgh Howden & Taylor tailed rat nose, dog of pair Tablespoons, Edinburgh 8oz handles, chased later with Tablespoons, 10, April Palace Scone Sothebys Scotland of Museums National Sale Scottish the Bonhams 1780/81 Robertson Patrick Edinburgh spoon Serving 1780/81 Patrick Robertson Edinburgh Tablespoons Edinburgh Robertson 1780 ca 1780/81 Patrick mark WM long 7/8" 4 fiddle, 5 Scots of set Teaspoons, Collection Phoenix The YEAR MAKER DESCRIPTION 1780 ca LOCATION Ross Hugh Tain no spoon, Masking SOURCE 1780 ca 1780 ca Scott William Dundee "PRAETIO motto and crest edged, 12 feather of set Tablespoons, 271 Compendium of Scottish Silver n ction ction MEQ 775 #116 2004 12, September 1990 #9 A.1963.441 A.1963.441 MEQ 917-918 1968.479-480 1968.479-480 917-918 MEQ 1935 #144 1935 #144 rked Scots fiddle pattern pattern fiddle Scots rked Scotland of Museums National no details details no Scotland of Museums National details details Scotland of Museums National Edinburgh Edinburgh details no 12, of set Teaspoons, Collection Swan Maple The Edinburgh Edinburgh "NF" initials the with mark, duty incuse with fiddle, Scots Teaspoon, Collection Private James Douglas Douglas James Edmonstoun Edmonstoun 1784/85 1784/85 Hewitt James 1785 ca Gairdner Alexander Edinburgh Edinburgh 1785/86 McEwan James initials engraved pattern, "W" English Old initial spoon, Hash English, Old 11 Tablespoons, Gairdner Alexander 1785/86 Glasgow Edinburgh or Dempster James 3.5oz long, 5/8" 12 English, Old spoon, Serving long 5/8" 8 "F", initial script with Hanoverian, Tablespoon, #14 1988 19, October Christies Collection Phoenix The 1993 London, Bourdon-Smith J USA Chicago Auction, Klein M 1785/86 1786/87 Marshall David Gairdner Alexander Edinburgh Edinburgh no details Tablespoon, not pictured spoon, Hash August Gleneagles Sothebys 550 p Marks Jackson 1784/85 Mathie Peter Edinburgh no spoon, Hash 1784/85 Cunningham P & W Edinburgh Spoon, Serving YEAR MAKER DESCRIPTION 1783/84 LOCATION 1783/84 Bowman Robert Welsh James Edinburgh no details Spoon, Edinburgh long 7 5/8" "JB", initials script with pattern, English Old pointed Tablespoon, Colle Phoenix The SOURCE 550 p Marks Jackson 1783/84 1784/85 Alexander Howden & Taylor Edinburgh long 5/8" 8 "J", initial script with English, Old Tablespoon, 1784/85 1784/85 Gilliland James Spence Alexander Edinburgh Collection Phoenix The Edinburgh "GT" initials with edge, feather pattern, English Old pointed Teaspoon, ma fully pair, Teaspoons, Collectio Phoenix The 1784/85 Marshall David Edinburgh 2.3oz English, Old edge, 6 feather of set Teaspoons, Sale Collection Breadalbane 272 Spoons , 39, 39, M Rafael, NYC USA 1993 USA NYC Rafael, M Collection Phoenix The 1993 USA MEQ 471 Private Collection Collection Private Sothebys Scone Palace April 19, 1977 #70 1978 #383 1978 #383 1982 #477 1982 #477 1979 #48 1993 #14 1993 #14 details details Scotland of Museums National Campbell "Follow me", initials "CC" in a badge/cartouche, 12 ½" long long ½" 12 badge/cartouche, a in "CC" initials me", "Follow Campbell flaming rock and a motto a motto and rock flaming 11.3oz 11.3oz Edinburgh Edinburgh 5.9oz motto, and a crest with English, Old of pair spoons, Gravy 29, August Gleneagles Sothebys Edinburgh Edinburgh details no pair, spoons, Gravy Collection Swan Maple The William Dempster Dempster William William Dempster Dempster William 1789/90 1789/90 Robertson Patrick 1789/90 Gairdner Alexander Edinburgh Edinburgh Ziegler Alexander 12oz initials, with 4, engraved of set spoons, Hash 1790 ca no details spoon, Hash Edinburgh Argo John 1790 ca English Old of pair spoons, Stuffing 1790/91 Leslie John Banff Robertson Patrick Edinburgh Aberdeen #16 1988 19, October Christies no spoon, Hash initials with engraved pair, spoons, Serving 2.7oz long, ¼" 11 "M", initial with English, spoon, Old Gravy p92 2005 Catalog Shaw Nicholas MA, Boston Parsons, & Firestone 550 p Marks Jackson #15 1988 19, October Christies 1789/90 Robertson Patrick Edinburgh of motto and crest pattern, English Old pointed pair, spoons, Serving 1788/89 1789/90 Paton Neil or Davie William Edinburgh "A" initial the with pattern, English pointed Old of spoons, pair Gravy Collection Private 1789/90 Hewitt James Edinburgh 6.7oz "E", with engraved pattern, English Old pointed spoon, Dessert August Gleneagles Sothebys 1789/90 Howden Francis 1789/90 Edinburgh Robertson Patrick 6.2oz initials, with pattern, English Old Pointed 3 Tablespoon, Edinburgh a of crest the with pattern, English Old 4 pointed of set spoons, Gravy 23 April Palace Scone Sothebys YEAR MAKER DESCRIPTION 1786/87 LOCATION Ziegler Alexander Edinburgh pattern English Old 2, spoons, Dessert SOURCE August Gleneagles Sothebys 1788/89 or Davie William 1788/89 Gilliland James Edinburgh 1-6, numbered and "B: initial the with English, 6 Old of set Tablespoons, 273 Compendium of Scottish Silver 31, 31, Midlothian e September Private Collection Collection Private 1992 #16 1992 #16 12, 1980 #141 1980 12, 1989 #7 I, vol 1911, Exhibition Glasgow #20 p111, 1993 DC, USA, 1994 USA, 1993 #11 1993 #11 1987 #241 1987 #244 1991 #14 1791/92 Gairdner Alexander Edinburgh 26oz motto, and crest with English, 12 Old of set Tablespoons, August Gleneagles Sothebys 1791/95 Ziegler Alexander Edinburgh 11.8oz "K", initial the with pattern, English Old pointed Tablespoons, Blair Castl Sothebys 1791/92 Howden Francis 1792/93 Edinburgh Robertson William Edinburgh 1793/94 no details pair, spoons, Serving details no Tablespoon, Gray Robert 1793/94 Gairdner Alexander Edinburgh Edinburgh "F" initial the with English, Old spoon, Serving English Old pointed spoon, Dessert April House Hopetoun Sothebys Washington Antiques, Getz M Hyslop DW VA Alexandria Inc. Levine, YEAR MAKER DESCRIPTION 1790/91 LOCATION 1790/91 Robertson William Edinburgh 1790/91 Henderson Alexander Edinburgh initials with engraved pair, spoons, Serving Howden Francis English Old pointed 6-8 spoons, Dessert Edinburgh "HS" initials pattern, English Old pointed 6, Tablespoons, August Gleneagles Sothebys #15 1988 19, October Christies SOURCE London 1991 Asprey 1790 ca 1790 ca Cornfute James 1790 ca Perth Cornfute James 1790 ca Perth Dickson Richard 1790/93 details no English, Old pointed pair, Spoons, Perth 1790/91 Cunningham P & W details no English, Old pointed 12 Tablespoons, Edinburgh Howden Francis English Old pointed 6, Spoons, no details 5, Spoons, Edinburgh "S" initial the with pattern, English pointed Old of spoons, pair Gravy vaults; August Silver Gleneagles London Sothebys August Gleneagles Sothebys 1991 Sale, London Shrubsole August Gleneagles Sothebys 274 Spoons and ust 27, 27, ust tle September September tle 1983 #382 1983 #382 August 24, 2005 #53 #53 2005 24, August The Phoenix Collection Collection Phoenix The p112, #39 p112, 12, 1980 #JE 1980 12, 1979 #228 1979 #228 The Phoenix Collection Collection Phoenix The MEQ 895 Williamsburg Williamsburg ad pattern, crest of Drummond, 7.5oz 7.5oz Drummond, of crest pattern, ad Aug Gleneagles Sothebys Teaspoons, set of pointed Old English pattern, with script initials "BN" "BN" initials script with pattern, English Old pointed of set Teaspoons, Scotl of Museums National Dessert spoons, set of 11 Old English, with 2 sets of initials, 10.5oz 10.5oz initials, of 2 sets with English, 11 Old of set spoons, Dessert 29, August Gleneagles Sothebys PETE FINUM", 12" long long 12" FINUM", PETE Edinburgh Edinburgh "JD" initials with engraved English, Old Tablespoons, Sale Scottish the Bonhams Glasgow Glasgow "CERTUM motto and crest pattern, English Old pointed spoon, Serving *ODVJRZ +DVKVSRRQQRGHWDLOV +\PDQ&ROOHFWLRQ±&RORQLDO & Co Co & Assayed in Edinburgh Assayed Edinburgh $VVD\HG±(GLQEXUJK 1797/98 Alexander Gairdner Gairdner 1797/98 Alexander 1797/98 Robert Gray Gray 1797/98 Robert 1797/98 HW 1797/98 HW 1796/97 1796/97 Robertson William Edinburgh 1797/98 Spence Alexander "H" initial the with 12, of set spoons, Dessert Spence Edinburgh Alexander Edinburgh "WD" initials the with pattern, thread & English 6 Old of set Spoons, details no pair, spoons, Gravy Collection Private Collection Private I, vol 1911, Exhibition Glasgow 1796/97 Robertson William Edinburgh 13.4oz initials, with pattern, English Old 6 pointed of set Tablespoons, Cas Blair Sothebys YEAR MAKER DESCRIPTION 1794/95 LOCATION 1794/95 Robertson William Edinburgh Christie George details no Tablespoon, Edinburgh long ½" 8 "E", script initial 3 Hanoverian, Tablespoons, 1993 Goodwin's SOURCE 550 p Marks Jackson 1794/95 1795 ca Robertson William Edinburgh