DOCSLIB.ORG

Boldnesian 1963 Bold Reasoning 1968 Seattle Slew 1974 Reason to Earn 1963 Poker 1963 My Charmer 1969 A.P. Indy 1989 Fair

Total Page：16

File Type：pdf, Size：1020Kb

Download full-text PDF Read full-text
Boldnesian 1963 Bold Reasoning 1968 Seattle Slew 1974 Reason to Earn 1963 Poker 1963 My Charmer 1969 A.P. Indy 1989 Fair Boldnesian 1963 Bold Reasoning 1968 Seattle Slew 1974 Reason to Earn 1963 Poker 1963 My Charmer 1969 A.P. Indy 1989 Fair Charmer 1959 Bold Ruler 1954 Secretariat 1970 Weekend Surprise 1980 Somethingroyal 1952 Buckpasser 1963 Lassie Dear 1974 Congrats Gay Missile 1967 (2000) Native Dancer 1950 Raise a Native 1961 Mr. Prospector 1970 Raise You 1946 Nashua 1952 Gold Digger 1962 Praise 1994 Sequence 1946 Nearctic 1954 Northern Dancer 1961 Wild Applause 1981 Natalma 1957 Graustark 1963 King Kongrats b c Glowing Tribute 1973 Foaled April 2, 2011 Admiring 1962 in Florida Boldnesian 1963 Bold Reasoning 1968 Seattle Slew 1974 Reason to Earn 1963 Poker 1963 My Charmer 1969 Slewacide 1980 Fair Charmer 1959 Tom Fool 1949 Buckpasser 1963 Evasive 1970 Busanda 1947 Summer Tan 1952 Summer Scandal 1962 King's Pact Go-Modern 1954 (1995) Free for All 1942 Rough'n Tumble 1948 Dr. Fager 1964 Roused 1943 Better Self 1945 Aspidistra 1954 Cult 1974 Tilly Rose 1948 Intent 1948 Intentionally 1956 Arrangement 1964 My Recipe 1947 Noble Hero 1945 Floral Girl 1954 Brown Flower 1938 3SA x 3SC Seattle Slew 4MA x 4MC My Charmer 4SA x 4SC Bold Reasoning 4SC x 5SA Buckpasser 5MA x 5MC Fair Charmer 5MA x 5MC Reason to Earn 5SA x 5SC Boldnesian 5SA x 5SC Poker By CONGRATS (2000), Black type winner, $998,960. Sire of 4 crops. 261 foals, 179 starters, 11 black type winners, 130 winners, $10,391,047, including Turbulent Descent ($1,211,640, Ballerina S. [G1], etc.), Wickedly Perfect ($404,600, Darley Alcibiades S. [G1], etc.), Emma's Encore ($398,248, Prioress S. [G1], etc.), I'm Steppin' It Up ($429,661, Kent S. [L], etc.), King Henry ($227,214, Penn Dash S. [O]), Oligarch ($165,996, Tropical Park Derby [O], etc.), Portside ($151,292, Star Shoot S. [L], etc.), Check My Cheeks ($109,125, Eduardo Cautino Insua S., etc.). 1ST DAM King's Pact (f, by Slewacide). In NA, Unplaced at 3. Dam of 10 Foals, 10 To Race, 5 Winners. THOROUGHLY (g, by Full Mandate). In US, 2 wins at 2, $59,425. Won Willard L. Proctor Memorial S. [L] (HOL, $46,725). Tre Hollywood Park 5f 00:58.45 (A) 2007. Chet (g, by Chester House). In NA, Winner at 2, $7,490. In US, 4 wins at 3 and 4, $43,574. (Total: $51,064) Princess Anna Lei (f, by Montbrook). In US, 3 wins at 4, $46,797. King Hall (f, by Graeme Hall). In US, 4 wins at 3 and 4, placed at 5, 2013, $37,960. Diamond Twister (c, by Omega Code). In Eng, Winner at 3 and 4, 14,860 GBP. In Fr, Placed at 3, 4,200 EUR. (Total: $28,737) Grade Gear (c, by Southern Halo). In Jpn, Placed at 2, $16,691. Fager's Lady (f, by Drewman). In US, Unplaced at 2 and 3. Sunshine Daisy (f, by Tiznow). In US, Unplaced at 5. Harlekin (c, by Sword Dance (IRE)). In Jpn, Unplaced at 2 to 4. King Kongrats (c, by Congrats). See record below. 