GOLGA3 Polyclonal Antibody Gene Symbol: GOLGA3

Total Page：16

File Type：pdf, Size：1020Kb

GOLGA3 polyclonal antibody Gene Symbol: GOLGA3 Gene Alias: GCP170, MEA-2 Catalog Number: PAB27865 Gene Summary: The Golgi apparatus, which Regulatory Status: For research use only (RUO) participates in glycosylation and transport of proteins Product Description: Rabbit polyclonal antibody raised and lipids in the secretory pathway, consists of a series against recombinant GOLGA3. of stacked cisternae (flattened membrane sacs). Interactions between the Golgi and microtubules are Immunogen: Recombinant protein corresponding to thought to be important for the reorganization of the amino acids of human GOLGA3. Golgi after it fragments during mitosis. This gene encodes a member of the golgin family of proteins which Sequence: are localized to the Golgi. Its encoded protein has been STRGTYGILSKTVGTQDTPYMVNGQEIPADTLGQFPSI postulated to play a role in nuclear transport and Golgi KDVLQAAAAEHQDQGQEVNGEVRSRRDSICSSVSLE apparatus localization. Several alternatively spliced SSAAETQEEMLQVLKEKMRLEG transcript variants of this gene have been described, but the full-length nature of these variants has not been Host: Rabbit determined. [provided by RefSeq] Reactivity: Human Applications: IF, IHC-P, WB (See our web site product page for detailed applications information) Protocols: See our web site at http://www.abnova.com/support/protocols.asp or product page for detailed protocols Form: Liquid Purification: Antigen affinity purification Isotype: IgG Recommend Usage: Immunohistochemistry (1:500-1:1000) Western Blot (1:100-1:250) Immunofluorescence (1-4 ug/mL) The optimal working dilution should be determined by the end user. Storage Buffer: In PBS, pH 7.2, (40% glycerol, 0.02% sodium azide) Storage Instruction: Store at 4°C. For long term storage store at -20°C. Aliquot to avoid repeated freezing and thawing. Entrez GeneID: 2802 Page 1/1 Powered by TCPDF (www.tcpdf.org).

Copy Link

Recommended publications

Application to Neuroimaging Biomarkers in Alzheimer's
The Author(s) BMC Medical Informatics and Decision Making 2017, 17(Suppl 1):61 DOI 10.1186/s12911-017-0454-0 RESEARCH Open Access Knowledge-driven binning approach for rare variant association analysis: application to neuroimaging biomarkers in Alzheimer’s disease Dokyoon Kim1,2, Anna O. Basile2, Lisa Bang1, Emrin Horgusluoglu4, Seunggeun Lee3, Marylyn D. Ritchie1,2, Andrew J. Saykin4 and Kwangsik Nho4* From The 6th Translational Bioinformatics Conference Je Ju Island, Korea. 15-17 October 2016 Abstract Background: Rapid advancement of next generation sequencing technologies such as whole genome sequencing (WGS) has facilitated the search for genetic factors that influence disease risk in the field of human genetics. To identify rare variants associated with human diseases or traits, an efficient genome-wide binning approach is needed. In this study we developed a novel biological knowledge-based binning approach for rare-variant association analysis and then applied the approach to structural neuroimaging endophenotypes related to late-onset Alzheimer’sdisease(LOAD). Methods: For rare-variant analysis, we used the knowledge-driven binning approach implemented in Bin-KAT, an automated tool, that provides 1) binning/collapsing methods for multi-level variant aggregation with a flexible, biologically informed binning strategy and 2) an option of performing unified collapsing and statistical rare variant analyses in one tool. A total of 750 non-Hispanic Caucasian participants from the Alzheimer’s Disease Neuroimaging Initiative (ADNI) cohort who had both WGS data and magnetic resonance imaging (MRI) scans were used in this study. Mean bilateral cortical thickness of the entorhinal cortex extracted from MRI scans was used as an AD-related neuroimaging endophenotype.