Douglas James details no pair, spoons, Serving Dundee Collection Swan Maple The 1795 ca 1795 ca 1796/97 Byres William 1796/97 Spence Alexander Banff Edinburgh Gray Robert no details Tablespoon, details no 4, Teaspoons, 550 p Marks Jackson 1993 USA NYC Raphael, M 1796/97 McKay James Edinburgh thre and fiddle of pair spoons, Gravy 275 Compendium of Scottish Silver August #13 August Williamsburg Williamsburg MEQ 48 Collection Gubbins Collection Gubbins Collection Gubbins 1991 #14 2003 #6 1993 #10 1993 #12 1993 #12 1993 #12 ngwall ngwall details no Spoon, p145 Luddington Edinburgh Edinburgh no details Spoon, 3HUWK +DVKVSRRQFUHVWDQGPRWWR 550 p Marks Jackson +\PDQ&ROOHFWLRQ±&RORQLDO Co Co $VVD\HG±(GLQEXUJK YEAR MAKER DESCRIPTION 1798/99 LOCATION 1799/1800 Duffus Thomas Robertson Patrick Edinburgh Edinburgh no details long Spoon, ½" 12 wrong, be may and struck double letter date spoon, Serving Gleneagles Sothebys SOURCE 550 p Marks Jackson 1799/1800 1799/1800 & Gardner Alexander 1799/1800 1799/1800 I Keay Robert 1800 ca 1800 ca Clark William 1800 ca Sinclaire James Greenock 1800 ca stamp Breadalbane with English, Old pointed Tablespoon, Wick Ross Alexander 1800 ca Di Fowler Charles 1800 ca pattern fiddle Spoon, Ritchie William Elgin 1800 ca Scotland of Museums National Perth Keith John 1800 ca pattern fiddle Spoon, Douglas James 1800 ca details no 6, spoons, Dessert Banff Gillet Nathaniel Dundee 1800 ca English Old Teaspoon, Aberdeen Gillet Nathaniel English 7 Old of set spoons, Dessert 1800 ca "H" initial the with English, 6 Old of set spoons, Dessert Aberdeen Leslie John 6 of set Teaspoons, p145 Luddington Aberdeen English Old 2 Teaspoons, August Gleneagles Sothebys August Gleneagles Sothebys p145 Luddington August Gleneagles Sothebys August Gleneagles Sothebys August Gleneagles Sothebys August Gleneagles Sothebys 276 Spoons ed, 1993 p585 1993 ed, th November 13, 1978 397 1978 13, November Nicholas Shaw Catalog 2001 p79 2001 Catalog Shaw Nicholas MEQ 510 1993 #14 MEQ 895 MEQ 484-487 484-487 MEQ 1993 #12 1993 #12 1993 #12 1993 #12 1993 #12 6´PDUN 6RWKHE\V*OHQHDJOHV$XJXVW set of 4 of set Scotland of Museums National no details details no Scotland of Museums National ing spoon spoon ing Scotland of Museums National ns, set of 6, date too late for these makers, 11.6oz 11.6oz makers, these for late too 6, date of set ns, House, Hopetoun Sothebys 3.4oz 3.4oz 1801/02 1801/02 Howden Francis Howden Francis Edinburgh Edinburgh no details Tablespoon, 10d 2oz spoon, Stuffing p550 Marks Jackson 27 PG Warman 1800 ca 1800 ca 1800 ca WM 1800/01 AC 1800/01 Ziegler John Ziegler Alexander 1800/01 Edinburgh Edinburgh Edinburgh Robertson & long Lothian ¾" 3 "W", initial script pattern, fiddle of pair spoons, Salt Greenock Edinburgh English 9 Old no details of set spoons, spoon, Hash Dessert long ½" 5 "MT", initials script with pattern, English Old pointed Teaspoon, Tablespoo Collection Phoenix The Collection Phoenix The August Gleneagles Sothebys 550 p Marks Jackson 1800 ca 1800 ca Keith John Banff spoons, Dessert 1800 ca 1800 ca Erskine James Aberdeen strain Gravy 1801/02 Henderson Alexander Edinburgh long, 12" ADSUM", "CAVE motto and crest English, Old spoon, Serving YEAR MAKER DESCRIPTION 1800 ca LOCATION McQueen J Banff English Old 3 Teaspoons, SOURCE August Gleneagles Sothebys 1800 ca 1800 ca Lambert Peter 1800 ca AC Banff FD $& 1800 ca English Old 2 Teaspoons, Erskine James Greenock Aberdeen English Old Teaspoon, *UHHQRFN spoon, Serving 7HDVSRRQ6FRWVILGGOHSDWWHUQDOVRZLWK³ August Gleneagles Sothebys August Gleneagles Sothebys 277 Compendium of Scottish Silver A * H.1996.38 H.1996.38 86$$ % Sandra Lipton, London 1995 1995 London Lipton, Sandra 1994 1993 USA, 1993 #10 1993 USA, DC Nicholas Shaw Catalog 2001 p79 2001 Catalog Shaw Nicholas MEQ 894 script initial "A" "A" initial script Canada, Toronto Ritas, & Floyd LQLWLDOV³-%´RU³,%´QRGHWDLOV +LJK0XVHXPRI$UW$WODQWD details details Scotland of Museums National , no details details no , Scotland of Museums National another pair also also pair another 3.5oz 3.5oz Edinburgh Edinburgh motto and crest with pattern, English Old pointed spoon, Serving London 1995 Cooke Mary Edmonston Edmonston 1806/07 Henderson Alexander Edinburgh pattern English Old pointed Teaspoon, 1992 USA VA Queen, Silver 1805/06 1805/06 Russel & Mitchell Glasgow Henderson Alexander Edinburgh no details Spoon, spoon Serving 550 p Marks Jackson 1802/03 1802/03 Craw Matthew 1802/03 Henderson Alexander Edinburgh Edinburgh WM no details pair, spoons, Serving no details Tablespoon, Edinburgh with English, Old spoon, Hash 1992 NY, Wyler, S 550 p Marks Jackson 1802/03 WM 1802/05 Gray Robert 1804/05 Alexander Edinburgh Glasgow English Old of pair Tablespoons, "J" initial with English, Old 6 spoon, Dessert $OH[DQGHU6SHQFH (GLQEXUJK 6SRRQVSDLULQVFULEHGZLWK August Gleneagles Sothebys TX Austin Antiques, Whirligig 1804/05 Son & Gray Robert Glasgow long ¾" 12 English, Old spoon, Serving Washington Antiques, Getz M 1802/03 Craw Matthew Edinburgh motto, and crest with pattern, English Old pointed pair, spoons, Serving YEAR MAKER DESCRIPTION 1801/02 IM no LOCATION spoon, Serving Edinburgh SOURCE 1802/03 Ziegler Alexander Edinburgh long, ¾" 12 Arms, of coat with pattern, English Old pointed spoon, Serving 278 Spoons itas Toronto Canada Canada Toronto itas 1994 1993 #11 1983 1991 Canada 1995 USA Collection Phoenix The 1983 ooved, with scriptinitial "A" Floyd & R Paisley Paisley pattern fiddle Paisley Teaspoon, USA SC Charleston E Austin, Glasgow Glasgow "MH" initials script with English, Old Teaspoon, Edinburgh details no Tablespoon, Collection Phoenix The Collection Swan Maple The Glasgow Glasgow 5.2oz long, 3/8" 5 "JW", initials English, 12 Old of set Teaspoon, #3076 London Lipton Sandra Assayed in Edinburgh Assayed in Edinburgh Edmonston Assayed in Edinburgh 1807/08 Hanney Howden Francis 1807/08 William Edinburgh "HS" initials with English, Old 6 spoon, Dessert August Gleneagles Sothebys 1807/08 Son & Gray Robert 1808/09 1808/09 Alexander Henderson Alexander Edinburgh crest with pair, spoon, Serving 1993 USA NYC Voth D 1808/09 WM 1808/09 Edinburgh 1809/10 Naysmith James "RN" initials script with pattern, fiddle spoon, Hash 1809/10 D & N Edinburgh LG or ID spoon berry as a decorated later Tablespoon, Edinburgh Edinburgh spoon berry as a decorated later Tablespoon, Toronto Antiques Lorentz ¼"long 5 pattern, fiddle of pair Teaspoons, Collection Swan Maple The Collection Swan Maple The NY Trumansburg Collection, The YEAR MAKER DESCRIPTION 1806/07 LOCATION WC Edinburgh pattern fiddle Tablespoon, SOURCE USA SC Charleston E Austin, 1806/07 Son & Gray Robert 1807/08 1807/08 McKay James Ziegler John Edinburgh details no spoon, Salt Edinburgh gr strainer English, Old spoon, Hash Collection Swan Maple The 279 Compendium of Scottish Silver to Canada f Scotland S RQS ZHH:DVKLQJ'&86$ Gubbins Collection Collection Gubbins The Phoenix Collection Collection Phoenix The Canada 1994 Canada 1994 Gubbins Collection Collection Gubbins 1994 1991 0(4 WLQLWLDO³)´ó´ORQJ 1DWLRQDO0XVHXPVR ZLWKVFULSWLQLWLDO7ORQJ +\GH3DUN&HQWHU1<86$ 6RWKHE\V*OHQHDJOHV$XJXVW 7KH0DSOH6ZDQ&ROOHFWLRQ Tablespoon, fiddle pattern, with script initials "HR" initials "HR" script with pattern, fiddle Tablespoon, Toronto Antiques Lorentz 7HDVSRRQVVHWRIQRGHWDLOV 7KH0DSOH6ZDQ&ROOHFWLRQ WDEOH 'XQGHH 6HUYLQJVSRRQVSDLURISRLQWHG2OG(QJOLVKVFULS Assayed in Edinburgh Assayed Edinburgh FD 5REHUW.HD\, 3HUWK 7DEOHVSRRQVSDLURIILGGOHSDWWHUQ 1810/11 A R R 1810/11 A )UDQFLV+RZGHQ (GLQEXUJK 6DOWVSRRQVSDLUQRGHWDLOV :LOOLDP&XQQLQJKDP (GLQEXUJK 6DOWVSRRQVQRGHWDLOV -DPHV0F.D\FD :6 (GLQEXUJK 7DEOHVSRRQILGGOHSDWWHUQ 3HWHUKHDG 6SRRQILGGOHSDWWHUQQRGHWDLOV )0LO /XGGLQJW 1810 ca 1810 ca Jamieson William 1810/11 AR Aberdeen "D" initial with English, 6 Old Tablespoons, August Gleneagles Sothebys 1809/10 1809/10 McKay James Henderson Alexander 1810 ca Edinburgh Edinburgh pattern fiddle 6 spoons, Dessert Cons William English FD Old 6 spoons, Dessert :$ )RUUHV 6SRRQILGGOHSDWWHUQQRGHWDLOV Canada Toronto Wine, Louis 994 USA VA Fox, Scarlet /XGGLQJWRQ YEAR MAKER DESCRIPTION 1809/10 LOCATION Ziegler for Z Edinburgh "P" initial script sun, of crest with pattern, fiddle of pair Tablespoons, Toron Ritas & Floyd SOURCE 280 Spoons &RORQLDO USA, 1995 USA, Williamsburg Williamsburg Williamsburg Williamsburg 1993 USA DC Williamsburg Williamsburg Collection Gubbins Collection Gubbins 1991 #10 1989 #8 LWKLQLWLDOV +\PDQ&ROOHFWLRQ±&RORQLDO , fiddle pattern pattern , fiddle p145 Luddington 3HUWK +DVKVSRRQRDUSDWWHUQZLWKDFUHVW +\PDQ&ROOHFWLRQ± 3HUWK +DVKVSRRQILGGOHSDWWHUQ +\PDQ&ROOHFWLRQ±&RORQLDO Assayed in Edinburgh Assayed in Edinburgh YEAR MAKER DESCRIPTION 1815/16 LOCATION available Not Edinburgh "AH" initials script with pattern, King's Tablespoons, NC Raleigh Emporium, Antique SOURCE 1815/16 I Keay Robert 1816/17 I Keay Robert 1816/17 Daglish Charles 1817/18 1818/19 Edinburgh Russell & Mitchell Watson by Glasgow retailed pattern, fiddle 3, spoons, Salt Dalgleish Charles -RKQ+HURQ Edinburgh no details spoon, Hash details no spoon, Salt 3DLVOH\ +DVKVSRRQVKHOOILGGOHSDWWHUQZ Washington Antiques, Getz M 1991 Podner & Perdue Collection Swan Maple The 1820 ca 1820 ca McQueen John 1820 ca Banff Burgess Adam 1820 ca Stewart Alexander Spoons Dumfries 1820 ca Inverness pattern English Old Spoon, Jamieson William 1820 ca no details 6, Tablespoons, Aberdeen 1820/21 Gray David details no spoon, Serving 1820/21 Dalgleish Charles Howden Francis Edinburgh Dumfries no details spoon, Mustard Edinburgh pattern fiddle spoon, Hash no details spoon, Hash p145 Luddington August Gleneagles Sothebys April House Hopetoun Sothebys Collection Swan Maple The 1993 NY Shrubsole, 1993 USA VT Antiques Gebelein 281 Compendium of Scottish Silver DC USA, 1993 USA, DC 1993 1988 #11 1993 1988 #20 1992 USA DC pattern pattern Washington Antiques, Getz M Paisley Paisley details no 2, Teaspoon, USA SC Charleston, E Austin Assayed Glasgow YEAR MAKER DESCRIPTION 1820/21 LOCATION 1821/22 Dalgleish Charles 1823/24 Fenwick George Edinburgh Son & Mitchell no details 6, of set Teaspoons, Edinburgh details no 2, spoons, Mustard Glasgow pattern fiddle spoon, Serving SOURCE Collection Swan Maple The Collection Swan Maple The Washington Antiques, Getz M 1823/24 William Hannay Hannay 1823/24 William 1823/24 1824/25 Son & Marshall 1824/25 AW Edinburgh 1824/25 available Not long 5 3/8" crest, plow with pattern, fiddle Teaspoon, S & M 1824/25 Edinburgh PG 1825/26 no details spoon, Mustard Cunningham P & Glasgow W 1826/27 Edinburgh no details spoon, Hash Collection Phoenix The 1826/27 no details Spoon, Son & Gray Robert no details 6, Teaspoons, Edinburgh Edinburgh 1827/28 AW pattern fiddle spoon, Serving 1827/28 pattern fiddle 6 Teaspoons, AW R W 1828/29 1828/29 Edinburgh Aiken Peter Edinburgh AM over WM pattern fiddle pair, spoons, Serving Glasgow details no Glasgow spoon, Salt Edinburgh Collection King's Swan spoon, Maple The Salt no details Teaspoon, motto and crest pattern, King's spoon, Mustard 1993 USA VT Gebelein, April House Hopetoun Sothebys USA NY Center, Park Hyde April House Hopetoun Sothebys 1993 USA VA Fox, Scarlet 1992 USA NY Wyler, S 1994 Canada Toronto Gordin V Collection Swan Maple The 1992 USA VA Queen, Silver 282 Spoons 1993 #8 1993 #8 DC USA 1993 USA DC 1998 USA 1993 #6 1016 MEQ 1993 USA NY Syracuse 's pattern pattern 's Washington, Antiques, Getz M Edinburgh Edinburgh long 3/8" 5 pattern, fiddle 5 Teaspoons, 1992 Show NY Ithaca, Alexander Edmonston YEAR MAKER DESCRIPTION 1830 ca LOCATION Jamieson William Aberdeen "D" initial with pattern, fiddle spoon, Dessert August Gleneagles Sothebys SOURCE 1830 ca 1830 ca 1830/31 Gray David or Elder Adam Dumfries pattern fiddle 6 Teaspoons, 1993 USA VA Plus, Silver 1830/31 1830/31 DE 1830/31 Naysmith James 1834/35 McKay James Edinburgh 1835/36 Mildridge John spoon Tea caddy Edinburgh Edinburgh McKay James Glasgow long 3/8" 5 pattern, details no fiddle Teaspoon, pair, Tablespoons, Edinburgh no details 6, Teaspoon, King spoon, Salt 1994 Show NY Ithaca, Collection Swan Maple The 1994 USA CT House, Hobart 1993 USA VA Plus, Silver 1835/36 WR 1837/38 Aiken Peter 1840 ca 1850/51 MacKay Glasgow Glasgow Robb Charles 1856/57 no details spoon, Mustard details no sifter, Sugar JL Elgin Edinburgh 1858/59 1866/67 3 of set spoons, Dessert Son & Robb Charles Edinburgh "HR" probably monogram pattern, fiddle spoon, Serving JW ½" 5 12, of set Teaspoons, Glasgow pattern shell 6 spoons, Dessert Edinburgh Collection Phoenix The pattern King's 6, Teaspoons, TX Antonio, San Mall Antique August Gleneagles Sothebys Scotland of Museums National Collection Phoenix The Show, Antique City Salt 1993 USA VA Plus Silver 283 Compendium of Scottish Silver 284 Sugar Tongs SugarSUGAR TONGSTongs Plate 31. Three Sugar Tongs Left – 1790ca by Peter Mathie, Edinburgh; Center – 1800ca by James Erskine, Aberdeen; Right – 1790ca by PH, Paisley Courtesy of The Phoenix Collection. Photograph by Janice M Dietert 285 Compendium of Scottish Silver on L1980.6 L1980.6 1991 1993 1992 1995 USA 200 p90 details details Scotland of Museums National SUGAR TONGS YEAR MAKER DESCRIPTION LOCATION SOURCE 1800 ca 1800 ca 1800 ca Hannay William PH Paisley details no tongs, Sugar Paisley no details tongs, Sugar 1991 USA CT Bernfelds 1991 USA VT Gebelein, 1745 ca 1745 ca Ker James Edinburgh no tongs, Sugar 1800 ca 1800 ca 1800 ca IM Hannay William Paisley Edinburgh long 6" "J", initial script nips, shell and reeding with plain tongs, Sugar long ½" 5 plain, tongs, Sugar Collecti Phoenix The Collection Phoenix The 1760/61 1780 ca Aitchison Alexander Edinburgh available Not 1783/84 no details tongs, Sugar Dempster James 1785 ca Edinburgh Cornfute James 1790 ca grips shell engraved, tongs, Sugar 1790 ca Perth Robertson Patrick grips spoon tongs, Sugar 1790 ca Mathie Peter Edinburgh Ziegler Alexander cut bright tongs, Sugar no details tongs, Sugar 1790 ca Edinburgh Edinburgh 1790 ca PH cut bright tongs, Sugar cut bright tongs, Sugar 1790 ca Mathie Peter 1795 ca Ziegler Alexander 548 p Marks Jackson Edinburgh Livingstone Edward Edinburgh Paisley Dundee USA SC Charleston, E Austin, nips shell side, each on cartouche vacant with "WJE" cut, initials bright the tongs, Sugar with cut, bright pattern, bulge tongs, Sugar 1.6oz long long, ¾" 5 5 5/8" bowl, decoration, fluted cut bright shaped tongs, tongs, Sugar Sugar Collection Phoenix The USA SC Charleston, E Austin, Collection Private USA SC Charleston, E Austin, 1991 NY Shrubsole, Winter Catalog Shaw Nicholas 1993 USA CT Toby's, NC Raleigh, Emporium Antique Collection Phoenix The 286 Sugar Tongs ter ter Winter lection lection 2001 p82 2001 p82 Winter Catalog Shaw Nicholas 2001 p82 2001 p82 2001 p82 The Phoenix Collection Collection Phoenix The MEQ 646 Nicholas Shaw Catalog Winter Winter Catalog Shaw Nicholas 2001 p82 The Phoenix Collection Collection Phoenix The 2001 p82 82 2001 p 1945.40 1945.40 MEQ 722 1964.1882 1964.1882 722 MEQ ORQJ 7RE\¶V&786$ no details details no Scotland of Museums National 1.8oz 1.8oz and motto "Per Actum intentio", for Urquhart, 6" long long 6" Urquhart, for intentio", Actum "Per motto and ORQJR] Edinburgh Edinburgh details no tongs, Sugar Scotland of Museums National Simpson Simpson 1820 ca 1820 ca Cameron Alexander Dundee long, ¼" 6 "D", initial the with engraved plain, pattern, fiddle tongs, Sugar 1820 ca 1820 ca Murray Charles Perth 2.5oz long, ¼" 6 MS", to "MA initials engraved bowl, fluted tongs, Sugar Win Catalog Nicholas Shaw 1820 ca 1820 ca Gray David Dumphries 1.6oz long, ½" 5 "D", initial the with engraved pattern, fiddle tongs, Sugar Catalog Nicholas Shaw 1818/19 Henderson Alexander Edinburgh head crest boar's "Elness", a banner in nips, shell rounded with tongs Sugar 1817/18 Charles Dalgleish Edinburgh Sugar tongs, 1810 ca Sugar Edinburgh Dalgleish McKay James 1817/18 Charles Edinburgh grips shell with plain tongs, Sugar USA SC Charleston, E Austin, 1805 ca 1805 ca I Keay Robert 1805 ca & Erskine James Perth 1808/09 Cunningham Aberdeen 1.4oz long, 5" bowl, fluted with pattern, fiddle tongs, Sugar long, 1.6oz ¾" 5 "D", initial with engraved plain, tongs, Sugar Winter Catalog Shaw Nicholas Winter Catalog Nicholas Shaw 1810 ca 1810 ca Hannay William Paisley ¾" 5 "WJA", initials engraved bowl, fluted with border, reeded tongs, Sugar YEAR MAKER DESCRIPTION 1800 ca LOCATION 1800 ca IM * G A Edinburgh Edinburgh no details tongs, Sugar details no tongs, Sugar SOURCE 1992 USA NY Delmar, Scotland of Museums National 1800 ca 1800 ca Erskine James -2VFULSW Aberdeen cartouche oval an in "D" initial script with decoration, cut bright tongs, Sugar Col Phoenix The (GLQEXUJK 6XJDUWRQJVSODLQZLWKVKHOOQLSV 287 Compendium of Scottish Silver ational Museums of Scotland Scotland of Museums ational MEQ 837 1993 MEQ 713 1964.1851 1964.1851 713 MEQ 1969.1820 749 MEQ Nicholas Shaw Catalog Winter Winter Catalog Shaw Nicholas 2000 p90 MEQ 646 Spencer Marks Antiques, MA #277 2006 Item USA Nicholas Shaw Catalog Winter Winter Catalog Shaw Nicholas 2000 p90 2000 p90 2000 