Mouse Ift20 Conditional Knockout Project (CRISPR/Cas9)

Total Page:16

File Type:pdf, Size:1020Kb

Mouse Ift20 Conditional Knockout Project (CRISPR/Cas9) https://www.alphaknockout.com Mouse Ift20 Conditional Knockout Project (CRISPR/Cas9) Objective: To create a Ift20 conditional knockout Mouse model (C57BL/6J) by CRISPR/Cas-mediated genome engineering. Strategy summary: The Ift20 gene (NCBI Reference Sequence: NM_018854 ; Ensembl: ENSMUSG00000001105 ) is located on Mouse chromosome 11. 6 exons are identified, with the ATG start codon in exon 3 and the TGA stop codon in exon 6 (Transcript: ENSMUST00000128788). Exon 4 will be selected as conditional knockout region (cKO region). Deletion of this region should result in the loss of function of the Mouse Ift20 gene. To engineer the targeting vector, homologous arms and cKO region will be generated by PCR using BAC clone RP23-356D12 as template. Cas9, gRNA and targeting vector will be co-injected into fertilized eggs for cKO Mouse production. The pups will be genotyped by PCR followed by sequencing analysis. Note: Mice homozygous for a null mutation die before birth. Mice with conditional loss in renal collecting ducts lackprimary cilia and develop renal cysts. Exon 4 starts from about 32.32% of the coding region. The knockout of Exon 4 will result in frameshift of the gene. The size of intron 3 for 5'-loxP site insertion: 997 bp, and the size of intron 4 for 3'-loxP site insertion: 849 bp. The size of effective cKO region: ~586 bp. The cKO region does not have any other known gene. Page 1 of 7 https://www.alphaknockout.com Overview of the Targeting Strategy Wildtype allele gRNA region 5' gRNA region 3' 1 2 3 4 5 6 3 Targeting vector Targeted allele Constitutive KO allele (After Cre recombination) Legends Exon of mouse Ift20 Homology arm cKO region Exon of mouse Tmem97 loxP site Page 2 of 7 https://www.alphaknockout.com Overview of the Dot Plot Window size: 10 bp Forward Reverse Complement Sequence 12 Note: The sequence of homologous arms and cKO region is aligned with itself to determine if there are tandem repeats. No significant tandem repeat is found in the dot plot matrix. So this region is suitable for PCR screening or sequencing analysis. Overview of the GC Content Distribution Window size: 300 bp Sequence 12 Summary: Full Length(7086bp) | A(24.74% 1753) | C(23.14% 1640) | T(27.9% 1977) | G(24.22% 1716) Note: The sequence of homologous arms and cKO region is analyzed to determine the GC content. No significant high GC-content region is found. So this region is suitable for PCR screening or sequencing analysis. Page 3 of 7 https://www.alphaknockout.com BLAT Search Results (up) QUERY SCORE START END QSIZE IDENTITY CHROM STRAND START END SPAN ----------------------------------------------------------------------------------------------- browser details YourSeq 3000 1 3000 3000 100.0% chr11 + 78536711 78539710 3000 browser details YourSeq 143 698 859 3000 92.1% chr16 + 8799447 8799597 151 browser details YourSeq 140 717 869 3000 96.7% chrX - 60636654 60636811 158 browser details YourSeq 138 721 868 3000 97.3% chrX + 7254449 7254609 161 browser details YourSeq 137 713 867 3000 92.8% chr15 - 100252259 100252411 153 browser details YourSeq 137 717 868 3000 95.4% chr15 + 82635801 82635952 152 browser details YourSeq 137 717 868 3000 95.4% chr14 + 10153615 10153768 154 browser details YourSeq 137 697 868 3000 91.2% chr11 + 99004862 99005031 170 browser details YourSeq 136 717 868 3000 93.4% chr12 - 77259971 77260121 151 browser details YourSeq 136 717 868 3000 93.3% chr17 + 73807965 73808114 150 browser details YourSeq 136 726 878 3000 96.6% chr11 + 89004988 89005598 611 browser details YourSeq 135 717 869 3000 93.4% chr5 + 136178871 136179022 152 browser details YourSeq 135 721 868 3000 96.0% chr5 + 121391009 121391157 149 browser details YourSeq 135 717 868 3000 94.8% chr2 + 59500951 59501102 152 browser details YourSeq 134 714 868 3000 94.2% chr3 + 57647579 57647736 158 browser details YourSeq 133 717 868 3000 95.3% chr4 - 149291874 149292397 524 browser details YourSeq 133 721 869 3000 93.3% chr4 - 136432494 136432641 148 browser details YourSeq 133 716 863 3000 96.6% chrX + 103418540 103418687 148 browser details YourSeq 132 717 867 3000 96.6% chrX + 142419216 142419366 151 browser details YourSeq 132 725 867 3000 97.2% chr4 + 118352730 118352872 143 Note: The 3000 bp section upstream of Exon 4 is BLAT searched against the genome. No significant similarity is found. BLAT Search Results (down) QUERY SCORE START END QSIZE IDENTITY CHROM STRAND START END SPAN ----------------------------------------------------------------------------------------------- browser details YourSeq 3000 1 3000 3000 100.0% chr11 + 78540297 78543296 3000 browser details YourSeq 956 1521 2502 3000 99.0% chr16 - 22230660 22231641 982 browser details YourSeq 276 597 1418 3000 86.5% chr9 + 12234192 12234705 514 browser details YourSeq 91 193 2926 3000 88.2% chr1 - 9711930 9929823 217894 browser details YourSeq 75 156 286 3000 85.6% chr11 + 5782998 5783128 131 browser details YourSeq 72 148 263 3000 90.0% chr2 - 144212681 144212797 117 browser details YourSeq 72 153 263 3000 86.0% chr1 + 186545225 186545336 112 browser details YourSeq 70 125 282 3000 84.3% chr4 - 117533823 117533975 153 browser details YourSeq 68 2847 2953 3000 94.9% chr5 - 65332279 65332393 115 browser details YourSeq 68 2864 2953 3000 93.6% chr6 + 83528541 83528631 91 browser details YourSeq 67 2864 2965 3000 88.0% chr8 + 25549909 25550011 103 browser details YourSeq 65 149 267 3000 91.2% chr5 - 100216022 100216141 120 browser details YourSeq 65 149 264 3000 88.3% chr10 + 60021350 60021466 117 browser details YourSeq 64 2827 2934 3000 93.5% chr11 - 116252545 116253103 559 browser details YourSeq 63 2864 2965 3000 85.6% chr11 - 76161960 76580859 418900 browser details YourSeq 63 120 240 3000 85.6% chr4 + 148390410 148390527 118 browser details YourSeq 62 137 290 3000 93.2% chr2 + 167550316 167550472 157 browser details YourSeq 62 107 217 3000 90.5% chr2 + 27060665 27060774 110 browser details YourSeq 62 2864 2964 3000 92.0% chr12 + 4100568 4100668 101 browser details YourSeq 61 109 287 3000 93.1% chr6 - 48710916 48711096 181 Note: The 3000 bp section downstream of Exon 4 is BLAT searched against the genome. No significant similarity is found. Page 4 of 7 https://www.alphaknockout.com Gene and protein information: Ift20 intraflagellar transport 20 [ Mus musculus (house mouse) ] Gene ID: 55978, updated on 14-Oct-2019 Gene summary Official Symbol Ift20 provided by MGI Official Full Name intraflagellar transport 20 provided by MGI Primary source MGI:MGI:1915585 See related Ensembl:ENSMUSG00000001105 Gene type protein coding RefSeq status VALIDATED Organism Mus musculus Lineage Eukaryota; Metazoa; Chordata; Craniata; Vertebrata; Euteleostomi; Mammalia; Eutheria; Euarchontoglires; Glires; Rodentia; Myomorpha; Muroidea; Muridae; Murinae; Mus; Mus Also known as mIFT20; AU015496; 0610009H04Rik Expression Ubiquitous expression in duodenum adult (RPKM 42.4), small intestine adult (RPKM 37.8) and 28 other tissues See more Orthologs human all Genomic context Location: 11; 11 B5 See Ift20 in Genome Data Viewer Exon count: 6 Annotation release Status Assembly Chr Location 108 current GRCm38.p6 (GCF_000001635.26) 11 NC_000077.6 (78536361..78541732) Build 37.2 previous assembly MGSCv37 (GCF_000001635.18) 11 NC_000077.5 (78349938..78354975) Chromosome 11 - NC_000077.6 Page 5 of 7 https://www.alphaknockout.com Transcript information: This gene has 5 transcripts Gene: Ift20 ENSMUSG00000001105 Description