Inhibition of Single Minded 2 Gene Expression Mediates Tumor-Selective Apoptosis and Differentiation in Human Colon Cancer Cells

Total Page:16

File Type:pdf, Size:1020Kb

Load more

Inhibition of Single Minded 2 gene expression mediates tumor-selective apoptosis and differentiation in human colon cancer cells Mireille J. Aleman*†‡§, Maurice Phil DeYoung*†§¶, Matthew Tress*†, Patricia Keating*†, Gary W. Perryʈ, and Ramaswamy Narayanan*†** *Center for Molecular Biology and Biotechnology, Departments of †Biology and ‡Chemistry, and ¶Center for Complex System and Brain Sciences, Florida Atlantic University, 777 Glades Road, Boca Raton, FL 33431 Communicated by Herbert Weissbach, Florida Atlantic University, Boca Raton, FL, July 21, 2005 (received for review April 4, 2005) A Down’s syndrome associated gene, Single Minded 2 gene short bound AhR͞ARNT complex (12) and hence prevent carcinogen form (SIM2-s), is specifically expressed in colon tumors but not in metabolism, leading to cumulative DNA damage and cancer. the normal colon. Antisense inhibition of SIM2-s in a RKO-derived The growth arrest and DNA damage (GADD) family of genes colon carcinoma cell line causes growth inhibition, apoptosis, and was originally isolated from UV radiation-treated cells and subse- inhibition of tumor growth in a nude mouse tumoriginicity model. quently grouped according to their coordinate regulation by growth The mechanism of cell death in tumor cells is unclear. In the present arrest and DNA damage (13). The GADD family members include study, we investigated the pathways underlying apoptosis. Apo- GADD34,-45␣,-45␤,-45␥, and -153 (14, 15). These are stress- ptosis was seen in a tumor cell-specific manner in RKO cells but not response genes induced by both genotoxic and nongenotoxic in normal renal epithelial cells, despite inhibition of SIM2-s expres- stresses (16–18). GADD45␣ is the most extensively studied mem- sion in both of these cells by the antisense. Apoptosis was de- ber of the family and is regulated in both a p53-dependent and pended on WT p53 status and was caspase-dependent; it was -independent manner (13, 19). GADD45␣-mediated apoptosis may inhibited by a pharmacological inhibitor of mitogen-activated involve activation of JNK and͞or p38 mitogen-activated protein protein kinase activity. Expression of a key stress response gene, kinase (MAPK) signaling pathways (14, 20). CELL BIOLOGY growth arrest and DNA damage gene (GADD)45␣, was up-regu- We have recently demonstrated that the SIM2 short-form lated in antisense-treated tumor cells but not in normal cells. In an (SIM2-s) gene is specifically expressed in distinct solid tumors, isogenic RKO cell line expressing stable antisense RNA to including colon, pancreas, and prostate, but not in the correspond- GADD45␣, a significant protection of the antisense-induced apo- ing normal tissues (21–23). Antisense inhibition of SIM2-s expres- ptosis was seen. Whereas antisense-treated RKO cells did not sion caused apoptosis in colon and pancreatic cancer-derived cells. undergo cell cycle arrest, several markers of differentiation were In an effort to understand the molecular mechanism underlying the deregulated, including alkaline phosphatase activity, a marker of role of SIM2-s in tumor cell growth, we have embarked on mapping terminal differentiation. Protection of apoptosis and block of the key pathways linked to SIM2-s. We show that apoptosis is tumor differentiation showed a correlation in the RKO model. Our results cell-selective and requires GADD45␣ function. Further, we dem- support the tumor cell-selective nature of SIM2-s gene function, onstrate that key pathways, including caspase, p38 MAPK activities, provide a direct link between SIM2-s and differentiation, and may and WT p53 status, are critical to apoptosis. Our results link provide a model to identify SIM2-s targets. apoptosis to induction of tumor cell-selective differentiation. Down’s syndrome ͉ antisense ͉ p53 Methods Cell Culture. Isogenic colon cancer-derived cell lines (RKO, RKO- ␣ he Single Minded 2 (SIM2) gene is present in chromosome 21 E6-p53- knockout, and RKO-AS45.1-stable GADD45 antisense Tat the Down’s syndrome critical region, which in triplication is clone) and OM-1 and SW 480 colon carcinoma-derived cells were associated with diverse phenotypic characteristics of Down’s syn- obtained from American Type Culture Collection and were main- drome (1). Patients with Down’s syndrome show various neurolog- tained as recommended by American Type Culture Collection. ical symptoms and a high incidence of leukemia (1, 2). Members of Early-passage primary human renal epithelial (HRE) cells were the SIM family include SIM1 and SIM2, which map to 6q16.3-q21 obtained from Cambrex (Walkersville, MD) and were cultured and 21q22.2, respectively (3), and belong to a family of transcription following the manufacturer’s instructions. factors containing a basic helix–loop–helix motif, two period ho- mologue (PER)͞ARNT͞SIM (ARNT, aryl hydrocarbon receptor Inhibitors and Antibodies. Antisense SIM2-s was synthesized as nuclear translocator) domains, and the HIF1␣͞SIM͞TRH domains described (22). Methylmethane