p90 2001 p82 no details details no Scotland of Museums National 1.3oz 1.3oz long, 1.5oz 1.5oz long, long, 1.5oz 1.5oz long, amieson amieson Aberdeen details no tongs, Sugar Scotland of Museums National 1867/68 JW Edinburgh pattern King's tongs, Sugar USA SC Charleston, E Austin, 1848/49 J RG 1854/55 George Edinburgh details no tongs, Sugar Scotland of Museums National 1846/47 Son JMK & Edinburgh no details tongs, Sugar N 1838/39 Mollison & Emslie Aberdeen long, 5 7/8" "H", initial the with engraved plain, pattern, fiddle tongs, Sugar 1833/34 Douglas James Edinburgh tongs, Sugar 1831/32 TK Glasgow ¾" 5 "GB", monogram nips, script shell with pattern, fiddle tongs, Sugar YEAR MAKER DESCRIPTION 1820 ca LOCATION Booth George Aberdeen 1.3oz long, 6" plain, pattern, fiddle tongs, Sugar SOURCE Winter Catalog Shaw Nicholas 1823/24 1825 ca JM Sellar John 1825 ca Whitecross William Aberdeen Wick Glasgow 7/8" 5 "JW", initials the with engraved plain, pattern, fiddle tongs, Sugar shells wavy tongs, Sugar 1.9oz long, ¼" 6 plain, pattern, fiddle tongs, Sugar Winter Catalog Shaw Nicholas 1993 USA NY Shrubsole 288 Sugar Tongs MEQ 808 1965.1879 1965.1879 808 MEQ MEQ 1059 1059 MEQ Silver Plus Antiques, Central Central Antiques, Plus Silver 1992 USA CT Village, MEQ 717 1141 MEQ 1570 MEQ MEQ 1969.5 1969.5 MEQ 1067 MEQ MEQ 621 1962.1029 1962.1029 621 MEQ # 100 1991 Finlay MEQ 1037 Archibald C. Campbell, Bart. Bart. Campbell, C. Archibald Scotland of Museums National no details details no Scotland of Museums National inkstand inkstand Scotland of Museums National mounted foot), inverted funnel, ½" 3 foot X ½" below 5 ht, shell ½" 4 bowl, single hallmarked, silver fully handle shell, the on INK POTS AND STANDS INK POTS section with crest a of catand themotto "Touch NOT theCAT BOT A Glove" for McPherson and others Edinburgh Edinburgh each nozzle, sander small top, flat with body cylindrical sander, and pot Ink Edinburgh stand and holder Ink Scotland of Museums National William Dempster Dempster William William Davie or or Davie William Dempster William 1898/99 Hamilton & Inches Edinburgh Enameled Enameled Edinburgh Inches & 1898/99 Hamilton 1837/38 Whittet & Robb 1843/44 Edinburgh Marshall William 1851/52 stone curling a from made Inkstand, Edinburgh Marshall William 1882/83 details no Inkstand, Edinburgh Co & Crichton H details no Inkstand, Edinburgh Sir to presented Inkstand, Scotland of Museums National Scotland of Museums National Scotland of Museums National 1813/14 Fenwick George 1820/21 Edinburgh McKay James details no Inkstand, Edinburgh handle, lid, (silver inkpot glass mounted silver with like, shell Inkstand, Scotland of Museums National 1742/43 Gordon Robert Edinburgh members 3 with decoration, rococo Inkstand, Scotland of Museums National 1785/86 script or Davie William 1785/86 WD 1807/08 George Fenwick Edinburgh Ink holder, holder, Fenwick Ink Edinburgh 1807/08 George YEAR MAKER DESCRIPTION LOCATION SOURCE 289 Compendium of Scottish Silver DAG011209 DAG011209 Galleries AB Galleries in 2005 acquired Nicholas Shaw Catalog 2005 2005 Catalog Shaw Nicholas p106 MEQ 808 nd, no details details no nd, Scotland of Museums National Inkwell, double, no details no details double, Inkwell, and Museums Aberdeen Arms of the Royal Scots Greys, 11 5/8" di, 29oz Assayed Edinburgh 1973/74 Michael Rowe Rowe 1973/74 Michael YEAR MAKER DESCRIPTION 1903/04 LOCATION Chisholm & MacKay Edinburgh inksta Enameled SOURCE 1906/07 Inches & Hamilton Edinburgh bottle, glass cut mounted silver center edge, gadrooned circular, Inkstand, 290 Glossary BRIEF GLOSSARY AND EXPLANATIONS To aid the reader, a brief glossary of terms found in the compendium and related sources are provided along with explanations for some maker assignments within this book. For a far more FRPSUHKHQVLYHGHILQLWLRQRIWHUPVZHZRXOGUHIHUWKHUHDGHUWR0LFKDHO&OD\WRQ¶V'LFWLRQDU\RI the Silver and Gold of Great Britain and North America. (see Works Cited). Acanthus = a leafy plant used as a model for some stylized decoration Adam-style = following the architectural designs of Robert Adam, the important 18th century Scottish architect. Argyll = a container with a heat preserving component (hot water jacket or a heated bar of iron) to enable gravy to stay warm. Assay master = the goldsmith entrusted by the Incorporation with certifying the standard of wares wrought by the freemen. Prior to 1681, the elected deacon in Edinburgh also performed the function of assay master. The elected posts were separated in 1681 but the DVVD\PDVWHUFRQWLQXHGWRXVHKLVPDNHU¶VPDUNSXQFKIRUFHUWLILFDWLRQXQWLOWKHDGYHQWRIWKH thistle mark in 1759. The Scottish standard for silver was not the same as English sterling for much of the 18th century and earlier. Ashet = an oval meat dish; the term is frequently used in Scotland and is derived from French. Bale (or bail) = a swing handle as on a bucket Baluster = a column or stem of small size with a shaped outline. Bannock Rack = a variant on the toast rack but with fewer especially wide dividers to accommodate Scottish bannock bread. Beaker = a tall cylindrical cup, usually of tapering-cylindrical form, without handles. Blackjack = a leather tankard or bottle, sometimes with silver mounts Bleeding Bowl = in this book a form of shallow dish or cup with a single handle (also called a porringer in some countries). Bobeche = from the French, a collar on a candlestick nozzle used to catch wax drippings Bombe = curving or bulging outward. Based on French and used extensively in furniture designs. This form would contrast with the inverted pear or baluster descriptions in that the bulge is usually dramatic but following a smooth line. Cabriole = resembling the leg of a capering (e.g. goat) animal. It is a leg that curves outward at the knee and then narrows downward ending is an ornamental foot. The term and use was SURPLQHQWLQ7KRPDV&KLSSHQGDOH¶VIXUQLWXUHGHVLJQV xxiii545xxi Compendium of Scottish Silver Campana = the shape of a bell. Canted corners = corners having slanted or oblique surfaces. Canteen = a container usually with cutlery, spice containers and a cup or beaker for use when traveling. Capped = sitting atop, as in a stylized leaf sitting atop a handle on a mug, (i.e. leaf-capped.) Capstan = the shape of a vertical spool-shaped cylinder used on docks for securing boats Caryatid = usually a supporting column that takes the form of a draped female figure. Cartouche = an oval shaped decorated element usually engraved or as an applied plaque. Its function was usually to permit owner designations. It is either vacant or containing heraldic elements or initials. Caster = a tall, narrow covered container for sugar and spices. They may have pierced covers or be blind (not pierced, but sometimes engraved to match the pierced design on others). Casting = made involving a mold usually created in wood, metal or wax. Examples of casting would include spouts on teapots and some candlesticks. Exceptional Scottish casting required a different set of expertise from that of raising spoons, etc. Therefore, examples of cast Scottish candlesticks are found for only an expert subset of all Scottish goldsmiths. &'OHWWHUVLQDKHDUWVKDSHGVKLHOG(GLQEXUJKPDNHU¶VPDUN 2ULJLQDOO\HDUO\th century FD &'PDUNVZHUHDWWULEXWHGVROHO\WR&KDUOHV'LFNVRQ,DJROGVPLWKLQERWK Edinburgh and Dundee. However, the recent appearance of items carrying the mark in question prior to Dickson becoming free suggests that Charles Duncan is the more likely attribution for the mark presented in Jackson. In this compendium, both names are listed in many cases where the source had attributed the piece to Dickson. This current confusion over this specific mark for Duncan vs. Dickson should be sorted out in favor of Duncan in the near future. Chamfered corners = corners given a smooth rounded or beveled shape. Chasing = the pushing of the silver surface with no removal of silver to create decorative patterns or designs. Flat chasing is performed from the front and is in low relief. In contrast, repousse chasing is done from the back where silver is pushed into raised patterns and then finished on the front Chocolate Pot = of similar form to a coffee pot but with a finial either hinged or sliding to permit ready use of a stirrer for suspending the sediment before serving Cinquefoil = an architectural design having five sides consisting of converging arcs. The origin is derived from five petaled flowers or the plant of the same name. 546xxiv Glossary Cipher = a design of interweaving letters of a