intraflagellar transport 20 [Source:MGI Symbol;Acc:MGI:1915585] Gene Synonyms 0610009H04Rik Location Chromosome 11: 78,536,361-78,541,737 forward strand. GRCm38:CM001004.2 About this gene This gene has 5 transcripts (splice variants), 211 orthologues, is a member of 1 Ensembl protein family and is associated with 3 phenotypes. Transcripts Name Transcript ID bp Protein Translation ID Biotype CCDS UniProt Flags Ift20-203 ENSMUST00000128788.7 1141 132aa ENSMUSP00000118015.1 Protein coding CCDS25111 Q61025 TSL:1 GENCODE basic APPRIS P1 Ift20-202 ENSMUST00000108275.1 582 132aa ENSMUSP00000103910.1 Protein coding CCDS25111 Q61025 TSL:1 GENCODE basic APPRIS P1 Ift20-201 ENSMUST00000050366.14 735 111aa ENSMUSP00000051699.8 Protein coding - Z4YJL9 CDS 3' incomplete TSL:5 Ift20-204 ENSMUST00000137120.7 1167 No protein - Retained intron - - TSL:1 Ift20-205 ENSMUST00000152016.1 909 No protein - Retained intron - - TSL:2 25.38 kb Forward strand 78.53Mb 78.54Mb 78.55Mb Genes (Comprehensive set... Ift20-203 >protein coding Ift20-201 >protein coding Ift20-202 >protein coding Ift20-204 >retained intron Ift20-205 >retained intron Contigs AL591177.14 > Genes < Tnfaip1-202protein coding < Tmem97-201protein coding (Comprehensive set... < Tnfaip1-201protein coding Regulatory Build 78.53Mb 78.54Mb 78.55Mb Reverse strand 25.38 kb Regulation Legend CTCF Enhancer Open Chromatin Promoter Promoter Flank Gene Legend Protein Coding merged Ensembl/Havana Ensembl protein coding Non-Protein Coding processed transcript Page 6 of 7 https://www.alphaknockout.com Transcript: ENSMUST00000128788 5.38 kb Forward strand Ift20-203 >protein coding ENSMUSP00000118... Low complexity (Seg) Coiled-coils (Ncoils) Pfam Intraflagellar transport protein 20 PANTHER Intraflagellar transport protein 20 Scale bar 0 20 40 60 80 100 132 We wish to acknowledge the following valuable scientific information resources: Ensembl, MGI, NCBI, UCSC. Page 7 of 7.
Recommended publications
  • Role of Phytochemicals in Colon Cancer Prevention: a Nutrigenomics Approach
    Role of phytochemicals in colon cancer prevention: a nutrigenomics approach Marjan J van Erk Promotor: Prof. Dr. P.J. van Bladeren Hoogleraar in de Toxicokinetiek en Biotransformatie Wageningen Universiteit Co-promotoren: Dr. Ir. J.M.M.J.G. Aarts Universitair Docent, Sectie Toxicologie Wageningen Universiteit Dr. Ir. B. van Ommen Senior Research Fellow Nutritional Systems Biology TNO Voeding, Zeist Promotiecommissie: Prof. Dr. P. Dolara University of Florence, Italy Prof. Dr. J.A.M. Leunissen Wageningen Universiteit Prof. Dr. J.C. Mathers University of Newcastle, United Kingdom Prof. Dr. M. Müller Wageningen Universiteit Dit onderzoek is uitgevoerd binnen de onderzoekschool VLAG Role of phytochemicals in colon cancer prevention: a nutrigenomics approach Marjan Jolanda van Erk Proefschrift ter verkrijging van graad van doctor op gezag van de rector magnificus van Wageningen Universiteit, Prof.Dr.Ir. L. Speelman, in het openbaar te verdedigen op vrijdag 1 oktober 2004 des namiddags te vier uur in de Aula Title Role of phytochemicals in colon cancer prevention: a nutrigenomics approach Author Marjan Jolanda van Erk Thesis Wageningen University, Wageningen, the Netherlands (2004) with abstract, with references, with summary in Dutch ISBN 90-8504-085-X ABSTRACT Role of phytochemicals in colon cancer prevention: a nutrigenomics approach Specific food compounds, especially from fruits and vegetables, may protect against development of colon cancer. In this thesis effects and mechanisms of various phytochemicals in relation to colon cancer prevention were studied through application of large-scale gene expression profiling. Expression measurement of thousands of genes can yield a more complete and in-depth insight into the mode of action of the compounds.