sulfonate was obtained from Sigma (4–6). In Drosophila, SIM is a master regulator of fruit-fly neuro- Aldrich. Caspase-family inhibitor set IV was obtained from Biovi- genesis, regulating midline gene expression (6, 7). The SIM2 gene sion (Mountain View, CA). p38 kinase inhibitor (SB202190) was exists in two distinct forms, the long and short forms (SIM2-l and obtained from A. G. Scientific (San Diego). General tyrosine SIM2-s), due to alternative splicing (3). A putative cancer-related kinase inhibitor (Genistein) was from Sigma Aldrich. Antibodies role of the SIM family of genes is their ability to transcriptionally were obtained from Santa Cruz Biotechnology. regulate key metabolic enzymes to inactivate carcinogens (8). Binding of carcinogens to the aryl hydrocarbon receptor (AhR), Abbreviations: ALP, alkaline phosphatase; GADD, growth arrest and DNA damage gene; which is kept sequestered in the cytoplasm by heat-shock protein MAPK, mitogen-activated protein kinase; SIM2, Single Minded 2; SIM2-s, SIM2 short form; (HSP) 90 (9), dissociates HSP 90. The ligand-bound AhR is then HRE, human renal epithelial. translocated into the nucleus, where it can dimerize with ARNT §M.J.A. and M.P.D. contributed equally to this work. (10). This complex binds to the xenobiotic response element, ¶Present address: Massachusetts General Hospital and Harvard Medical School, Boston, present in the promoters of key oxidative enzymes, and activates MA 02114. gene transcription (8, 11), thus causing inactivation of the carcin- **To whom correspondence should be addressed. E-mail: [email protected]. ogen. The SIM proteins can inhibit the dimerization of the ligand- © 2005 by The National Academy of Sciences of the USA www.pnas.org͞cgi͞doi͞10.1073͞pnas.0505484102 PNAS ͉ September 6, 2005 ͉ vol. 102 ͉ no. 36 ͉ 12765–12770 Downloaded by guest on September 29, 2021 RT-PCR. End-point RT-PCR analysis and primers used were de- To further clarify the apoptotic mechanism, we next used specific scribed previously (22, 23). Quantitative real-time PCR was done by pathway inhibitors. The RKO cells were significantly protected using ␤2 microglobulin standards (Roche Applied Sciences, Indi- from apoptosis induced by SIM2-s antisense by both general anapolis). Exon-specific RT-PCR primers were used (see Table 1, (Z-VAD-FMK) and specific caspase inhibitors (caspase 9 and 10). which is published as supporting information on the PNAS This effect was not seen when caspase 2 or 8 inhibitors were used web site). (Fig. 1D). Inhibitors of other caspases (caspases 3, 4, 5, 6, and 13) showed only marginal protection (10–15%) against apoptosis (data Cell Cycle and FACS Analysis of GADD45␣ Protein. Cells were har- not shown). To further map the signal transduction involved in vested after 100 nM antisense or control oligo treatment and fixed apoptosis, we next used key kinase pathway pharmacological in- at 4°C overnight in 70% ethanol. The fixed cells were resuspended hibitors. Significant protection from apoptosis was seen when the in PBS and treated with 20 ␮g͞ml RNaseA for 30 min at 37°C, RKO cells were pretreated with a p38 MAPK pathway inhibitor stained with 60 ␮g͞ml propidium iodide at room temperature for (SB 202190). As a control, we used Genistein, a nonspecific tyrosine 30 min, and scanned by an Epics XL-MCL Flow Cytometer kinase inhibitor, which did not cause such a protection (Fig. 1E). (Beckman Coulter). Cell cycle distribution was calculated by using Treatment of RKO cells with these inhibitors alone did not cause MULTICYCLE V.3.1.1 software (Phoenix Flow Systems, San Diego). apoptosis (data not shown). GADD45␣ protein expression was analyzed in antisense-treated We next addressed whether apoptosis mediated by the inhibition RKO or HRE cells by using either GADD45␣-phycoerythrin of SIM2-s expression depends on p53 tumor suppressor gene (PE)-conjugated antibody or its IgG1 isotype control PE- function. Isogenic RKO (WT p53) or RKO-E6 (p53 functional conjugated antibody by using an Epics XL-MCL Flow Cytometer knockout by HPV-E6 oncogene) cells were treated either with the (Beckman Coulter). control oligo or SIM2-s antisense and at the indicated time analyzed by apoptosis ELISA (Fig. 1F). In the isogenic RKO E6 cells, SIM2-s Caspase and p38 Kinase Inhibitor Experiments. For inhibitor studies, antisense-induced apoptosis was 4- to 5-fold reduced. the cells were pretreated with 20 ␮M caspase inhibitors, 20 ␮M SB202190 (p38 MAPK inhibitor), or 10 ␮M Genistein (general Identification of GADD45␣ as a Critical Mediator of SIM2-s Antisense tyrosine kinase inhibitor) for 1 h before transfection with the Mechanism. Up-regulation of GADD genes is often seen in tumor oligonucleotides and then continuously incubated with the inhibi- cells undergoing apoptosis. Hence we investigated the regulation of tors. At select time points, apoptosis was measured by using the Cell GADD family members in the SIM2-s antisense-treated RKO cells Death Detection ELISAPlus (Roche Applied Science), as described (Fig. 2A). The inhibition of SIM2-s by antisense in RKO cells (23).
Recommended publications
  • Variations in Microrna-25 Expression Influence the Severity of Diabetic