[Show full text]
Changes in Mirna Expression in a Model of Microcephaly Shan Parikh University of Connecticut - Storrs, [email protected]
University of Connecticut OpenCommons@UConn Honors Scholar Theses Honors Scholar Program Spring 5-9-2010 Changes in miRNA Expression in a Model of Microcephaly Shan Parikh University of Connecticut - Storrs, [email protected] Follow this and additional works at: https://opencommons.uconn.edu/srhonors_theses Part of the Cellular and Molecular Physiology Commons, and the Other Physiology Commons Recommended Citation Parikh, Shan, "Changes in miRNA Expression in a Model of Microcephaly" (2010). Honors Scholar Theses. 140. https://opencommons.uconn.edu/srhonors_theses/140 Changes in miRNA expression in a model of Microcephaly Shan Parikh Physiology and Neurobiology Abstract miRNAs function to regulate gene expression through post-transcriptional mechanisms to potentially regulate multiple aspects of physiology and development. Whole transcriptome analysis has been conducted on the citron kinase mutant rat, a mutant that shows decreases in brain growth and development. The resulting differences in RNA between mutant and wild-type controls can be used to identify genetic pathways that may be regulated differentially in normal compared to abnormal neurogenesis. The goal of this thesis was to verify, with quantitative reverse transcriptase polymerase chain reaction (qRT-PCR), changes in miRNA expression in Cit-k mutants and wild types. In addition to confirming miRNA expression changes, bio- informatics software TargetScan 5.1 was used to identify potential mRNA targets of the differentially expressed miRNAs. The miRNAs that were confirmed to change include: rno-miR- 466c, mmu-miR-493, mmu-miR-297a, hsa-miR-765, and hsa-miR-1270. The TargetScan analysis revealed 347 potential targets which have known roles in development. A subset of these potential targets include genes involved in the Wnt signaling pathway which is known to be an important regulator of stem cell development.
[Show full text]
A SARS-Cov-2 Protein Interaction Map Reveals Targets for Drug Repurposing
Article A SARS-CoV-2 protein interaction map reveals targets for drug repurposing https://doi.org/10.1038/s41586-020-2286-9 A list of authors and affiliations appears at the end of the paper Received: 23 March 2020 Accepted: 22 April 2020 A newly described coronavirus named severe acute respiratory syndrome Published online: 30 April 2020 coronavirus 2 (SARS-CoV-2), which is the causative agent of coronavirus disease 2019 (COVID-19), has infected over 2.3 million people, led to the death of more than Check for updates 160,000 individuals and caused worldwide social and economic disruption1,2. There are no antiviral drugs with proven clinical efcacy for the treatment of COVID-19, nor are there any vaccines that prevent infection with SARS-CoV-2, and eforts to develop drugs and vaccines are hampered by the limited knowledge of the molecular details of how SARS-CoV-2 infects cells. Here we cloned, tagged and expressed 26 of the 29 SARS-CoV-2 proteins in human cells and identifed the human proteins that physically associated with each of the SARS-CoV-2 proteins using afnity-purifcation mass spectrometry, identifying 332 high-confdence protein–protein interactions between SARS-CoV-2 and human proteins. Among these, we identify 66 druggable human proteins or host factors targeted by 69 compounds (of which, 29 drugs are approved by the US Food and Drug Administration, 12 are in clinical trials and 28 are preclinical compounds). We screened a subset of these in multiple viral assays and found two sets of pharmacological agents that displayed antiviral activity: inhibitors of mRNA translation and predicted regulators of the sigma-1 and sigma-2 receptors.