    [Show full text]
  • Cilia-Related Protein SPEF2 Regulates Osteoblast Differentiation
    www.nature.com/scientificreports OPEN Cilia-related protein SPEF2 regulates osteoblast diferentiation Mari S. Lehti1,2, Henna Henriksson2, Petri Rummukainen 2, Fan Wang2, Liina Uusitalo- Kylmälä2, Riku Kiviranta2,3, Terhi J. Heino2, Noora Kotaja2 & Anu Sironen1 Received: 5 May 2017 Sperm fagellar protein 2 (SPEF2) is essential for motile cilia, and lack of SPEF2 function causes male Accepted: 22 December 2017 infertility and primary ciliary dyskinesia. Cilia are pointing out from the cell surface and are involved Published: xx xx xxxx in signal transduction from extracellular matrix, fuid fow and motility. It has been shown that cilia and cilia-related genes play essential role in commitment and diferentiation of chondrocytes and osteoblasts during bone formation. Here we show that SPEF2 is expressed in bone and cartilage. The analysis of a Spef2 knockout (KO) mouse model revealed hydrocephalus, growth retardation and death prior to fve weeks of age. To further elucidate the causes of growth retardation we analyzed the bone structure and possible efects of SPEF2 depletion on bone formation. In Spef2 KO mice, long bones (tibia and femur) were shorter compared to wild type, and X-ray analysis revealed reduced bone mineral content. Furthermore, we showed that the in vitro diferentiation of osteoblasts isolated from Spef2 KO animals was compromised. In conclusion, this study reveals a novel function for SPEF2 in bone formation through regulation of osteoblast diferentiation and bone growth. Skeletogenesis occurs through endochondral and intramembranous ossifcation. During intramembranous ossifcation, mesenchymal stem cells (MSC) directly diferentiate into osteoblasts. In endochondral ossifcation, MSCs frst diferentiate to chondrocytes forming the cartilage, which is subsequently replaced by bone.
    [Show full text]
  • SPEF2 Functions in Microtubule-Mediated Transport in Elongating Spermatids to Ensure Proper Male Germ Cell Differentiation Mari S
    © 2017. Published by The Company of Biologists Ltd | Development (2017) 144, 2683-2693 doi:10.1242/dev.152108 RESEARCH ARTICLE SPEF2 functions in microtubule-mediated transport in elongating spermatids to ensure proper male germ cell differentiation Mari S. Lehti1,2,*, Fu-Ping Zhang2,3,*, Noora Kotaja2,* and Anu Sironen1,‡,§ ABSTRACT 2006, 2002). Mutations in the Spef2 gene (an amino acid substitution Sperm differentiation requires specific protein transport for correct within exon 3 and a nonsense mutation within exon 28) in the big giant sperm tail formation and head shaping. A transient microtubular head (bgh) mouse model caused a primary ciliary dyskinesia (PCD)- structure, the manchette, appears around the differentiating like phenotype, including hydrocephalus, sinusitis and male infertility spermatid head and serves as a platform for protein transport to the (Sironen et al., 2011). Detailed analysis of spermatogenesis in both pig growing tail. Sperm flagellar 2 (SPEF2) is known to be essential for and mouse models revealed axonemal abnormalities, including defects sperm tail development. In this study we investigated the function of in central pair (CP) structure and the complete disorganization of the SPEF2 during spermatogenesis using a male germ cell-specific sperm tail (Sironen et al., 2011). A role of SPEF2 in protein transport Spef2 knockout mouse model. In addition to defects in sperm tail has been postulated owing to its known interaction and colocalization development, we observed a duplication of the basal body and failure with intraflagellar transport 20 (IFT20). During spermatogenesis, in manchette migration resulting in an abnormal head shape. We IFT20 and SPEF2 colocalize in the Golgi complex of late identified cytoplasmic dynein 1 and GOLGA3 as novel interaction spermatocytes and round spermatids and in the manchette and basal partners for SPEF2.