    Variations in Microrna-25 Expression Influence the Severity of Diabetic

    BASIC RESEARCH www.jasn.org Variations in MicroRNA-25 Expression Influence the Severity of Diabetic Kidney Disease † † † Yunshuang Liu,* Hongzhi Li,* Jieting Liu,* Pengfei Han, Xuefeng Li, He Bai,* Chunlei Zhang,* Xuelian Sun,* Yanjie Teng,* Yufei Zhang,* Xiaohuan Yuan,* Yanhui Chu,* and Binghai Zhao* *Heilongjiang Key Laboratory of Anti-Fibrosis Biotherapy, Medical Research Center, Heilongjiang, People’s Republic of China; and †Clinical Laboratory of Hong Qi Hospital, Mudanjiang Medical University, Heilongjiang, People’s Republic of China ABSTRACT Diabetic nephropathy is characterized by persistent albuminuria, progressive decline in GFR, and second- ary hypertension. MicroRNAs are dysregulated in diabetic nephropathy, but identification of the specific microRNAs involved remains incomplete. Here, we show that the peripheral blood from patients with diabetes and the kidneys of animals with type 1 or 2 diabetes have low levels of microRNA-25 (miR-25) compared with those of their nondiabetic counterparts. Furthermore, treatment with high glucose decreased the expression of miR-25 in cultured kidney cells. In db/db mice, systemic administration of an miR-25 agomir repressed glomerular fibrosis and reduced high BP. Notably, knockdown of miR-25 in normal mice by systemic administration of an miR-25 antagomir resulted in increased proteinuria, extracellular matrix accumulation, podocyte foot process effacement, and hypertension with renin-angiotensin system activation. However, excessive miR-25 did not cause kidney dysfunction in wild-type mice. RNA sequencing showed the alteration of miR-25 target genes in antagomir-treated mice, including the Ras-related gene CDC42. In vitro,cotrans- fection with the miR-25 antagomir repressed luciferase activity from a reporter construct containing the CDC42 39 untranslated region.
  • GADD45 Induction of a G2/M Cell Cycle Checkpoint

    GADD45 Induction of a G2/M Cell Cycle Checkpoint

    Proc. Natl. Acad. Sci. USA Vol. 96, pp. 3706–3711, March 1999 Cell Biology GADD45 induction of a G2/M cell cycle checkpoint XIN WEI WANG*, QIMIN ZHAN†,JILL D. COURSEN*, MOHAMMED A. KHAN*, H. UDO KONTNY†,LIJIA YU‡, M. CHRISTINE HOLLANDER†,PATRICK M. O’CONNOR‡,ALBERT J. FORNACE,JR.†, AND CURTIS C. HARRIS*§ *Laboratory of Human Carcinogenesis, †Laboratory of Biological Chemistry, and ‡Laboratory of Molecular Pharmacology, Division of Basic Science, National Cancer Institute, National Institutes of Health, Bethesda, MD 20892 Communicated by Theodore T. Puck, Eleanor Roosevelt Institute for Cancer Research, Denver, CO, January 12, 1999 (received for review November 30, 1998) ABSTRACT G1yS and G2yM cell cycle checkpoints main- p53-deficient mice, p21-deficient mice undergo normal develop- tain genomic stability in eukaryotes in response to genotoxic ment and normal apoptotic response, and do not have an stress. We report here both genetic and functional evidence of a increased frequency of spontaneous malignancies (11, 16). These y Gadd45-mediated G2yM checkpoint in human and murine cells. data indicate that factors other than p21 in the G1 S checkpoint Increased expression of Gadd45 via microinjection of an expres- pathway may be required for p53-mediated tumor suppression. sion vector into primary human fibroblasts arrests the cells at Alternatively, other p53-mediated checkpoints may play more the G yM boundary with a phenotype of MPM2 immunoposi- important roles in the prevention of tumorigenesis. 2 y y tivity, 4n DNA content and, in 15% of the cells, centrosome In contrast to the G1 S checkpoint, the mammalian G2 M separation. The Gadd45-mediated G2yM arrest depends on checkpoint is poorly understood.
  • Association of Gene Ontology Categories with Decay Rate for Hepg2 Experiments These Tables Show Details for All Gene Ontology Categories