monogram in an intricate manner. With many cipher engravings the letters are virtually indecipherable or coded. Hence the derivation of the term Citrine = a pale yellow type of crystallized quartz Cover = a fully detachable lift-off top usually to a two-handled cup, sugar bowl or occasionally a few teapots. Coconut Cup = a coconut shell usually mounted with silver. Coronets = coronets on Scottish silver have different distinctions depending upon the exact form of the crown. This explains references made in the descriptions to the coronet of a duke, an earl, etc. Sometimes, a specific coronet and an initial (of the last name) are sufficient to suggest a likely family of prior ownership. Coronets are of five types distinguishing the ranks of duke, marquess, earl, viscount and lord in descending order. In the peerage of Scotland ³ORUG´LVWKHFRUUHFWWLWOHIRUWKHHTXLYDOHQW(QJOLVKUDQNRI³EDURQ´ Cowrie Box = a box, in this case-silver mounted, using the shell of a specific tropical marine gastropod Cruet = a low stand with rings to hold casters, casters and bottles, bottles alone or egg cups Cut-Card Work = a late 17th early 18th century decorative procedure involving pieces of silver, sometimes decorated itself, which were then applied to the body or cover of an item via solder. In Scottish silver, the most frequently seen examples are the lobes found on thistle mugs arranged in such a way as to suggest stylized leaves. 'HDFRQ WKH'HDFRQRIWKH,QFRUSRUDWLRQRI*ROGVPLWKVLQ(GLQEXUJKZDVWKHKLJKHVWHOHFWHG position and the post was most usually held for two years in duration. Until 1681, the deacon DOVRVHUYHGDVWKHDVVD\PDVWHUDQGKLVPDNHU¶VPDUNZDVXVHGIRUFHUWLI\LQJWKDWWKH appropriate silver standard had been used in making an item. Once a goldsmith had served as Deacon he continued to be referred to as Deacon in subsequent minutes, notes and correspondence of the Incorporation. This is a practice that can lead to some confusion in the present day. Diaper-Work = a decorated usually engraved area consisting of a network of shaped geometric elements usually boxes or lozenges (sometimes with a dot in the center of each) Dirk = a particular type of Highland dagger with a long straight blade. The dirk is at least twice the length of a skene dhu, slung from a belt at the waist when wearing the kilt. Dish Cross = an X-shaped stand having a combination of four arms (usually adjustable in length) used to support a dish for serving and/or warming. Scottish examples may or may not be equipped with a central burner. Dish Ring = In Scotland, a circular open ring or shallow cone on a stand used to accommodate a circular food container such as a serving dish. It serves the same function as a dish cross. It sometimes has a fitting for a spirit burner. 547xxv Compendium of Scottish Silver Disk-end spoons = among the earliest form of Scottish spoon. The terminal is an almost complete circle joining the stem. The disk may carry decoration and/or engraving of initials or arms. Dog-nose flatware/spoons = a modification of the trefid without any notches. The center of the terminal is rounded and projecting while the shoulders are also slightly rounded. The terminal is angled upward slightly from the plane of the stem (in contrast with wavy-end flatware). The pattern was found mainly between 1690-1715 in Scotland Dolphin-handle = the famous dolphin handles applied to select Scottish cream boats, etc. of the 1740s and 50s was used by only a small cadre of Scottish goldsmiths. From close inspection of several cast forms, the figure does not resemble an actual dolphin but rather is a heraldic dolphin or stylized sea creature with mixed features derived from dolphins, eels and fish. The earliest use recorded to date is 1743/44 WD mm for either William Dempster or William Davie. Double-scroll = two connected scrolls, as used in forming a handle, with the second curved at a different angle from the first. Dredger = a container with a perforated cover for sifting through flour or other materials. Edinburgh Silver post 1783 = Since Scottish silver was supposed to be assayed in Edinburgh and duty paid from 1784-, many provincial goldsmiths made work carrying Edinburgh marks, particularly between 1784 and the opening of the Glasgow assay office in 1819. Therefore, any pieces falling in this interval should be viewed as potentially crafted by goldsmiths based anywhere in Scotland and not necessarily the output of an Edinburgh goldsmith. Engraving = design created by removing silver from the surface. Engraving was used in Scotland for including armorials, initials and also for other decorations. Bright cut-engraving is seen from about 1775 on and is created by using contrasting depths and angles of the cut. Epergne = usually a centerpiece with a large central bowl and several smaller bowls distributed around the circumference: a French term Everted = turned outward Ewer = a pitcher of various shapes accompanying a basin, both were used for hand washing during meals (particularly necessary preceding the use of utensils). Faceted = having multiple flat surfaces oriented at different angles as on a cut gemstone. Fiddle pattern flatware/spoons (English) = this is the traditional flatware with the terminal half of the stem forming a slightly rounded rectangle. Slight projections can occur where this rectangle thins to the profile of the stem. Flagon = frequently these were made for secular use but then later presented by donors to churches. These usually take the form of tall, slender tankards/pitchers, often they are cylindrical and on a spreading foot 548xxvi Glossary Flange = a protruding rim or collar Festoon = a draped arrangement of flowers and fruit tied at either end and sometimes secured in the middle as well Filigree = openwork metal formed into geometric design or foliage-like ornament Finial = an element, usually architecturally-derived, placed atop covers, lids and some spoons Fluting = a series of long usually rounded grooves incised into otherwise flat surfaces, the effects resemble that of a pleated ruffle of cloth. Foliate = resembling foliage Freedom = as in Freedom Boxes. The granting of the right to become a burgess of a burgh or alternatively a freeman of an Incorporation or Guild. It could be given by town councils in gratitude or earned though apprenticeship and successful essays. Freedom Boxes were designed to hold the documents. Gadroons = probably referring to gathered-rounds, in this case decorative raised arcs of silver used in the borders of tazzas, sauceboats, and on the bases of various pieces. Girdle = in this case an applied band of silver, sometimes decorated, placed surrounding the body and used to strengthen the piece while providing decoration. Hanoverian flatware/spoons = This is a pattern common across the UK and the earliest use in Scotland was 1702/03. The pattern has an upturned mostly rounded terminal on a stem sometimes with an upper midrib. Contemporary engraving was always placed on the terminal reverse. +DVK6SRRQ KHUHDODUJHVHUYLQJVSRRQJUHDWHUWKDQ´LQOHQJWK IB Glasgow 1707-50 mark = In this book, these marks are designated as by Johann Got-helf- Bilsings as according to Jackson. However, this maker assignment seems tenuous and is likely to be revised in the near future. The reader should approach this with caution. James Boyd became a freeman in 1707 and the earlier IB marks possibly pertain to him. ,0PDNHU¶VPDUNV(GLQEXUJK %DVHGRQWKHPRVWUHFHQWLQIRUPDWLRQDWSUHVVWLPH designation for the mark IM with a figure between has been given to James Mitchell. Pieces previously attributed to John Main have been assigned to James Mitchelson in this compendium. Pieces carrying the mark, IM in an engrailed rectangle, are listed as by either James McKenzie I or James Mitchelson. (see Silver Studies 2006 for more detail). Knop = a decorative knob such as those found on the stems of some communion cups and candlesticks or on the tops of handles of some early Scottish two-handled cups. Lattice (or Trellis) work = a framework of regularly overlaid lines. Leith Race Prizes = The Leith Race was an annual horserace where prizes were awarded. The FRQWUDFWIRUSURGXFLQJWKHSUL]HXVXDOO\ZHQWWRWKH'HDFRQRIWKH(GLQEXUJK,QFRUSRUDWLRQRI xxvii549 Compendium of Scottish Silver Goldsmiths. The gold teapots by James Ker are examples of Leith prizes. Regrettably, only a small proportion of those that were made have survived. Lid = a top to items such as a teapot, tankard or jug, that is not designed to detach completely and is