    [Show full text]
  • Variation in Protein Coding Genes Identifies Information Flow
    bioRxiv preprint doi: https://doi.org/10.1101/679456; this version posted June 21, 2019. The copyright holder for this preprint (which was not certified by peer review) is the author/funder, who has granted bioRxiv a license to display the preprint in perpetuity. It is made available under aCC-BY-NC-ND 4.0 International license. Animal complexity and information flow 1 1 2 3 4 5 Variation in protein coding genes identifies information flow as a contributor to 6 animal complexity 7 8 Jack Dean, Daniela Lopes Cardoso and Colin Sharpe* 9 10 11 12 13 14 15 16 17 18 19 20 21 22 23 24 Institute of Biological and Biomedical Sciences 25 School of Biological Science 26 University of Portsmouth, 27 Portsmouth, UK 28 PO16 7YH 29 30 * Author for correspondence 31 [email protected] 32 33 Orcid numbers: 34 DLC: 0000-0003-2683-1745 35 CS: 0000-0002-5022-0840 36 37 38 39 40 41 42 43 44 45 46 47 48 49 Abstract bioRxiv preprint doi: https://doi.org/10.1101/679456; this version posted June 21, 2019. The copyright holder for this preprint (which was not certified by peer review) is the author/funder, who has granted bioRxiv a license to display the preprint in perpetuity. It is made available under aCC-BY-NC-ND 4.0 International license. Animal complexity and information flow 2 1 Across the metazoans there is a trend towards greater organismal complexity. How 2 complexity is generated, however, is uncertain. Since C.elegans and humans have 3 approximately the same number of genes, the explanation will depend on how genes are 4 used, rather than their absolute number.
    [Show full text]
  • Investigating the Effect of Chronic Activation of AMP-Activated Protein
    Investigating the effect of chronic activation of AMP-activated protein kinase in vivo Alice Pollard CASE Studentship Award A thesis submitted to Imperial College London for the degree of Doctor of Philosophy September 2017 Cellular Stress Group Medical Research Council London Institute of Medical Sciences Imperial College London 1 Declaration I declare that the work presented in this thesis is my own, and that where information has been derived from the published or unpublished work of others it has been acknowledged in the text and in the list of references. This work has not been submitted to any other university or institute of tertiary education in any form. Alice Pollard The copyright of this thesis rests with the author and is made available under a Creative Commons Attribution Non-Commercial No Derivatives license. Researchers are free to copy, distribute or transmit the thesis on the condition that they attribute it, that they do not use it for commercial purposes and that they do not alter, transform or build upon it. For any reuse or redistribution, researchers must make clear to others the license terms of this work. 2 Abstract The prevalence of obesity and associated diseases has increased significantly in the last decade, and is now a major public health concern. It is a significant risk factor for many diseases, including cardiovascular disease (CVD) and type 2 diabetes. Characterised by excess lipid accumulation in the white adipose tissue, which drives many associated pathologies, obesity is caused by chronic, whole-organism energy imbalance; when caloric intake exceeds energy expenditure. Whilst lifestyle changes remain the most effective treatment for obesity and the associated metabolic syndrome, incidence continues to rise, particularly amongst children, placing significant strain on healthcare systems, as well as financial burden.