    Association of Gene Ontology Categories with Decay Rate for Hepg2 Experiments These Tables Show Details for All Gene Ontology Categories

    Supplementary Table 1: Association of Gene Ontology Categories with Decay Rate for HepG2 Experiments These tables show details for all Gene Ontology categories. Inferences for manual classification scheme shown at the bottom. Those categories used in Figure 1A are highlighted in bold. Standard Deviations are shown in parentheses. P-values less than 1E-20 are indicated with a "0". Rate r (hour^-1) Half-life < 2hr. Decay % GO Number Category Name Probe Sets Group Non-Group Distribution p-value In-Group Non-Group Representation p-value GO:0006350 transcription 1523 0.221 (0.009) 0.127 (0.002) FASTER 0 13.1 (0.4) 4.5 (0.1) OVER 0 GO:0006351 transcription, DNA-dependent 1498 0.220 (0.009) 0.127 (0.002) FASTER 0 13.0 (0.4) 4.5 (0.1) OVER 0 GO:0006355 regulation of transcription, DNA-dependent 1163 0.230 (0.011) 0.128 (0.002) FASTER 5.00E-21 14.2 (0.5) 4.6 (0.1) OVER 0 GO:0006366 transcription from Pol II promoter 845 0.225 (0.012) 0.130 (0.002) FASTER 1.88E-14 13.0 (0.5) 4.8 (0.1) OVER 0 GO:0006139 nucleobase, nucleoside, nucleotide and nucleic acid metabolism3004 0.173 (0.006) 0.127 (0.002) FASTER 1.28E-12 8.4 (0.2) 4.5 (0.1) OVER 0 GO:0006357 regulation of transcription from Pol II promoter 487 0.231 (0.016) 0.132 (0.002) FASTER 6.05E-10 13.5 (0.6) 4.9 (0.1) OVER 0 GO:0008283 cell proliferation 625 0.189 (0.014) 0.132 (0.002) FASTER 1.95E-05 10.1 (0.6) 5.0 (0.1) OVER 1.50E-20 GO:0006513 monoubiquitination 36 0.305 (0.049) 0.134 (0.002) FASTER 2.69E-04 25.4 (4.4) 5.1 (0.1) OVER 2.04E-06 GO:0007050 cell cycle arrest 57 0.311 (0.054) 0.133 (0.002)
  • The Oestrogen Receptor Alpha-Regulated Lncrna NEAT1 Is a Critical Modulator of Prostate Cancer

    The Oestrogen Receptor Alpha-Regulated Lncrna NEAT1 Is a Critical Modulator of Prostate Cancer

    ARTICLE Received 5 Dec 2013 | Accepted 26 Sep 2014 | Published 21 Nov 2014 DOI: 10.1038/ncomms6383 OPEN The oestrogen receptor alpha-regulated lncRNA NEAT1 is a critical modulator of prostate cancer Dimple Chakravarty1,2, Andrea Sboner1,2,3, Sujit S. Nair4, Eugenia Giannopoulou5,6, Ruohan Li7, Sven Hennig8, Juan Miguel Mosquera1,2, Jonathan Pauwels1, Kyung Park1, Myriam Kossai1,2, Theresa Y. MacDonald1, Jacqueline Fontugne1,2, Nicholas Erho9, Ismael A. Vergara9, Mercedeh Ghadessi9, Elai Davicioni9, Robert B. Jenkins10, Nallasivam Palanisamy11,12, Zhengming Chen13, Shinichi Nakagawa14, Tetsuro Hirose15, Neil H. Bander16, Himisha Beltran1,2, Archa H. Fox7, Olivier Elemento2,3 & Mark A. Rubin1,2 The androgen receptor (AR) plays a central role in establishing an oncogenic cascade that drives prostate cancer progression. Some prostate cancers escape androgen dependence and are often associated with an aggressive phenotype. The oestrogen receptor alpha (ERa)is expressed in prostate cancers, independent of AR status. However, the role of ERa remains elusive. Using a combination of chromatin immunoprecipitation (ChIP) and RNA-sequencing data, we identified an ERa-specific non-coding transcriptome signature. Among putatively ERa-regulated intergenic long non-coding RNAs (lncRNAs), we identified nuclear enriched abundant transcript 1 (NEAT1) as the most significantly overexpressed lncRNA in prostate cancer. Analysis of two large clinical cohorts also revealed that NEAT1 expression is asso- ciated with prostate cancer progression. Prostate cancer cells expressing high levels of NEAT1 were recalcitrant to androgen or AR antagonists. Finally, we provide evidence that NEAT1 drives oncogenic growth by altering the epigenetic landscape of target gene promoters to favour transcription. 1 Department of Pathology and Laboratory Medicine, Weill Medical College of Cornell University, 413 East 69th Street, Room 1402, New York, New York 10021, USA.
  • Genetic Deletion Ofgadd45b, a Regulator of Active DNA