hinged either via a flush hinge or through an applied hinge. Lozenge = a heraldic device in a diamond-like shape. /XJ OLWHUDOO\³HDU´WKH6FRWWLVKZRUGIRUDVPDOOKDQGOHDVRQDTXDLFKSLJJLQHWF Maker vs. Deacon = For pre-1681 Edinburgh silver where the elected deacon served as the assay master, it is not always possible to determine with certainty which punch is that of the maker of a piece and which is by the deacon at the time of assay. Because of this, the same piece may appear to have different makers as described in different catalogs. A famous example is the set of trefid spoons carrying the marks of Edward Cleghorne I and Alexander Reid. We have attempted to use the most recent designations based on style and other considerations. %XWWKHVHVWLOOODFNFRPSOHWHFHUWDLQW\8VXDOO\WKHPDNHU¶VPDUNLVRQWKHOHIWRIWKHFDVWOH DQGWKHGHDFRQ¶VPDUNRQWKHULJKWEXWWKLVPHWKRGRILGHQWLILFDWLRQEUHDNVGRZQZKHQPDUNV are struck vertically on spoons, etc. 0DUURZ6SRRQ DVSRRQWKDWKDVWKHVWHPLQFRUSRUDWLQJDPDUURZVFRRS Mazer = a shallow, broad bowl, often wooden, on a single foot that can range from a low rim to a WDOOHUSHGHVWDO IRU³VWDQGLQJPD]HUV´ 0RQWHLWK DERZOXVXDOO\DSXQFKERZOZLWKDQRWFKHGULP VRPHWLPHVGHWDFKDEOH QDPHG DIWHUD6FRWVPDQZKRVHFORDNVZHUHQRWFKHGDWWKHERWWRP Muffineer = a container with a perforated cover for applying sugar to breads, etc. Nozzle = also called a socket. The top part of the candlestick into which the candle is inserted. 6RPHWLPHVWKHVHDUHPDGHWREHGHWDFKDEOH Octagonal hollowware = silver items with eight-sided finished surfaces Employed in the early 18thFHQWXU\E\RQO\WKHPRUHH[SHUW6FRWWLVKJROGVPLWKV Old English flatware/spoons = a modification of the Hanoverian pattern where the terminal FXUYHVGRZQZDUGVDQGXVXDOO\ZLWKDVPRRWKVWHPDQGQRPLGULE6HHSRLQWHG2OG(QJOLVK IRUDFRPPRQ6FRWWLVKYDULDQW 3DS%RDW DVKDOORZERZOXVHGIRUIHHGLQJ,WLVVKDSHGOLNHWKHWRSRID6FRWWLVKFUHDPERDWEXW without a foot or handle. 3DWHQ DFRYHUIRUDFRPPXQLRQFXS6RPHWLPHVLWLVQRWHDVLO\GLVWLQJXLVKDEOHIURPDVPDOO WD]]D&RPPXQLRQFXSVRIWKH&KXUFKRI6FRWODQGQHYHUKDYHSDWHQV3DWHQVJRZLWKFKDOLFHV and are used by the Catholic Church but they have no foot. Patens in the Episcopal Church of 6FRWODQGPLJKWRFFDVLRQDOO\KDYHDIRRWOLNHDWD]]DEXWDUHQRUPDOO\MXVWDVKDOORZGLVK ZLWKRXWDIRRW6FRWWLVKSDWHQVLIDQ\6FRWWLVKPDGHRQHVUHDOO\H[LVWEHIRUHWKHODWHUth century, are extraordinarily rare. 550xxviii Glossary Piggin = A piggin is a miniature stave-built pail, with one of the staves rising above the rest to form a single vertical lug. This shape was occasionally copied in silver. Pointed Old English = the variant derived from the Old English flatware (i.e. a down-turned rounded end on spoon terminals) pattern using a pointed rather than a rounded terminal. It was made mainly in Scotland, Ireland and by Scottish or Irish craftsman in the colonies. It has been called by a variety of names over the years. It has nothing whatsoever to do with being Celtic. Points = repeating projections within the wavy borders of bowls, salvers and teapot stands. These may be enumerated as one means of distinguishing among otherwise identical pieces. 7KHQXPEHURI³SRLQWV´RQDVWDQGLVXVXDOO\PRUHWKDQWKHQXPEHURISRLQWVRQDVXJDU bowl within the same set. Porringers = In this compendium, a form of two handled cups that are usually shallow, wide and bulbous near the base. Here it is distinguished from a bleeding bowl that has only one handle. 3XQFK%RZO LQWKLVERRNDERZORI´RUODUJHULQGLDPHWHU Puritan spoons = modified from earlier slip-top spoons. The stem is not flat but rather largely square like a plank of wood. These spoons have essentially no special terminal beyond a cut made at right angles. Quaich = a two-lugged shallow bowl. The earliest were originally made of wood. Many silver H[DPSOHV DWWHPSWWRVLPXODWHWKHZRRGHQVHFWLRQVE\HQJUDYLQJVWDYHOLQHV Reeded = having a series of parallel incised lines. Repousse = a technique of hammering designs in relief from the reverse side of metal. Reticulated = a series of lines forming a net, mesh or network. Riband = a ribbon used for decoration or to contain a motto. Rocaille = decorative rococo work emphasizing shells and scrolls. Originally it meant artificial rock-work and this gradually slid into scrollwork. In contrast with rococo work, rocaille does not necessarily have to be asymmetrical. Rococo = an ornate decorative style with intricate work of flowers, shells and scrolls. The defining element of rococo is that it is asymmetrical. Roundels = a series of round panels. 6DOWLUH $6W$QGUHZ¶V&URVVLQWKHVKDSHRIDQ; 6DOYHU LQWKLVERRNDWUD\RQWKUHHRUPRUHIHHWRIJUHDWHUWKDQò´LQGLDPHWHU Sander = a container, usually part of the 18th century writing implements set, with perforations in the cover to apply drying sand to documents just completed using ink. The sand aided in the drying process by stabilizing the ink on the document. xxix551 Compendium of Scottish Silver Sauceboats = this term for a handled sauce container of boat shape is somewhat confused with cream boats in 18thFHQWXU\6FRWODQG:HKDYHUHVHUYHGWKH³VDXFHERDW´WHUPJHQHUDOO\IRU HDUO\GRXEOHOLSSHGKDQGOHGERDWVDQGIRUODWHUERDWVRIODUJHUVL]HDQGGHHSHUVKDSHWKDQ WKRVHXVHGIRUFUHDP0DQ\ERDWVRIWKHVDQGHDUO\VWHUPHGVDXFHERDWVLQFDWDORJV were of a form described as cream boats in contemporary accounts. 6FDOORSHG KDYLQJFXUYHGSURMHFWLRQVIRUPLQJDQRUQDPHQWDOERUGHU'HULYHGIURPWKHPDULQH mollusk shell patterns. In this book, it is also used to describe the pie-crust-like borders on salts, etc. 6FRQFH SURWUXGLQJWRSSDUWRIDFDQGOHVWLFN VRPHWLPHVGHWDFKDEOH XVHGWRSUHYHQWZD[IURP GULSSLQJRQVXUIDFHVEHORZ 6FRWV)LGGOHSDWWHUQIODWZDUHVSRRQV GLIIHUHQWIURPWKHWUDGLWLRQ(QJOLVKILGGOHSDWWHUQ6FRWV fiddle is a pattern found mainly from 18th century Scotland. It is a modified Hanoverian ZKHUHWKHVWHPKDVWZRSURQRXQFHGEXOJHVZLWKWKHRXWOLQHUHVHPEOLQJWKHERG\RIDILGGOHRU YLROLQ7KHVHLWHPVZHUHXVXDOO\ZLWKPDNHU¶VPDUNRQO\7KHGHVLJQRYHUODSVZLWKVW\OHV VHHQLQ'HQPDUNDQGWKH1RUVHFRXQWULHV6FRWVILGGOHVXVXDOO\GDWHIURPFDFD 6FRWWLVKFUHVWVDQGPRWWRV XQOLNHIDPLOLHVLQ(QJODQGDQG,UHODQGZKHUHWKHPRWWRVZHUH placed beneath the crest, Scottish family mottos are usually seen on ribbons draped across the WRSRIFUHVWV$VDUHVXOWWKHYDVWPDMRULW\RIDUPRULDOVLOYHULQWKLVOLVWLQJZRXOGH[KLELW mottos placed above the crest. This helps readily identify pieces as previously Scottish owned. However, the maker of Scottish owned pieces may or may not be a Scottish JROGVPLWK/RQGRQPDGHVLOYHUZDVDOVRSXUFKDVHGE\6FRWWLVKSDWURQV6FRWWLVKPRWWRVDUH PRVWIUHTXHQWO\VHHQLQ/DWLQRU(QJOLVKEXWVRPHH[DPSOHVRI)UHQFKDQG6FRWVPRWWRVDOVR H[LVW7KHFRPELQDWLRQRIDVSHFLILFFUHVW XVXDOO\VKDUHGE\RQO\DIHZIDPLOLHV DQGPRWWR XVXDOO\VKDUHGE\DVPDOODQGRYHUODSSLQJVXEVHWRIIDPLOLHV LVDSRZHUIXOWRROLQLGHQWLI\LQJ WKHVLQJOH6FRWWLVKIDPLO\WKDWSUHYLRXVO\RZQHGDSLHFHRIVLOYHU3URYHQDQFHIRUPDQ\RIWKH VLOYHULWHPVLQWKLVOLVWLQJKDYHEHHQQDUURZHGWRDVLQJOHIDPLO\$QH[DPSOHRIDPRWWRLQ Scots is Quhidder will zieZLWKDXQLFRUQ¶VKHDGSHUWDLQLQJWRVHYHUDOIDPLOLHVRIWKH6WHZDUWV of Appin. 6FUDWFKZHLJKW WKHZHLJKWRIDQREMHFWDVGHVLJQDWHGWKURXJKXVXDOO\OLJKW³VFUDWFKHG´ HQJUDYLQJE\WKHJROGVPLWK6FUDWFKZHLJKWVDUHXVXDOO\SODFHGLQLQFRQVSLFXRXVSODFHVPRVW IUHTXHQWO\DSSOLHGWRWKHERWWRPRIPRUHVLJQLILFDQWLWHPVRIVLOYHU0RGHUQZHLJKWVRIROG SLHFHVVKRXOGEHVOLJKWO\ORZHUWKDQWKHVFUDWFKZHLJKWJLYHQWKHORVVRIVLOYHURYHUWLPH WKURXJKFOHDQLQJDQGZHDU6FUDWFKZHLJKWVFDQEHXVHIXOWRGHWHUPLQHLIDQLWHPKDVEHHQ DOWHUHGIURPLWVRULJLQDOIRUPDWVRPHWLPHLQWKHSDVW Scrolls = decorative ornaments on silver and furniture that resemble, in form, partially unrolled rolls of paper 6HDO DGLHRUVLJQHWKDYLQJDUDLVHGRULPSUHVVHGV\PEROXVHGWRVWDPSWKHLPSUHVVLRQLQZD[ HWF,QWKLVFDVHXVHGWRVHDODQGHIIHFWLYHO\VLJQFRUUHVSRQGHQFH6HDOVZHUHIUHTXHQWO\ PDGHZLWKKDQGOHVRIVLOYHURUJROG6HDO%R[HVZHUHGHVLJQHGWRSURWHFWZD[VHDOV associated with important documents. 552xxx Glossary Seal-top spoons = very rare in Scotland and from the late 16th century. Unlike English seals with balustoid elements as the terminal Scottish seals may consist of a terminal formed as a simple tapering rectangular section attached to the stem. 6HUYLQJ6SRRQ LQWKLVERRNDODUJHVSRRQXVXDOO\EHWZHHQ´LQOHQJWK Silver Handles = It should be noted that silver handles on tea service items were not common in England or Ireland but were prominent in Scotland from 1720-50. Therefore, the descriptions indicate silver or wooden handles when the information was available. 