    [Show full text]
  • IFT20 (NM 001267774) Human Tagged ORF Clone Product Data
    OriGene Technologies, Inc. 9620 Medical Center Drive, Ste 200 Rockville, MD 20850, US Phone: +1-888-267-4436 [email protected] EU: [email protected] CN: [email protected] Product datasheet for RG231896 IFT20 (NM_001267774) Human Tagged ORF Clone Product data: Product Type: Expression Plasmids Product Name: IFT20 (NM_001267774) Human Tagged ORF Clone Tag: TurboGFP Symbol: IFT20 Vector: pCMV6-AC-GFP (PS100010) E. coli Selection: Ampicillin (100 ug/mL) Cell Selection: Neomycin ORF Nucleotide >RG231896 representing NM_001267774 Sequence: Red=Cloning site Blue=ORF Green=Tags(s) TTTTGTAATACGACTCACTATAGGGCGGCCGGGAATTCGTCGACTGGATCCGGTACCGAGGAGATCTGCC GCCGCGATCGCC ATGACACACCTCCTCCTGACTGCCACTGTCACTCCTTCAGAGCAGAACTCCTCTAGGGAACCTGGATGGG AAACAGCCATGGCCAAGGACATCCTGGGTGAAGCAGGGCTACACTTTGATGAACTGAACAAGCTGAGGGT GTTGGACCCAGAGGTTACCCAGCAGACCATAGAGCTGAAGGAAGAGTGCAAAGACTTTGTGGACAAAATT GGCCAGTTTCAGAAAATAGTTGGTGGTTTAATTGAGCTTGTTGATCAACTTGCAAAAGAAGCAGAAAATG AAAAGATGAAGGCCATCGGTGCTCGGAACTTGCTCAAATCTATAGCAAAGCAGAGAGAAGCTCAACAGCA GCAACTTCAAGCCCTAATAGCAGAAAAGAAAATGCAGCTAGAAAGGTATCGGGTTGAATATGAAGCTTTG TGTAAAGTAGAAGCAGAACAAAATGAATTTATTGACCAATTTATTTTTCAGAAA ACGCGTACGCGGCCGCTCGAG - GFP Tag - GTTTAA Protein Sequence: >RG231896 representing NM_001267774 Red=Cloning site Green=Tags(s) MTHLLLTATVTPSEQNSSREPGWETAMAKDILGEAGLHFDELNKLRVLDPEVTQQTIELKEECKDFVDKI GQFQKIVGGLIELVDQLAKEAENEKMKAIGARNLLKSIAKQREAQQQQLQALIAEKKMQLERYRVEYEAL CKVEAEQNEFIDQFIFQK TRTRPLE - GFP Tag - V Restriction Sites: SgfI-MluI This product is to be used for laboratory only. Not for diagnostic
    [Show full text]
  • Mouse Models of Inherited Retinal Degeneration with Photoreceptor Cell Loss
    cells Review Mouse Models of Inherited Retinal Degeneration with Photoreceptor Cell Loss 1, 1, 1 1,2,3 1 Gayle B. Collin y, Navdeep Gogna y, Bo Chang , Nattaya Damkham , Jai Pinkney , Lillian F. Hyde 1, Lisa Stone 1 , Jürgen K. Naggert 1 , Patsy M. Nishina 1,* and Mark P. Krebs 1,* 1 The Jackson Laboratory, Bar Harbor, Maine, ME 04609, USA; [email protected] (G.B.C.); [email protected] (N.G.); [email protected] (B.C.); [email protected] (N.D.); [email protected] (J.P.); [email protected] (L.F.H.); [email protected] (L.S.); [email protected] (J.K.N.) 2 Department of Immunology, Faculty of Medicine Siriraj Hospital, Mahidol University, Bangkok 10700, Thailand 3 Siriraj Center of Excellence for Stem Cell Research, Faculty of Medicine Siriraj Hospital, Mahidol University, Bangkok 10700, Thailand * Correspondence: [email protected] (P.M.N.); [email protected] (M.P.K.); Tel.: +1-207-2886-383 (P.M.N.); +1-207-2886-000 (M.P.K.) These authors contributed equally to this work. y Received: 29 February 2020; Accepted: 7 April 2020; Published: 10 April 2020 Abstract: Inherited retinal degeneration (RD) leads to the impairment or loss of vision in millions of individuals worldwide, most frequently due to the loss of photoreceptor (PR) cells. Animal models, particularly the laboratory mouse, have been used to understand the pathogenic mechanisms that underlie PR cell loss and to explore therapies that may prevent, delay, or reverse RD. Here, we reviewed entries in the Mouse Genome Informatics and PubMed databases to compile a comprehensive list of monogenic mouse models in which PR cell loss is demonstrated.