    Genetic Deletion Ofgadd45b, a Regulator of Active DNA

    The Journal of Neuroscience, November 28, 2012 • 32(48):17059–17066 • 17059 Brief Communications Genetic Deletion of gadd45b, a Regulator of Active DNA Demethylation, Enhances Long-Term Memory and Synaptic Plasticity Faraz A. Sultan,1 Jing Wang,1 Jennifer Tront,2 Dan A. Liebermann,2 and J. David Sweatt1 1Department of Neurobiology and Evelyn F. McKnight Brain Institute, University of Alabama at Birmingham, Birmingham, Alabama 35294 and 2Fels Institute for Cancer Research and Molecular Biology, Temple University, Philadelphia, Pennsylvania 19140 Dynamic epigenetic mechanisms including histone and DNA modifications regulate animal behavior and memory. While numerous enzymes regulating these mechanisms have been linked to memory formation, the regulation of active DNA demethylation (i.e., cytosine-5 demethylation) has only recently been investigated. New discoveries aim toward the Growth arrest and DNA damage- inducible 45 (Gadd45) family, particularly Gadd45b, in activity-dependent demethylation in the adult CNS. This study found memory- associated expression of gadd45b in the hippocampus and characterized the behavioral phenotype of gadd45b Ϫ/Ϫ mice. Results indicate normal baseline behaviors and initial learning but enhanced persisting memory in mutants in tasks of motor performance, aversive conditioning and spatial navigation. Furthermore, we showed facilitation of hippocampal long-term potentiation in mutants. These results implicate Gadd45b as a learning-induced gene and a regulator of memory formation and are consistent with its potential role in active DNA demethylation in memory. Introduction along with the finding of activity-induced gadd45b in the hip- Alterations in neuronal gene expression play a necessary role pocampus led us to hypothesize that Gadd45b modulates mem- in memory consolidation (Miyashita et al., 2008).
  • Gadd45a Regulates B-Catenin Distribution and Maintains Cell–Cell Adhesion/ Contact

    Gadd45a Regulates B-Catenin Distribution and Maintains Cell–Cell Adhesion/ Contact

    Oncogene (2007) 26, 6396–6405 & 2007 Nature Publishing Group All rights reserved 0950-9232/07 $30.00 www.nature.com/onc ORIGINAL ARTICLE Gadd45a regulates b-catenin distribution and maintains cell–cell adhesion/ contact JJi1, R Liu1, T Tong, Y Song, S Jin, M Wu and Q Zhan State Key Laboratory of Molecular Oncology, Cancer Institute, Chinese Academy of Medical Sciences & Peking Union Medical College, Beijing, PR China Gadd45a,a growth arrest and DNA-damage gene,plays 1999;Jin et al., 2000;Tong et al., 2005). Gadd45a important roles in the control of cell cycle checkpoints, also plays roles in negative regulation of cell malig- DNA repair and apoptosis. We show here that Gadd45a is nancy. Mouse embryonic fibroblasts (MEFs) derived involved in the control of cell contact inhibition and cell– from Gadd45a-null mice exhibited genomic instability, cell adhesion. Gadd45a can serve as an adapter to enhance single oncogene-mediated transformation, loss of nor- the interaction between b-catenin and Caveolin-1,and in mal cellular senescence, increased cellular proliferation, turn induces b-catenin translocation to cell membrane for centrosome amplification and reduced DNA repair maintaining cell–cell adhesion/contact inhibition. This is (Hollander et al., 1999;Smith et al., 2000). Gadd45a- coupled with reduction of b-catenin in cytoplasm and null mice have an increased frequency of tumorigenesis nucleus following Gadd45a induction,which is reflected by by ionizing radiation (IR), ultraviolet radiation (UVR) the downregulation of cyclin D1,one of the b-catenin and dimethylbenzanthracene (DMBA), although these targeted genes. Additionally,Gadd45a facilitates ultra- mice do not develop spontaneous tumors (Hollander violet radiation-induced degradation of cytoplasmic and et al., 1999, 2001;Hildesheim et al., 2002).
  • Download Download