6NHQH'KX PHDQLQJ³EODFNNQLIH´$ERXWKDOIWKHOHQJWKRIDGLUNDVNHQHGKXLVDVPDOO sheathed knife worn in the top of the right stocking when wearing the kilt. Slip-top spoons = 17th century spoons similar to Puritan except that the end is cut at a severe angle (said to be slipped) rather than at a right angle. Slop Bowl = a bowl used for disposal of used tea leaves or coffee sediment, usually broad and shallow compared with a sugar bowl. However, the distinction between slop and sugar bowls is not always clear. Snuff Mull = a vertical snuff container usually of baluster form rather than a horizontal box. They may be all silver or simply silver-mounted. Snuffer = usually a bell or cup shaped implement on a handle used to cover and extinguish the flame on a lighted candle or spirit lamp. Socket = also called nozzle. The hollow upper part of a candlestick into which the candle is fitted. Sometimes sockets are made to be detachable. Spherical = round, important in describing shapes of some teapots, milk jugs, covered sugars, etc. It is used here in place of the less-precise terms such as a globular and bullet. Spool = of general cylindrical shape, slightly waisted. Sporran = a Highland dress version of a leather or fur pouch worn at the front of the kilt and hung via a chain and leather strap. Frequently mounted with silver. Spume = foam on a liquid as in breaking ocean waves at the shoreline. Stands = early teapot and urn stands are usually supported on a simple rim foot contrasting with WD]]DVRQRQHSHGHVWDOIRRWRUVDOYHUVRQWKUHHRUPRUHIHHW$IWHUDERXWVSHFLDOL]HG stands became less frequent and salvers served the purpose. Stippled = having a group of dots or flecks applied via short strokes. Stirrup Cup = designed to be taken on foxhunts. It is a slender drinking cup shaped frequently OLNHDIR[¶VRUKRXQG¶VKHDG Swags = ornamental draperies resembling draped curtains. xxxi553 Compendium of Scottish Silver Tazza = a salver or shallow dish on a raised pedestal foot Thistle Mug = also called thistle cup. A relatively small mug of bell-shape with a flared rim similar to the shape of a thistle flower, usually with one or more applied girdles and frequently with several applied vertical lobes at the base simulating leaves. It may have a scrolled bead-decorated handle or a simple strap handle. It is uncommon outside of Scotland. Toilet Service = equipment needed for the dressing table usually including a mirror, comb boxes, scent bottles, pin cushion, whisk, and sometimes candlesticks or ewers and basins. Traprain silver (e.g. salts) = early 20th century reproductions of items from an ancient Roman silver hoard found on Traprain Law (hill), Scotland during quarrying activity in 1919. The firm of Brook and Son, Edinburgh, meticulously reproduced some items. The salts have a characteristic triangular shape. Tray = In this book, it usually refers to a large salver with handles. Trefid flatware/spoons = referring to a three lobed attachment or terminal as on a spoon. On a spoon this is created by flattening the upper part of the stem and using two notches two divide the terminal into three sections. When as attachments to bowls, etc the two side members are frequently described as commas. The trefid spoon terminal usually angles slightly upward form the plane of the stem. The trefid pattern was produced in Scotland mainly between 1670ca and 1710. Trefoils = decorative elements of a leaf with three parts. Taken from the Trifolium genus. Tumbler Cup = a cup without handles that tended to be broad but not deep. Sometimes these were nested when as sets. Scottish examples sometimes have slightly flared rims. Two-Handled Cups = self explanatory except that they are distinguished from porringers by being more vertical compared with the diameter. Unmarked Covers = Note that in 18th century Scotland and in contrast with London silver, the marking of covers was not common. Therefore, the descriptions lack a reference to this. Vinaigrette = a small container (sometimes worn) designed to hold a sponge soaked in perfume or alternatively vinegar for use as smelling salts. It may be of small box form or take numerous other shapes. Volute = a spiraled ornament resembling the designs found on gastropod mollusk (Volutidae family) shells (also used on Ionic capitals) :DLWHU LQWKLVERRNXVHGIRUDWUD\UHVWLQJRQWKUHHRUPRUHIHHWDQG´RUOHVVLQGLDPHWHU Warwick Cruet = a form of the cruet having the base designed with five rings. The earliest English example held five casters, however, many later examples hold two bottles and three casters. Wavy-end flatware/spoons = similar to dog-nose in that it has a rounded center projection, like a GRJ¶VVQRXWDQGWZRVOLJKWO\URXQGHGVKRXOGHUVRQWKHWHUPLQDO+RZHYHULQWKLVFDVHWKH 554xxxii Glossary end of the terminal of the spoon or fork is flat and in line with the stem. This is a largely early 18th century pattern in Scotland Wax jack = an item used to distribute sealing wax from a reel to be melted and used in sealing FRUUHVSRQGHQFH7KHPROWHQZD[ZDVWKHQVWDPSHGZLWKWKHVHQGHU¶VVHDO :'PDNHU¶VPDUNV(GLQEXUJK $WSUHVVWLPHWKHUHLVFRQVLGHUDEOHFRQIXVLRQ VXUURXQGLQJ(GLQEXUJK:'PDUNV:LOOLDP'UXPPRQGLVQRWLQFOXGHGLQWKHFRPSHQGLXP EHFDXVHKHPDGHOLWWOHLIDQ\VLOYHULQ(GLQEXUJK1XPHURXVYDULDQWVRI:'PDUNVZHUH employed between William Dempster and William Davie. The designations originally in -DFNVRQDUHQRZYLHZHGDVXQFHUWDLQDWEHVW,QPDQ\FDVHVDGHVFULSWLRQRIWKHOHWWHUV EORFN YVVFULSW LVSURYLGHGZKHUHSRVVLEOHDQGERWKPDNHUV¶QDPHVDUHOLVWHGLQPRVWFDVHV +RSHIXOO\WKLVZLOOEHUHVROYHGLQWKHQHDUIXWXUH :LOOLDP-DPLHVRQ±WKHPDNHU¶VPDUNVKRZQLQ-DFNVRQPDUNVLVUHDOO\-DPHV0LWFKHOVRQ¶V PDUNWXUQHGXSVLGHGRZQ7KHUHIRUHLWLVSUREDEO\QRW-DPLHVRQ¶VPDUNDWDOOEXWUDWKHU 0LWFKHOVRQ¶VSXQFK,QVWHDGD:,RU,0LQDSODLQRYDOVHHPVOLNHO\WREHWKHPDUNIRUHLWKHU :LOOLDP-DPLHVRQRUSRVVLEO\-RKQ0DLQ7KLVTXDQGDU\VKRXOGEHUHVROYHGLQWKHQHDU future. :LQH/DEHO DOVRFDOOHGZLQHWDJRUERWWOHWLFNHWXVXDOO\LQGLFDWLQJWKHW\SHRIZLQHRQD shaped shield or rectangle suspended around a bottle or decanted via a silver chain. Wire and Wire work = Wire is created by drawing malleable silver through a series of smaller and smaller holes in a draw plate thereby reducing the gauge after each new pass and also VWUHQJWKHQLQJWKHVLOYHUZLWKHDFKKDUGHQLQJ7KHUHVXOWLQJVWULQJPD\EHURXQGVTXDUHRU PXOWLVLGHGDQGFDQEHXVHGDVDPRXWKZLUHWRIRUWLI\DERZOHWFULPRULWPD\EHWZLVWHGIRU use in decorative filigree work. xxxiii555 Compendium of Scottish Silver 556xxxiv Works Cited Works Cited ARTICLES Fell, H. G. “Scottish Silver at Stratton Street” [Messr. How of Edinburgh], in Connoisseur Vol CIII February 1939 pp107, 109. [How of Edinburgh 1939] Jones, Alfred E. “Some Old Scottish and English Plate of the Marquess of Linlithgow, K T” in Apollo vol XVIII September 1933 pp153-161. [Linlithgow Collection] ………………… “Binning Collection of Old English and Scottish Plate,” in Burlington Magazine, vol LXVIII March 1936 pp199-225. [Binning Collection] …………………”Collection of Plate of Sir John Stirling Maxwell, Bart. K T” in Apollo Vol XXIII April 1936 pp99-104, 207-214. [Stirling Maxwell Collection] …………………”Silver at the Exhibition of Scottish Art” in Burlington Magazine Vol LXXIV 1939 pp71-72. [Scottish Art Exhibition 1939] Oman, Charles C. “Scottish Silver at the Royal Academy” in Connoisseur vol CIII, February 1939 pp70-75. [Scottish Art Exhibition 1939] BOOKS Alcorn, Ellenor M. English Silver at the Museum of Fine Arts in Boston Volume II. MFA Publications: Boston 2000 [Alcorn, Museum of Fine Arts] Bannister, Judith. Collecting Antique Silver. Galahad Books: NY 1972. [Bannister] Brett, Vanessa. The Sotheby’s Directory of Silver 1600-1940. Sotheby’s Publications: London 1986. [Brett] Burns, Thomas. Old Scottish Communion Plate. R & R Clarke: Edinburgh 1892. [Burns] Clayton, Michael. The Collector’s Dictionary of the Silver and Gold of Great Britain and North America 2nd edition. Antique Collector’s Club: Suffolk 1985. [Clayton Dictionary] xxxv557 Compendium of Scottish Silver …………………..Christie’s Pictorial History of English and American Silver. Phaidon- Christie’s Ltd: Oxford 1985. [Clayton Christie’s Book] Connoisseur Art Sales Annual, Connoisseur London. [Connoisseur] Cripps, Wilfred Joseph. Old English Plate: Ecclesiastical, Decorative and Domestic: Its Makers and Marks. J Murray: London 1906 [Cripps] Curtis, Tony ed. The Lyle Official Antique Review 1979. Lyle Publication’s: London 1978 [Lyle Annual Review 1979] ………………….The Lyle Official Antique Review 1980. Lyle Publication’s: London 1979 [Lyle Annual Review 1980] ………………….The Lyle Official Antique Review 1981. Lyle Publication’s: London 1980 [Lyle Annual Review 1981] ………………….The Lyle Official Antique Review 1982. Lyle Publication’s: London 1981 [Lyle Annual Review 1982] ………………….The Lyle Official Antique Review 1983. Lyle Publication’s: London 1982 [Lyle Annual Review 1983] ………………….The