    [Show full text]
  • Enrichment of in Vivo Transcription Data from Dietary Intervention
    Hulst et al. Genes & Nutrition (2017) 12:11 DOI 10.1186/s12263-017-0559-1 RESEARCH Open Access Enrichment of in vivo transcription data from dietary intervention studies with in vitro data provides improved insight into gene regulation mechanisms in the intestinal mucosa Marcel Hulst1,3* , Alfons Jansman2, Ilonka Wijers1, Arjan Hoekman1, Stéphanie Vastenhouw3, Marinus van Krimpen2, Mari Smits1,3 and Dirkjan Schokker1 Abstract Background: Gene expression profiles of intestinal mucosa of chickens and pigs fed over long-term periods (days/ weeks) with a diet rich in rye and a diet supplemented with zinc, respectively, or of chickens after a one-day amoxicillin treatment of chickens, were recorded recently. Such dietary interventions are frequently used to modulate animal performance or therapeutically for monogastric livestock. In this study, changes in gene expression induced by these three interventions in cultured “Intestinal Porcine Epithelial Cells” (IPEC-J2) recorded after a short-term period of 2 and 6 hours, were compared to the in vivo gene expression profiles in order to evaluate the capability of this in vitro bioassay in predicting in vivo responses. Methods: Lists of response genes were analysed with bioinformatics programs to identify common biological pathways induced in vivo as well as in vitro. Furthermore, overlapping genes and pathways were evaluated for possible involvement in the biological processes induced in vivo by datamining and consulting literature. Results: For all three interventions, only a limited number of identical genes and a few common biological processes/ pathways were found to be affected by the respective interventions. However, several enterocyte-specific regulatory and secreted effector proteins that responded in vitro could be related to processes regulated in vivo, i.e.
    [Show full text]
  • Leveraging Models of Cell Regulation and GWAS Data in Integrative Network-Based Association Studies
    PERSPECTIVE Leveraging models of cell regulation and GWAS data in integrative network-based association studies Andrea Califano1–3,11, Atul J Butte4,5, Stephen Friend6, Trey Ideker7–9 & Eric Schadt10,11 Over the last decade, the genome-wide study of both heritable and straightforward: within the space of all possible genetic and epigenetic somatic human variability has gone from a theoretical concept to a variants, those contributing to a specific trait or disease likely have broadly implemented, practical reality, covering the entire spectrum some coalescent properties, allowing their effect to be functionally of human disease. Although several findings have emerged from these canalized via the cell communication and cell regulatory machin- studies1, the results of genome-wide association studies (GWAS) have ery that allows distinct cells to interact and regulates their behavior. been mostly sobering. For instance, although several genes showing Notably, contrary to random networks, whose output is essentially medium-to-high penetrance within heritable traits were identified by unconstrained, regulatory networks produced by adaptation to spe- these approaches, the majority of heritable genetic risk factors for most cific fitness landscapes are optimized to produce only a finite number common diseases remain elusive2–7. Additionally, due to impractical of well-defined outcomes as a function of a very large number of exog- requirements for cohort size8 and lack of methodologies to maximize enous and endogenous signals. Thus, if a comprehensive and accurate power for such detections, few epistatic interactions and low-pen- map of all intra- and intercellular molecular interactions were avail- etrance variants have been identified9. At the opposite end of the able, then genetic and epigenetic events implicated in a specific trait or germline versus somatic event spectrum, considering that tumor cells disease should cluster in subnetworks of closely interacting genes.
    [Show full text]
  • (NF1) As a Breast Cancer Driver
    INVESTIGATION Comparative Oncogenomics Implicates the Neurofibromin 1 Gene (NF1) as a Breast Cancer Driver Marsha D. Wallace,*,† Adam D. Pfefferle,‡,§,1 Lishuang Shen,*,1 Adrian J. McNairn,* Ethan G. Cerami,** Barbara L. Fallon,* Vera D. Rinaldi,* Teresa L. Southard,*,†† Charles M. Perou,‡,§,‡‡ and John C. Schimenti*,†,§§,2 *Department of Biomedical Sciences, †Department of Molecular Biology and Genetics, ††Section of Anatomic Pathology, and §§Center for Vertebrate Genomics, Cornell University, Ithaca, New York 14853, ‡Department of Pathology and Laboratory Medicine, §Lineberger Comprehensive Cancer Center, and ‡‡Department of Genetics, University of North Carolina, Chapel Hill, North Carolina 27514, and **Memorial Sloan-Kettering Cancer Center, New York, New York 10065 ABSTRACT Identifying genomic alterations driving breast cancer is complicated by tumor diversity and genetic heterogeneity. Relevant mouse models are powerful for untangling this problem because such heterogeneity can be controlled. Inbred Chaos3 mice exhibit high levels of genomic instability leading to mammary tumors that have tumor gene expression profiles closely resembling mature human mammary luminal cell signatures. We genomically characterized mammary adenocarcinomas from these mice to identify cancer-causing genomic events that overlap common alterations in human breast cancer. Chaos3 tumors underwent recurrent copy number alterations (CNAs), particularly deletion of the RAS inhibitor Neurofibromin 1 (Nf1) in nearly all cases. These overlap with human CNAs including NF1, which is deleted or mutated in 27.7% of all breast carcinomas. Chaos3 mammary tumor cells exhibit RAS hyperactivation and increased sensitivity to RAS pathway inhibitors. These results indicate that spontaneous NF1 loss can drive breast cancer. This should be informative for treatment of the significant fraction of patients whose tumors bear NF1 mutations.