    Download Download

    NEUROSCIENCE RESEARCH NOTES OPEN ACCESS | RESEARCH NOTES ISSN: 2576-828X Transcriptomic profiling of skeletal muscle from the Ts1Cje mouse model of Down syndrome suggests dysregulation of trisomic genes associated with neuromuscular junction signaling, oxidative stress and chronic inflammation Melody Pui Yee Leong 1,2, Usman Bala 2,3, Chai Ling Lim 2,3, Rozita Rosli 1,2, Pike-See Cheah 2,3 and King-Hwa Ling 1,2,* 1 Department of Biomedical Science, Faculty of Medicine and Health Sciences, Universiti Putra Malaysia, 43400 UPM Serdang, Selangor, Malaysia. 2 Genetics and Regenerative Medicine Research Centre (GRMRC), Faculty of Medicine and Health Sciences, Universiti Putra Malaysia, 43400 UPM Serdang, Selangor, Malaysia. 3 Department of Human Anatomy, Faculty of Medicine and Health Sciences, Universiti Putra Malaysia, 43400 UPM Serdang, Selangor, Malaysia. * Correspondence: [email protected]; Tel.: +603-8947 2564 Received: 10 May 2018; Accepted: 21 August 2018; Published: 27 August 2018 Edited by: Azlina Ahmad Annuar (University of Malaya, Malaysia) Reviewed by: Ruth Chia (National Institute on Aging, National Institutes of Health, USA); Shelisa Tey (Institute of Neuropathology, RWTH University Hospital Aachen, Germany) DOI: https://doi.org/10.31117/neuroscirn.v1i1.12 Abstract: Ts1Cje is a mouse model of Down syndrome (DS) with partial triplication of chromosome 16, which encompasses a high number of human chromosome 21 (HSA21) orthologous genes. The mouse model exhibits muscle weakness resembling hypotonia in DS individuals. The effect of extra gene dosages on muscle weakness or hypotonia in Ts1Cje and DS individuals remains unknown. To identify molecular dysregulation of the skeletal muscle, we compared the transcriptomic signatures of soleus and extensor digitorum longus (EDL) muscles between the adult Ts1Cje and disomic littermates.
  • The Nuclear Hormone Receptor Coactivator SRC-1 Is a Specific Target of P300 TSO-PANG YAO, GREGORY Ku, NAIDONG ZHOU, RALPH SCULLY, and DAVID M

    The Nuclear Hormone Receptor Coactivator SRC-1 Is a Specific Target of P300 TSO-PANG YAO, GREGORY Ku, NAIDONG ZHOU, RALPH SCULLY, and DAVID M

    Proc. Natl. Acad. Sci. USA Vol. 93, pp. 10626-10631, October 1996 Biochemistry The nuclear hormone receptor coactivator SRC-1 is a specific target of p300 TSO-PANG YAO, GREGORY Ku, NAIDONG ZHOU, RALPH SCULLY, AND DAVID M. LIvINGSTON* Dana-Farber Cancer Institute and Harvard Medical School, 44 Binney Street, Boston, MA 02115 Contributed by David M. Livingston, June 17, 1996 ABSTRACT p300 and its family member, CREB-binding derlying ligand activation of nuclear receptor transcription protein (CBP), function as key transcriptional coactivators by activity. virtue of their interaction with the activated forms of certain Specifically, it has been shown that, upon ligand binding, a transcription factors. In a search for additional cellular specific set of proteins are recruited to the hormone bound targets of p300/CBP, a protein-protein cloning strategy, (i.e., activated) receptor (11-13). It was hypothesized that surprisingly identified SRC-1, a coactivator involved in nu- these multiprotein complexes assemble and become transcrip- clear hormone receptor transcriptional activity, as a p300/ tionally active in response to hormone binding. Identifying and CBP interactive protein. p300 and SRC-1 interact, specifically, understanding how individual components of these complexes in vitro and they also form complexes in vivo. Moreover, we function are part of the key to understand how nuclear show that SRC-1 encodes a new member of the basic helix- receptors modulate transcription. Recently, one of the nuclear loop-helix-PAS domain family and that it physically interacts receptor-binding proteins, steroid receptor coactivator-1 with the retinoic acid receptor in response to hormone bind- (SRC-1), was identified and cloned.
  • DNA Excision Repair Proteins and Gadd45 As Molecular Players for Active DNA Demethylation

