SON (Human) Recombinant Protein (Q01)

Catalog # : H00006651-Q01 規格 : [ 2 ug ] List All

Specification Application Image

Product Human SON partial ORF ( NP_620305, 2301 a.a. - 2410 a.a.) Enzyme-linked Immunoabsorbent Assay Description: recombinant protein with GST-tag at N-terminal. Western Blot (Recombinant Sequence: AAPVTGGMGAVLMRKMGWREGEGLGKNKEGNKEPILVDFKTDRKGLV protein) AVGERAQKRSGNFSAAMKDLSGKHPVSALMEICNKRRWQPPEFLLVHD SGPDHRKHFLFRVLR Antibody Production

Host: Wheat Germ (in vitro) Protein Array

Theoretical MW 37.84 (kDa):

Preparation in vitro wheat germ expression system Method:

Purification: Glutathione Sepharose 4 Fast Flow

Quality Control 12.5% SDS-PAGE Stained with Coomassie Blue. Testing:

Storage Buffer: 50 mM Tris-HCI, 10 mM reduced Glutathione, pH=8.0 in the elution buffer.

Storage Store at -80°C. Aliquot to avoid repeated freezing and thawing. Instruction:

Note: Best use within three months from the date of receipt of this protein.

MSDS: Download

Datasheet: Download

Applications

Enzyme-linked Immunoabsorbent Assay

Western Blot (Recombinant protein)

Antibody Production

Page 1 of 2 2016/5/22 Protein Array

Gene Information

Entrez GeneID: 6651

GeneBank NM_138927 Accession#:

Protein NP_620305 Accession#:

Gene Name: SON

Gene Alias: BASS1,C21orf50,DBP-5,FLJ21099,FLJ33914,KIAA1019,NREBP,SON3

Gene SON DNA binding protein Description:

Omim ID: 182465

Gene Ontology: Hyperlink

Gene Summary: The protein encoded by this gene binds to a specific DNA sequence upstream of the upstream regulatory sequence of the core promoter and second enhancer of human hepatitis B virus (HBV). Through this binding, it represses HBV core promoter activity, transcription of HBV genes, and production of HBV virions. The protein shows sequence similarities with other DNA-binding structural proteins such as gallin, oncoproteins of the MYC family, and the oncoprotein MOS. It may also be involved in protecting cells from apoptosis and in pre-mRNA splicing. Several transcript variants encoding different isoforms have been described for this gene, but the full-length nature of only two of them has been determined. [provided by RefSeq

Other Bax antagonist selected in Saccharomyces 1,NRE-binding protein,SON Designations: DNA-binding protein,negative regulatory element-binding protein

Page 2 of 2 2016/5/22