    [Show full text]
  • Genome-Wide Association Studies for Sperm Traits in Assaf Sheep Breed
    ANIMAL-100065; No of Pages 9 Animal xxx (2021) xxx Contents lists available at ScienceDirect Animal The international journal of animal biosciences Genome-wide association studies for sperm traits in Assaf sheep breed M. Serrano a,⁎, M. Ramón b, J.H. Calvo c,f, M.Á. Jiménez a, F. Freire d, J.M. Vázquez d, J.J. Arranz e a Departamento de Mejora Genética Animal, INIA, 28040 Madrid, Spain b IRIAF-CERSYRA, Valdepeñas 13300, Ciudad Real, Spain c Unidad de Tecnología en Producción Animal, CITA, 59059 Zaragoza, Spain d OVIGEN, Granja Florencia s/n, Ctra. Villalazán-Peleagonzalo, 49800 Toro, Zamora, Spain e Departamento de Producción Animal, Universidad de León, 24007 León, Spain f ARAID, 50004 Zaragoza, Spain article info abstract Article history: Sperm quality traits routinely collected by artificial insemination (AI) center for rams progeny test are related Received 6 May 2020 with the capacity to produce sperm doses for AI and, in more or less grade, with males' fertility. Low-quality ejac- Received in revised form 20 August 2020 ulates are unuseful to perform AI sperm doses, which suppose high economic loses for the AI center. Moreover, Accepted 21 August 2020 sperm quality traits have low heritability values which make traditional genetic selection little efficient to its im- Available online xxxx provement. In this work, a genome-wide association study (GWAS) was conducted by using sperm quality traits data and 50 K Affymetrix custom chip genotypes of 429 rams of Assaf breed from OVIGEN AI centre. Furthermore, Keywords: Association study 47 of these rams were also genotyped with the Illumina HD Ovine BeadChip, and therefore HD genotypes were Pseudo-phenotypes imputed for all rams with phenotype data.
    [Show full text]
  • Supplementary Figure 1 the Mutated Amino Acid Residues of SPEF2 and Their Conservativeness Across Species
    Supplementary figure 1 The mutated amino acid residues of SPEF2 and their conservativeness across species. The conservativeness analysis was conducted using the ClustalX2 tool. Conserved residues are marked in black (100% conservativeness), dark gray (80% conservativeness), and light gray (60% conservativeness). No shading denotes the residues with less than 60% conservativeness. A B Supplementary figure 2 The SPEF2 transcripts and SPEF2 protein domains affected by the MMAF-associated SPEF2 mutations. (A) According to the Ensembl database (GRCh38), all the six protein-coding transcripts (T201 to T216) of SPEF2 are illustrated here. The SPEF2 variant c.910C>T (p.Arg304*) affects the transcripts T201, T202, T203, T211 and T216, but does not affect T212. The remaining two SPEF2 variants affect the long transcripts T202, T203 and T216. (B) The corresponding positions and affected domains of the previously reported Spef2 mutations in animals. All three human stop-gain variants of SPEF2 (shown in red) are located before the IFT20 binding domain, which has an important role in sperm tail development. This domain was truncated in all three SPEF2-mutated men. The Spef2 mutations associated with PCD-like symptoms in animals are specifically located in the CH domain. A B C D E Supplementary figure 3 Differential interference contrast microscopy (DICM) analysis of the human spermatozoa. DICM images showed normal sperm morphology in a healthy control male (A), while MMAF phenotypes were observed in a SPEF2-mutated male (B to E). The data of the SPEF2-mutated subject A028-II-1 are exemplified here. Scale bars: 5 μm. Supplementary figure 4 CFAP69 immunostaining in the spermatozoa from MMAF subjects with the CFAP251 or DNAH1 mutations.
    [Show full text]