    DNA Excision Repair Proteins and Gadd45 As Molecular Players for Active DNA Demethylation

    Cell Cycle ISSN: 1538-4101 (Print) 1551-4005 (Online) Journal homepage: http://www.tandfonline.com/loi/kccy20 DNA excision repair proteins and Gadd45 as molecular players for active DNA demethylation Dengke K. Ma, Junjie U. Guo, Guo-li Ming & Hongjun Song To cite this article: Dengke K. Ma, Junjie U. Guo, Guo-li Ming & Hongjun Song (2009) DNA excision repair proteins and Gadd45 as molecular players for active DNA demethylation, Cell Cycle, 8:10, 1526-1531, DOI: 10.4161/cc.8.10.8500 To link to this article: http://dx.doi.org/10.4161/cc.8.10.8500 Published online: 15 May 2009. Submit your article to this journal Article views: 135 View related articles Citing articles: 92 View citing articles Full Terms & Conditions of access and use can be found at http://www.tandfonline.com/action/journalInformation?journalCode=kccy20 Download by: [University of Pennsylvania] Date: 27 April 2017, At: 12:48 [Cell Cycle 8:10, 1526-1531; 15 May 2009]; ©2009 Landes Bioscience Perspective DNA excision repair proteins and Gadd45 as molecular players for active DNA demethylation Dengke K. Ma,1,2,* Junjie U. Guo,1,3 Guo-li Ming1-3 and Hongjun Song1-3 1Institute for Cell Engineering; 2Department of Neurology; and 3The Solomon Snyder Department of Neuroscience; Johns Hopkins University School of Medicine; Baltimore, MD USA Abbreviations: DNMT, DNA methyltransferases; PGCs, primordial germ cells; MBD, methyl-CpG binding protein; NER, nucleotide excision repair; BER, base excision repair; AP, apurinic/apyrimidinic; SAM, S-adenosyl methionine Key words: DNA demethylation, Gadd45, Gadd45a, Gadd45b, Gadd45g, 5-methylcytosine, deaminase, glycosylase, base excision repair, nucleotide excision repair DNA cytosine methylation represents an intrinsic modifica- silencing of gene activity or parasitic genetic elements (Fig.
  • The Role of Npas4 in Neuroprotection and Neurogenesis

    The Role of Npas4 in Neuroprotection and Neurogenesis

    !!"$ &#!"#!%%! &#! $$ ! !( %$$$&%%!#%#! !%!#!!$!"( "#% % ! %$ '!&%! !!! !! $ '#$%(! # ,01;4 >5>=C4=CB 42;0A0C8>= 2:=>F;4364<4=CB 1BCA02C 70?C4A "=CA>3D2C8>= *4E84F(0?4A *46D;0C8>=>5'?0B4G?A4BB8>=1H>C74A<4270=8B<B -*',*'("#&(&&,(+ 0(*++#'& (+ 0(*++#'&#&*+('&+,'# *&,,1(+' +,*++ 338C8>=0;5D=2C8>=B>5'?0B 0#,,#'&#&"##,#'&"'%'+,+#+ -*'!&+#+ &82A>*'B #'!&+#+' %# + %# +#&&-*'!&+#+ (A>942CA0C8>=0;40=3A4B40A2708<B 70?C4A *4B40A27?0?4A 70?C4A *4B40A27?0?4A 70?C4A 8BC8=2C8E4?A>58;4>58B><8*4G?A4BB8>=0=3=>E4;<82A>*'B3DA8=6=4DA0; 38554A4=C80C8>=>5<>DB44<1AH>=82BC4<24;;B "=CA>3D2C8>= *4BD;CB0=338B2DBB8>= .*.#/' +%$$ +)-&#&!, -&&' #+'%#+)-&+ &,# #,#'&' &'.$%# + >=2;DB8>= 70?C4A >=2;D38=6*4<0A:B (A>942CB86=85820=24 *42><<4=30C8>=B5>A5DAC74AF>A: *454A4=24 42;0A0C8>= 5FGQUMPIAMLR?GLQLMK?RCPG?JUFGAFF?Q@CCL?AACNRCBDMPRFC?U?PBMD?LWMRFCPBCEPCC MPBGNJMK?GL?LWSLGTCPQGRWMPMRFCPRCPRG?PWGLQRGRSRGML?LB RMRFC@CQRMDKWILMUJCBEC ?LB@CJGCD AMLR?GLQLMK?RCPG?JNPCTGMSQJWNS@JGQFCBMPUPGRRCL@W?LMRFCP NCPQML CVACNR UFCPCBSCPCDCPCLACF?Q@CCLK?BCGLRFCRCVR *EGTCAMLQCLRRMRFGQAMNWMDKWRFCQGQ UFCLBCNMQGRCBGLRFC6LGTCPQGRW-G@P?PW @CGLE K?BC?T?GJ?@JCDMPJM?L?LBNFMRMAMNWGLE QS@HCARRMRFCNPMTGQGMLQMDRFC$MNWPGEFR"AR *?JQM EGTCNCPKGQQGMLDMPRFCBGEGR?JTCPQGMLMDKWRFCQGQRM@CK?BC?T?GJ?@JCMLRFCUC@ TG?RFC6LGTCPQGRWmQBGEGR?JPCQC?PAFPCNMQGRMPW RFC-G@P?PWA?R?JMESC?LB?JQMRFPMSEFUC@ QC?PAFCLEGLCQ SLJCQQNCPKGQQGMLF?Q@CCLEP?LRCB@WRFC6LGTCPQGRWRMPCQRPGAR?AACQQDMP? NCPGMBMDRGKC 4GELCB %?RC 2:=>F;4364<4=CB *UMSJBJGICRMR?ICRFGQMNNMPRSLGRWRMCVNPCQQKWSRKMQREP?RGRSBCRMK?LWGLBGTGBS?JQUFM
  • Ohnologs in the Human Genome Are Dosage Balanced and Frequently Associated with Disease