[Show full text]
SPEF2 Functions in Microtubule-Mediated Transport in Elongating Spermatids to Ensure Proper Male Germ Cell Differentiation Mari S
© 2017. Published by The Company of Biologists Ltd | Development (2017) 144, 2683-2693 doi:10.1242/dev.152108 RESEARCH ARTICLE SPEF2 functions in microtubule-mediated transport in elongating spermatids to ensure proper male germ cell differentiation Mari S. Lehti1,2,*, Fu-Ping Zhang2,3,*, Noora Kotaja2,* and Anu Sironen1,‡,§ ABSTRACT 2006, 2002). Mutations in the Spef2 gene (an amino acid substitution Sperm differentiation requires specific protein transport for correct within exon 3 and a nonsense mutation within exon 28) in the big giant sperm tail formation and head shaping. A transient microtubular head (bgh) mouse model caused a primary ciliary dyskinesia (PCD)- structure, the manchette, appears around the differentiating like phenotype, including hydrocephalus, sinusitis and male infertility spermatid head and serves as a platform for protein transport to the (Sironen et al., 2011). Detailed analysis of spermatogenesis in both pig growing tail. Sperm flagellar 2 (SPEF2) is known to be essential for and mouse models revealed axonemal abnormalities, including defects sperm tail development. In this study we investigated the function of in central pair (CP) structure and the complete disorganization of the SPEF2 during spermatogenesis using a male germ cell-specific sperm tail (Sironen et al., 2011). A role of SPEF2 in protein transport Spef2 knockout mouse model. In addition to defects in sperm tail has been postulated owing to its known interaction and colocalization development, we observed a duplication of the basal body and failure with intraflagellar transport 20 (IFT20). During spermatogenesis, in manchette migration resulting in an abnormal head shape. We IFT20 and SPEF2 colocalize in the Golgi complex of late identified cytoplasmic dynein 1 and GOLGA3 as novel interaction spermatocytes and round spermatids and in the manchette and basal partners for SPEF2.
[Show full text]
Initial Whole-Genome Sequencing and Analysis of the Host Genetic
Wang et al. Cell Discovery (2020) 6:83 Cell Discovery https://doi.org/10.1038/s41421-020-00231-4 www.nature.com/celldisc ARTICLE Open Access Initial whole-genome sequencing and analysis of the host genetic contribution to COVID-19 severity and susceptibility Fang Wang1, Shujia Huang2,3, Rongsui Gao1, Yuwen Zhou2,4, Changxiang Lai1,ZhichaoLi2,4, Wenjie Xian1, Xiaobo Qian2,4,ZhiyuLi1, Yushan Huang2,4,QiyuanTang1, Panhong Liu2,4, Ruikun Chen1, Rong Liu2,XuanLi1, Xin Tong 2, Xuan Zhou1, Yong Bai 2,GangDuan1, Tao Zhang 2,XunXu 2,5,JianWang2,6,HuanmingYang2,6, Siyang Liu2,QingHe1,XinJin2,3 and Lei Liu1 Abstract The COVID-19 pandemic has accounted for millions of infections and hundreds of thousand deaths worldwide in a short-time period. The patients demonstrate a great diversity in clinical and laboratory manifestations and disease severity. Nonetheless, little is known about the host genetic contribution to the observed interindividual phenotypic variability. Here, we report the first host genetic study in the Chinese population by deeply sequencing and analyzing 332 COVID-19 patients categorized by varying levels of severity from the Shenzhen Third People’s Hospital. Upon a total of 22.2 million genetic variants, we conducted both single-variant and gene-based association tests among five severity groups including asymptomatic, mild, moderate, severe, and critical ill patients after the correction of potential confounding factors. Pedigree analysis suggested a potential monogenic effect of loss of function variants in GOLGA3 and DPP7 for critically ill and asymptomatic disease demonstration. Genome-wide association study suggests the most 1234567890():,; 1234567890():,; 1234567890():,; 1234567890():,; significant gene locus associated with severity were located in TMEM189–UBE2V1 that involved in the IL-1 signaling pathway.