Lyle Official Antique Review 1984. Lyle Publication’s: London 1983 [Lyle Annual Review 1984] ………………….The Lyle Official Antique Review 1994. Perigee 1993 [Lyle Annual Review 1994] ………………….The Lyle Antiques and Their Value: Silver. Voor Hoede Publications B. V.: NY 1982 [Lyle Silver Review] Dalgleish, George and Stuart Maxwell. The Lovable Craft: 1687-1987. Pinpoint Direct Marketing: Edinburgh [Dalgleish and Maxwell] Davis, John D. English Silver at Williamsburg. Colonial Williamsburg Foundation and University Press of Virginia: Charlottesville 1976. [English Silver at Williamsburg] Delieb, Eric. Investing in Silver. Clarkson N Potter: NY 1967 [Delieb] Finlay, Ian. Scottish Gold and Silver Work. Pelican Publishing Co: Gretna, LA 1991. [Finlay 1991] 558xxxvi Works Cited *ULPZDGH$UWKXU7KH4XHHQ¶V6LOYHU$6XUYH\RI+HU0DMHVW\¶V3HUVRQDO&ROOHFWLRQ. The &RQQRLVVHXU/RQGRQ >4XHHQ¶V6LOYHU@ *XWKULH'U:LOOLDP'XQGHH6LOYHU:*XWKULH3XEOLVKHU +DUNHQEURFK +D\GHQ$UWKXU&KDWVRQ2OG6LOYHU'RYHU3XEOLFDWLRQV,QF1< >+D\GHQ@ +ROODQG0DUJDUHW6LOYHU$Q,OOXVWUDWHG*XLGHWR&ROOHFWLQJ6LOYHU2FWRSXV%RRNV/WG +RQJ.RQJ >+ROODQG@ +RXDUW9LFWRU0LQLDWXUH6LOYHU7R\V$OSLQH)LQH$UWV1< >+RXDUW@ +RZ*(3DQG-DQH3+RZ(QJOLVKDQG6FRWWLVK6LOYHU6SRRQVYROXPHV +XJKHV*HRUJH%HUQDUGDQG7KHUOH+XJKHV7KUHH&HQWXULHVRI(QJOLVK'RPHVWLF6LOYHU :)XQN1< >+XJKHV@ -DFNVRQ&KDUOHV-DPHV$Q,OOXVWUDWHG+LVWRU\RI(QJOLVK3ODWHYROXPHV&RXQWU\/LIH/WG $QG%7%DWVIRUG/RQGRQ >-DFNVRQ@ -DFNVRQ&KDUOHV-DFNVRQ¶V6LOYHUDQG*ROG0DUNVHG,DQ3LFNIRUG$QWLTXH&ROOHFWRU¶V&OXE 6XIIRON >-DFNVRQ0DUNV@ -RQHV($2OG(QJOLVK*ROG3ODWH%HPURVH 6RQV/WG/RQGRQ >-RQHV@ .RYHO5DOSKDQG7HUU\.RYHO.RYHO¶V$QWLTXHVDQG&ROOHFWLEOH¶V3ULFH/LVWIRUWKH 0DUNHWthHGLWLRQ&URZQ3XEOLVKHUV1< >.RYHOV@ ««««««««««««.RYHO¶V$QWLTXHVDQG&ROOHFWLEOHV3ULFH/LVWIRUWKH 0DUNHW&URZQ3XEOLVKHUV1< >.RYHOV@ /HH*HRUJLDQDDQG5RQDOG$/HH%ULWLVK6LOYHU0RQWHLWK%RZOV,QFOXGLQJ$PHULFDQDQG (XURSHDQ([DPSOHV0DQRU+RXVH3UHVV6XUU\ >/HH0RQWHLWKV@ xxxvii559 Compendium of Scottish Silver Luddington, John. Starting to Collect Silver$QWLTXH&ROOHFWRU¶V&OXE6XIIRON [Luddington] 3LFNIRUG,DQ6LOYHU)ODWZDUH(QJOLVK,ULVKDQG6FRWWLVK$QWLTXH&ROOHFWRU¶V &OXE6XIIRON >3LFNIRUG6SRRQV@ 5DELQRYLWFK%HQWRQ6H\PRXU$QWLTXH6LOYHU6HUYHUVIRUWKH'LQLQJ7DEOH6W\OH)XQFWLRQ )RRGDQG6RFLDO+LVWRU\-RVOLQ+DOO3XEOLVKLQJ&RQFRUG0$ >5DELQRYLWFK@ 5LQNHU+DUU\/HG:DUPDQ¶V$QWLTXHVDQG7KHLU3ULFHVth edition.UDXVH3XEOLFDWLRQV ,ROD:, >:DUPDQV@ 7LFKHU.XUW,ULVK6LOYHULQWKH5RFRFR3HULRG,ULVK8QLYHUVLW\3UHVV6KDQQRQ >7LFKHU,ULVK6LOYHU@ :DOGHQ0DXUJKHULWD+RZDUGGH4XHHQ&KDUORWWH¶V/RDQ([KLELWLRQRI2OG6LOYHU0D\VW -XQHth6HDIRUG+RXVH%HOJUDYH6TXDUH/RQGRQ7KH6DLQW&DWKHULQH3UHVV5R\DO /RQGRQ >4XHHQ¶V([KLELWLRQ@ :DOGURQ3HWHU7KH3ULFH*XLGHWR$QWLTXH6LOYHUnd edition$QWLTXH&ROOHFWRU¶V&OXE 6XIIRON >:DOGURQ@ :DUN%HWK&DUYHU(QJOLVK,ULVKDQG6FRWWLVK6LOYHUDWWKH6WLUOLQJDQG)UDQFLQH&ODUN$UW ,QVWLWXWH+XGVRQ+LOOV3UHVV1< >:HHV&ODUN$UW,QVWLWXWH@ :LOOV*HRIIUH\&DQGOHVWLFNV&13RWWHU1< >:LOOV&DQGOHVWLFNV@ &$7$/2*6 %RQKDP¶V6DOHV&DWDORJV >%RQKDPV@ %UHDGDOEDQH&ROOHFWLRQRI6LOYHUVPLWK¶V:RUN7KH'RZHOO/WG6DOH&DWDORJ0D\ (GLQEXUJK >%UHDGDOEDQH&ROOHFWLRQ6DOH@ &DWDORJRI([KLELWLRQRI6FRWWLVK6LOYHU5R\DO6FRWWLVK0XVHXP$XJXVW±6HSWHPEHU >5R\DO6FRWWLVK0XVHXP([KLELWLRQ@ &DWDORJRI+LJKO\,PSRUWDQW(QJOLVK6FRWWLVKDQG&RQWLQHQWDO6LOYHUWKH3URSHUW\RI+LV*UDFH 7KH'XNHRI%XFFOHXFK«DQGWKH+RSHWRXQ(VWDWHV&RPSDQ\6RWKHE\¶V6DOHV&DWDORJ 560xxxviii Works Cited 25 July 1953 [Hopetoun Silver] &KULVWLH¶V$UW7UHDVXUHV([KLELWLRQ&DWDORJ >$UW7UHDVXUHV([KLELWLRQ@ &KULVWLH¶V,QWHUQDWLRQDO6DOHV&DWDORJV [Christies] ([KLELWLRQRI6FRWWLVK6LOYHUIURPWKH&ROOHFWLRQRI-RKQ1REOH&KDLUPDQRIWKH6FRWWLVK&UDIW &HQWHU$XJXVW±6HSWHPEHU >1REOH&ROOHFWLRQ@ *ODVJRZ(PSLUH([KLELWLRQ0D\2FWREHU2OG6FRWWLVK6LOYHU&DWDORJXHRI/RDQ &ROOHFWLRQLQ6FRWWLVK+LVWRULFDO3DYLOLRQ7KH6FRWWLVK&RPPLWWHH >*ODVJRZ(PSLUH([KLELWLRQ@ +RZRI(GLQEXUJK/WG6LOYHU([KLELWLRQDW6WUDWWRQ6WUHHW/RQGRQ: 1936 >+RZRI(GLQEXUJK@ +RZRI(GLQEXUJK/WG6LOYHU([KLELWLRQDW6WUDWWRQ6WUHHW/RQGRQ: 1937 >+RZRI(GLQEXUJK@ -+%RXUGRQ6PLWK&DWDORJV/RQGRQ >-%RXUGRQ6PLWK&DWDORJ@ /RDQ([KLELWLRQRI2OG(QJOLVK3ODWH3DUN/DQH/RQGRQ >3DUN/RQGRQ([KLELWLRQ@ 1LFKRODV6KDZ&DWDORJV >1LFKRODV6KDZ&DWDORJ@ 3DODFHRI+LVWRU\6FRWWLVK([KLELWLRQRI1DWXUDO+LVWRU\$UWV ,QGXVWU\*ODVJRZ YROXPHV >*ODVJRZ([KLELWLRQRI@ 3KLOOLS¶V$XFWLRQ+RXVH&DWDORJV >3KLOOLSV@ 6FRWWLVK3URYLQFLDO6LOYHUIURPWKH'DYLG0RUULV&ROOHFWLRQ-XO\DQG2FWREHU &KULVWLH¶V6FRWODQG6DOH&DWDORJV >7KH0RUULV&ROOHFWLRQ@ 6KDZ&ROOHFWLRQRI,PSRUWDQW6FRWWLVK6LOYHUDQG3LVWROVWKHth0DUFK&KULVWLH¶V6DOH &DWDORJ >6KDZ&ROOHFWLRQ@ 6LOYHU7HDSRWVIURPWKH-RKQ%HOORI$EHUGHHQ&ROOHFWLRQth1RYHPEHU±th'HFHPEHUDWWKH &H\ORQ7HD&HQWHU*ODVJRZ([KLELWLRQ&DWDORJ >%HOORI$EHUGHHQ@ xxxix561 Compendium of Scottish Silver 6RWKHE\¶V6DOHV&DWDORJV >6RWKHE\V@ JOURNALS $QWLTXHV$WZRRG%RVWRQ >$QWLTXHV0DJD]LQH@ 7KH0DJD]LQH$QWLTXHV6WUDLJKW(QWHUSULVHV1<SUHVHQW >$QWLTXHV0DJD]LQH@ $SROOR$SROOR/RQGRQSUHVHQW >$SROOR@ %XUOLQJWRQ0DJD]LQH%XUOLQJWRQ0DJD]LQH3XEOLFDWLRQV/WG/RQGRQSUHVHQW >%XUOLQJWRQ0DJD]LQH@ 7KH&RQQRLVVHXU1DWLRQDO0DJD]LQH&RPSDQ\/RQGRQSUHVHQW >&RQQRLVVHXU0DJD]LQH@ &RXQWU\/LIH&RXQWU\/LIH/RQGRQSUHVHQW >&RXQWU\/LIH@ 7KH6FRWWLVK$UW5HYLHZ*ODVJRZ$UW*DOOHU\DQG0XVHXPV$VVRFLDWLRQV*ODVJRZ SUHVHQW >6FRWWLVK$UW5HYLHZ@ 6LOYHU6WXGLHV-RXUQDORIWKH6LOYHU6RFLHW\HG9DQHVVD%UHWW >6LOYHU6WXGLHV@ 0(',$ &KULVWLH¶V1HJDWLYH)LOHLGHQWLILFDWLRQQXPEHUVIRULPDJHVKRXVHGDW&KULVWLH¶V/RQGRQ &KULVWLH¶V3LFWXUH)LOHVSKRWRJUDSKVVWRUHGDW&KULVWLH¶V,QWHUQDWLRQDO/RQGRQ 6RWKHE\¶V3LFWXUH)LOHVSKRWRJUDSKVVWRUHGDW6RWKHE\¶V/RQGRQ 086(806 $EHUGHHQ0XVHXPVDQG*DOOHULHV $UW,QVWLWXWHRI&KLFDJR,/86$ %DOWLPRUH0XVHXPRI$UW0'86$ 562xxxx Works Cited Berkshire Museum Pittsfield, MA USA Birmingham Museum of Art, Birmingham AL USA Boston Museum of Fine Art MA USA Campbell Museum Camden NJ USA Carnegie Institute Museum of Art, Pittsburgh PA USA Cincinnati Art Museum OH USA Clark Art Institute Brooklyn Museum Brooklyn NY USA Dallas Museum of Art TX USA Dayton Art Institute OH USA Detroit Institute of Art MI USA Dewitt Gallery, Hyman Collection - Colonial Williamsburg [Hyman Collection - Colonial Williamsburg, VA USA Dundee Museums and Art Galleries Fogg Art Museum, Harvard University, Cambridge MA USA Glasgow Museums Glasgow Scotland High Museum of Art, Atlanta GA USA Huntington Library San Mateo CA USA Huntley House Edinburgh Scotland Indianapolis Museum of Art IN USA J B Speed Museum Louisville KT USA Los Angeles County Museum CA USA Lyman Allyn Art Museum New London CT USA McKissick Museum University of SC Columbus SC USA Metropolitan Museum of Art NY USA Milwaukee Art Museum WI USA xxxxi563 Compendium of Scottish Silver Minneapolis Institute of Art MN USA Musee de Beaux Arts Montreal Canada National Museums of Scotland, Edinburgh Scotland National Museum of Wales Cardiff Wales Nova Scotia Museum Hallifax Nova Scotia Canada Perth City Art Gallery and Museum Perth Scotland Philadelphia Museum of Art PA USA Portland Art Museum OR USA Rhode Island School of Museum Providence, RI USA Royal Ontario Museum Toronto Canada St Louis City Art Museum LA USA San Diego Museum of Art CA USA San Francisco, Fine Arts Museums of CA USA Toledo Museum of Art OH USA Victoria and Albert Museum London UK Virginia Museum of Fine Arts Richmond VA USA Yale University Art Gallery New Haven CT USA 564xxxxii Rodney R. Dietert, Ph.D, Professor of Immunotoxicology, College of Veterinary Medicine, at Cornell University has devoted over 25 years to researching and teaching about the health hazards of exposure to heavy metals and other environmental contaminants. Additionally, he directed both the Institute for Comparative and Environmental Toxicology and the Program on Breast Cancer and Environmental Risk Factors at Cornell. Dietert is listed in Who’s Who in Medicine and Healthcare, Who’s Who in America and Who’s Who in the World. Here, he directs his attention to the beneficial artistic and historical sides of metals - namely, the production of Scottish gold and silver work spanning four centuries. Janice M Dietert, M.A., Learning Disabilities Specialist, has spent her life devoting herself to individuals with learning disabilities and Attention Deficit Disorder. While raising a daughter with both LDs and ADD, she also earned a degree in social science that gave her the background, pulled heavily from her coursework in English Literature and Linguistics and neuropsychology, primed for higher educational work with individuals challenged in these areas. However, she never left her first loves – computers and English Literature and Composition. Now that her life has begun another phase, she has shifted back to using her talents with camera, computer and words to aid in the compilation of this magnificent compendium.