    Ohnologs in the Human Genome Are Dosage Balanced and Frequently Associated with Disease

    Ohnologs in the human genome are dosage balanced and frequently associated with disease Takashi Makino1 and Aoife McLysaght2 Smurfit Institute of Genetics, University of Dublin, Trinity College, Dublin 2, Ireland Edited by Michael Freeling, University of California, Berkeley, CA, and approved April 9, 2010 (received for review December 21, 2009) About 30% of protein-coding genes in the human genome are been duplicated by WGD, subsequent loss of individual genes related through two whole genome duplication (WGD) events. would result in a dosage imbalance due to insufficient gene Although WGD is often credited with great evolutionary impor- product, thus leading to biased retention of dosage-balanced tance, the processes governing the retention of these genes and ohnologs. In fact, evidence for preferential retention of dosage- their biological significance remain unclear. One increasingly pop- balanced genes after WGD is accumulating (4, 7, 11–20). Copy ular hypothesis is that dosage balance constraints are a major number variation [copy number polymorphism (CNV)] describes determinant of duplicate gene retention. We test this hypothesis population level polymorphism of small segmental duplications and show that WGD-duplicated genes (ohnologs) have rarely and is known to directly correlate with gene expression levels (21– experienced subsequent small-scale duplication (SSD) and are also 24). Thus, CNV of dosage-balanced genes is also expected to be refractory to copy number variation (CNV) in human populations deleterious. This model predicts that retained ohnologs should be and are thus likely to be sensitive to relative quantities (i.e., they are enriched for dosage-balanced genes that are resistant to sub- dosage-balanced).
  • The Molecular Pathogenesis of Down Syndrome-Associated Diseases And

    The Molecular Pathogenesis of Down Syndrome-Associated Diseases And

    Clinical and Medical Investigations Editorial ISSN: 2398-5763 The molecular pathogenesis of down syndrome-associated diseases and the promising potential therapeutic targets Mohammed Rachidi Molecular Genetics of Human Diseases (MGHD), French Polynesia and University Paris 7 Denis Diderot, Paris, France Trisomy 21, the most common origin of Down syndrome, is an development [7]. Colon carcinoma cell lines selected for increased extra copy of chromosome 21 in all cells generated by a chromosomal metastatic potential in nude mice express more TIAM1 protein non-disjunction during meiosis. The increased transcription of than their parental line [8,9]. This indicate that TIAM1 may have a the oncogenes and tumor suppressor genes located on the human role in the progression and metastasis of colon carcinomas and that chromosome 21 determines transcriptional alterations of several TIAM1 regulates cell adhesion, migration and apoptosis in colon molecular pathways involved in the Down syndrome associated tumor cells. RNA interference (RNAi) study examined the effect of diseases related to cell cycle alteration, leukemia, tumors and cancer. the inhibition of TIAM1 expression on proliferation and metastasis The elucidation of the molecular mechanisms involved in the Down and it has been found that the silencing of TIAM1 resulted in the syndrome-associated diseases could promise potential therapeutic effective inhibition of in vitro cell growth and of the invasive ability of targets. colorectal cancer cells. This suggest that TIAM1 plays a causal role in the metastasis of colorectal cancer and that RNAi-mediated silencing Trisomy 21 or Down syndrome determined by the triplication of of TIAM1 may provide an opportunity to develop a new treatment human chromosome 21, is the most frequent genetic disorder with strategy for colorectal cancer [10].