[Show full text]
Retinal Gene Expression and Visually Evoked Behavior in Diabetic Long Evans Rats
Retina Retinal Gene Expression and Visually Evoked Behavior in Diabetic Long Evans Rats Stefanie J. Kirwin,1,2 Suzanne T. Kanaly,3 Candice R. Hansen,1 Belinda J. Cairns,3,4 Meina Ren,3 and Jeffrey L. Edelman1 PURPOSE. Patients with diabetic retinopathy may experience abnormally high glucose levels. Diabetic patients without vas- severe vision loss due to macular edema and neovascularization cular changes in the retina experience abnormal color vision,2 secondary to vascular abnormalities. However, before these dark adaptation,3 and contrast sensitivity.4 The oscillatory po- abnormalities become apparent, there are functional deficits in tential (OP) of the electroretinogram (ERG) is anomalous in contrast sensitivity, color perception, and dark adaptation. The diabetic patients4–8 and rodents,9–13 which is consistent with goals of this study are to evaluate early changes (up to 3 altered function of supporting cells in the retina, such as months) in retinal gene expression, selected visual cycle pro- impaired glutamate metabolism14–16 and increased glial fibril- teins, and optokinetic tracking (OKT) in streptozotocin (STZ)- lary acidic protein (GFAP) expression in Mu¨ller cells.13,15,17–19 induced diabetic rats. Other glial cells, such as astrocytes and microglia, are also 17 METHODS. Retinal gene expression in diabetic Long Evans rats affected. There is evidence of inflammatory changes in the 20–24 25–27 was measured by whole genome microarray 7 days, 4 weeks, eyes of diabetic patients and animals and cell death of 28–33 and 3 months after the onset of hyperglycemia. Select gene and various retinal neurons. protein changes were probed by polymerase chain reaction In addition to inner retinal pathology, photoreceptor viabil- 5,31,34 (PCR) and immunohistochemistry, respectively, and OKT ity is impacted by hyperglycemia.
[Show full text]
Phenotype Informatics
Freie UniversitätBerlin Department of Mathematics and Computer Science Phenotype informatics: Network approaches towards understanding the diseasome Sebastian Kohler¨ Submitted on: 12th September 2012 Dissertation zur Erlangung des Grades eines Doktors der Naturwissenschaften (Dr. rer. nat.) am Fachbereich Mathematik und Informatik der Freien Universitat¨ Berlin ii 1. Gutachter Prof. Dr. Martin Vingron 2. Gutachter: Prof. Dr. Peter N. Robinson 3. Gutachter: Christopher J. Mungall, Ph.D. Tag der Disputation: 16.05.2013 Preface This thesis presents research work on novel computational approaches to investigate and characterise the association between genes and pheno- typic abnormalities. It demonstrates methods for organisation, integra- tion, and mining of phenotype data in the field of genetics, with special application to human genetics. Here I will describe the parts of this the- sis that have been published in peer-reviewed journals. Often in modern science different people from different institutions contribute to research projects. The same is true for this thesis, and thus I will itemise who was responsible for specific sub-projects. In chapter 2, a new method for associating genes to phenotypes by means of protein-protein-interaction networks is described. I present a strategy to organise disease data and show how this can be used to link diseases to the corresponding genes. I show that global network distance measure in interaction networks of proteins is well suited for investigat- ing genotype-phenotype associations. This work has been published in 2008 in the American Journal of Human Genetics. My contribution here was to plan the project, implement the software, and finally test and evaluate the method on human genetics data; the implementation part was done in close collaboration with Sebastian Bauer.
[Show full text]
Tepzz 8Z6z54a T
(19) TZZ ZZ_T (11) EP 2 806 054 A1 (12) EUROPEAN PATENT APPLICATION (43) Date of publication: (51) Int Cl.: 26.11.2014 Bulletin 2014/48 C40B 40/06 (2006.01) C12Q 1/68 (2006.01) C40B 30/04 (2006.01) C07H 21/00 (2006.01) (21) Application number: 14175049.7 (22) Date of filing: 28.05.2009 (84) Designated Contracting States: (74) Representative: Irvine, Jonquil Claire AT BE BG CH CY CZ DE DK EE ES FI FR GB GR HGF Limited HR HU IE IS IT LI LT LU LV MC MK MT NL NO PL 140 London Wall PT RO SE SI SK TR London EC2Y 5DN (GB) (30) Priority: 28.05.2008 US 56827 P Remarks: •Thecomplete document including Reference Tables (62) Document number(s) of the earlier application(s) in and the Sequence Listing can be downloaded from accordance with Art. 76 EPC: the EPO website 09753364.0 / 2 291 553 •This application was filed on 30-06-2014 as a divisional application to the application mentioned (71) Applicant: Genomedx Biosciences Inc. under INID code 62. Vancouver, British Columbia V6J 1J8 (CA) •Claims filed after the date of filing of the application/ after the date of receipt of the divisional application (72) Inventor: Davicioni, Elai R.68(4) EPC). Vancouver British Columbia V6J 1J8 (CA) (54) Systems and methods for expression- based discrimination of distinct clinical disease states in prostate cancer (57) A system for expression-based discrimination of distinct clinical disease states in prostate cancer is provided that is based on the identification of sets of gene transcripts, which are characterized in that changes in expression of each gene transcript within a set of gene transcripts can be correlated with recurrent or non- recur- rent prostate cancer.
