Anti-PPP1R1B Monoclonal Antibody, Clone 4H22 (CABT-22918MH) This Product Is for Research Use Only and Is Not Intended for Diagnostic Use

Anti-PPP1R1B monoclonal antibody, clone 4H22 (CABT-22918MH) This product is for research use only and is not intended for diagnostic use.

PRODUCT INFORMATION

Antigen Description Midbrain dopaminergic neurons play a critical role in multiple brain functions, and abnormal signaling through dopaminergic pathways has been implicated in several major neurologic and psychiatric disorders. One well-studied target for the actions of dopamine is DARPP32. In the densely dopamine- and glutamate-innervated rat caudate-putamen, DARPP32 is expressed in medium-sized spiny neurons (Ouimet and Greengard, 1990 Mouse monoclonal antibody raised against a full length recombinant PPP1R1B.

Immunogen PPP1R1B (AAH01519, 1 a.a. ~ 169 a.a) full length recombinant protein with GST tag. MW of the GST tag alone is 26 KDa.

Isotype IgG2b

Source/Host Mouse

Species Reactivity Human

Clone 4H22

Conjugate Unconjugated

Applications WB,sELISA,ELISA

Sequence Similarities MLFRLSEHSSPEEEASPHQRASGEGHHLKSKRPNPCAYTPPSLKAVQRIAESHLQSISNLNENQ ASEEEDELGELRELGYPREEDEEEEEDDEEEEEEEDSQAEVLKVIRQSAGQKTTCGQGLEGPW ERPPPLDESERDGGSEDQVEDPALSEPGEEPQRPSPSEPGT*

Size 100 μg

Buffer In 1x PBS, pH 7.2

Preservative None

Storage Store at -20°C or lower. Aliquot to avoid repeated freezing and thawing.

GENE INFORMATION

45-1 Ramsey Road, Shirley, NY 11967, USA Email: [email protected]

Official Symbol PPP1R1B

Synonyms protein phosphatase 1, regulatory (inhibitor) subunit 1B; OTTHUMP00000164276; DARPP-32; dopamine and cAMP regulated phosphoprotein; FLJ20940; dopamine and cAMP-regulated neuronal phosphoprotein 32; Dopamine- and cAMP-regulated neuronal phosphoprotein; protein phosphatase 1 regulatory subunit 1B; DARPP32; protein phosphatase 1, regulatory (inhibitor) subunit 1B (dopamine and cAMPregulated phosphoprotein, DARPP-32); OTTHUMP00000164275; OTTHUMP00000164273; OTTHUMP00000164274; protein phosphatase 1, regulatory (inhibitor) subunit 1B (dopamine and cAMP regulated phosphoprotein, DARPP-32)

Entrez Gene ID 84152

Protein Refseq NP_001229393

UniProt ID A0A024R1R3

Chromosome Location 17q12

Pathway DARPP-32 events, organism-specific biosystem; Nicotine Activity on Dopaminergic Neurons, organism-specific biosystem; Opioid Signalling, organism-specific biosystem

Function protein kinase inhibitor activity; protein phosphatase inhibitor activity; receptor binding

45-1 Ramsey Road, Shirley, NY 11967, USA Email: [email protected]