[Show full text]
Detection of H3k4me3 Identifies Neurohiv Signatures, Genomic
viruses Article Detection of H3K4me3 Identifies NeuroHIV Signatures, Genomic Effects of Methamphetamine and Addiction Pathways in Postmortem HIV+ Brain Specimens that Are Not Amenable to Transcriptome Analysis Liana Basova 1, Alexander Lindsey 1, Anne Marie McGovern 1, Ronald J. Ellis 2 and Maria Cecilia Garibaldi Marcondes 1,* 1 San Diego Biomedical Research Institute, San Diego, CA 92121, USA; [email protected] (L.B.); [email protected] (A.L.); [email protected] (A.M.M.) 2 Departments of Neurosciences and Psychiatry, University of California San Diego, San Diego, CA 92103, USA; [email protected] * Correspondence: [email protected] Abstract: Human postmortem specimens are extremely valuable resources for investigating trans- lational hypotheses. Tissue repositories collect clinically assessed specimens from people with and without HIV, including age, viral load, treatments, substance use patterns and cognitive functions. One challenge is the limited number of specimens suitable for transcriptional studies, mainly due to poor RNA quality resulting from long postmortem intervals. We hypothesized that epigenomic Citation: Basova, L.; Lindsey, A.; signatures would be more stable than RNA for assessing global changes associated with outcomes McGovern, A.M.; Ellis, R.J.; of interest. We found that H3K27Ac or RNA Polymerase (Pol) were not consistently detected by Marcondes, M.C.G. Detection of H3K4me3 Identifies NeuroHIV Chromatin Immunoprecipitation (ChIP), while the enhancer H3K4me3 histone modification was Signatures, Genomic Effects of abundant and stable up to the 72 h postmortem. We tested our ability to use H3K4me3 in human Methamphetamine and Addiction prefrontal cortex from HIV+ individuals meeting criteria for methamphetamine use disorder or not Pathways in Postmortem HIV+ Brain (Meth +/−) which exhibited poor RNA quality and were not suitable for transcriptional profiling.
[Show full text]
Transposon Mutagenesis Identifies Genetic Drivers of Brafv600e Melanoma
ARTICLES Transposon mutagenesis identifies genetic drivers of BrafV600E melanoma Michael B Mann1,2, Michael A Black3, Devin J Jones1, Jerrold M Ward2,12, Christopher Chin Kuan Yew2,12, Justin Y Newberg1, Adam J Dupuy4, Alistair G Rust5,12, Marcus W Bosenberg6,7, Martin McMahon8,9, Cristin G Print10,11, Neal G Copeland1,2,13 & Nancy A Jenkins1,2,13 Although nearly half of human melanomas harbor oncogenic BRAFV600E mutations, the genetic events that cooperate with these mutations to drive melanogenesis are still largely unknown. Here we show that Sleeping Beauty (SB) transposon-mediated mutagenesis drives melanoma progression in BrafV600E mutant mice and identify 1,232 recurrently mutated candidate cancer genes (CCGs) from 70 SB-driven melanomas. CCGs are enriched in Wnt, PI3K, MAPK and netrin signaling pathway components and are more highly connected to one another than predicted by chance, indicating that SB targets cooperative genetic networks in melanoma. Human orthologs of >500 CCGs are enriched for mutations in human melanoma or showed statistically significant clinical associations between RNA abundance and survival of patients with metastatic melanoma. We also functionally validate CEP350 as a new tumor-suppressor gene in human melanoma. SB mutagenesis has thus helped to catalog the cooperative molecular mechanisms driving BRAFV600E melanoma and discover new genes with potential clinical importance in human melanoma. Substantial sun exposure and numerous genetic factors, including including BrafV600E, recapitulate the genetic and histological hallmarks skin type and family history, are the most important melanoma risk of human melanoma. In these models, increased MEK-ERK signaling factors. Familial melanoma, which accounts for <10% of cases, is asso- initiates clonal expansion of melanocytes, which is limited by oncogene- ciated with mutations in CDKN2A1, MITF2 and POT1 (refs.
[Show full text]
Downloaded from the Biogrid Database [30] Contain- the Immune System [12–15]
Adhami et al. BMC Biotechnology (2021) 21:22 https://doi.org/10.1186/s12896-021-00680-z RESEARCH ARTICLE Open Access Repurposing novel therapeutic candidate drugs for coronavirus disease-19 based on protein-protein interaction network analysis Masoumeh Adhami1, Balal Sadeghi2, Ali Rezapour3, Ali Akbar Haghdoost4 and Habib MotieGhader5,6* Abstract Background: The coronavirus disease-19 (COVID-19) emerged in Wuhan, China and rapidly spread worldwide. Researchers are trying to find a way to treat this disease as soon as possible. The present study aimed to identify the genes involved in COVID-19 and find a new drug target therapy. Currently, there are no effective drugs targeting SARS-CoV-2, and meanwhile, drug discovery approaches are time-consuming and costly. To address this challenge, this study utilized a network-based drug repurposing strategy to rapidly identify potential drugs targeting SARS-CoV-2. To this end, seven potential drugs were proposed for COVID-19 treatment using protein- protein interaction (PPI) network analysis. First, 524 proteins in humans that have interaction with the SARS-CoV-2 virus were collected, and then the PPI network was reconstructed for these collected proteins. Next, the target miRNAs of the mentioned module genes were separately obtained from the miRWalk 2.0 database because of the important role of miRNAs in biological processes and were reported as an important clue for future analysis. Finally, the list of the drugs targeting module genes was obtained from the DGIDb database, and the drug-gene network was separately reconstructed for the obtained protein modules. Results: Based on the network analysis of the PPI network, seven clusters of proteins were specified as the complexes of proteins which are more associated with the SARS-CoV-2 virus.
[Show full text]
GOLGA3 Antibody
Product Datasheet GOLGA3 antibody Catalog No: #22143 Orders: [email protected] Description Support: [email protected] Product Name GOLGA3 antibody Host Species Rabbit Clonality Polyclonal Purification Purified by antigen-affinity chromatography. Applications WB IHC IF Species Reactivity Hu Immunogen Type Peptide Immunogen Description Synthetic peptide contain a sequence corresponding to a region within amino acids 1436 and 1498 of Golgi autoantigen, golgin subfamily a, 3 Target Name GOLGA3 Accession No. Swiss-Prot:Q08378Gene ID:2802 Concentration 1mg/ml Formulation Supplied in 1XPBS, 1%BSA, 20% Glycerol (pH7.0). 0.01% Thimerosal was added as a preservative. Storage Store at -20°C for long term preservation (recommended). Store at 4°C for short term use. Application Details Predicted MW: 167kd Western blotting: 1:500-1:3000 Immunohistochemistry: 1:100-1:250 Immunofluorescence: 1:100-1:200 Images Sample(30 ug of whole cell lysate) A: A431 B: H1299 5% SDS PAGE Primary antibody diluted at 1: 1000 Address: 8400 Baltimore Ave., Suite 302, College Park, MD 20740, USA http://www.sabbiotech.com 1 Immunohistochemical analysis of paraffin-embedded gastric tissue, using GOLGA3 antibody at 1: 100 dilution. Immunofluorescence analysis of paraformaldehyde-fixed HeLa, using GOLGA3 antibody at 1: 200 dilution. Background The Golgi apparatus, which participates in glycosylation and transport of proteins and lipids in the secretory pathway, consists of a series of stacked cisternae (flattened membrane sacs). Interactions between the Golgi and microtubules are thought to be important for the reorganization of the Golgi after it fragments during mitosis. This gene encodes a member of the golgin family of proteins which are localized to the Golgi.
[Show full text]