2ND DAM Cult (f, by Dr. Fager). In NA, Placed at 3 and 4, $10,580. Dam of 6 Foals, 6 To Race, 5 Winners. COUP DE FUSIL (f, by Codex). In NA, 8 wins, 3 to 5, $690,424. Won Ruffian Handicap [G1], Delaware Handicap [G1], John A. Morris Handicap [G1]. 2nd Beldame S. [G1], Beldame S. [G1], Ladies Handicap [G1], Tanya S. [L] (BEL, $12,628), [Q] (AQU). 3rd Long Look Handicap [G2], Long Look Handicap [G2], Monmouth Park Breeders' Cup Hcp. [L] (MTH, $17,072). 4th Molly Pitcher Handicap [G2]. Ntr Delaware Park 1 1/4m 01:59.80 1987. Dam of 6 Foals, 6 To Race, 5 Winners. DERIVATIVE (g, by Fappiano). In NA, 24 wins, 4 to 12, $558,061. Won Thanksgiving Day Handicap [L] (CRC, $60,000), Spend A Buck Handicap [L] (CRC, $30,000). 2nd Spend A Buck Breeders' Cup Handicap [L] (CRC, $21,315), Memorial Day Handicap [L] (CRC, $10,000), Hialeah Sprint Championship Hcp. [L] (HIA, $10,000), Seminole Handicap [L] (HIA, $10,000). 3rd Thanksgiving Day Handicap [L] (CRC, $5,500), Flying Pidgeon Handicap (CRC, $4,250), Great Sound Handicap (CRC, $3,536). Competent Sort (f, by Cahill Road). In NA, 5 wins at 2 and 3, $76,174. 2nd Noble Royalty S. (CRC, $7,826). Dam of 7 Foals, 7 To Race, 5 Winners. Thats a Good Thing (g, by Lion Heart). In US, 5 wins, 2 to 5, $99,956. 3rd Prairie Meadows Freshman S. (PRM, $5,000). Sortilege (f, by Tale of the Cat). In US, Winner at 4 and 5, $75,989. Babson (g, by Boston Harbor). In NA, 3 wins at 3 and 5, $52,500. Nachas and Joy (g, by Lion Heart). In US, Winner at 2, placed at 4, 2013, $50,006. Artemus Eagle (g, by Boston Harbor). In NA, Winner at 3, $7,584. In US, Winner at 5, $6,950. (Total: $14,534) Fusil De Chasse (c, by Ogygian). In NA, 5 wins, 2 to 4, $60,152. Eve of Battle (f, by Holy Bull). In NA, 2 wins at 4, $27,180. Sent to Australia 2007. Dam of 2 Foals, 2 To Race, 1 Winner. Sudden Gold (f, by Golden Missile). In US, Winner at 2, $6,513. In Can, Winner at 3, 17,855 CAD. (Total: $22,371) Bolt Action (g, by Holy Bull). In NA, Winner at 3, $3,590. GUYANA (c, by Cutlass). In NA, 21 wins, 2 to 9, $329,114. Won Golden Beach H. [O] (CRC). 3rd Broward H. [L] (CRC), Jupiter H. [O] (CRC). Sent to Venezuela 1988. LITURGISM (f, by Native Charger). In NA, 7 wins, 2 to 4, $121,116. Won Highland Park S., Verona S., Straight Deal S. (1 div). 2nd Desert Vixen S., Coconut Grove S., My Dear Girl S. -R (HIA), Tosmah H. 3rd Half Moon H. Dam of 11 Foals, 11 To Race, 7 Winners. MILLIONS (c, by Dehere). In NA, 3 wins at 2, $213,022. Won Laurel Futurity [G3], First State S. [L] (DEL, $45,000). 2nd Remsen S. [G2]. 3rd Federico Tesio S. [L] (PIM, $16,500). Sire. Brentsville (f, by Arctic Tern). Sent to Ireland 1990. In Ire, Winner at 2, 10,044 IEP. 3rd Waterford Foods Phoenix Sprint S. [G3] (IRE). (Total: $16,238) Dam of 10 Foals, 10 To Race, 5 Winners. =Sylva Paradise (IRE) (g, by Dancing Dissident). In Eng, Winner at 2, 3 and 7, 60,906 GBP. In Ity, Unplaced at 4. 3rd Abernant S. (ENG). (Total: $95,251) =Commissario Maigret (IRE) (c, by Rossini). In Ity, 4 wins at 4 and 5, 28,806 EUR. (Total: $42,715) =Mighty Flyer (IRE) (f, by Mujtahid). In Eng, Unplaced at 2. In Fr, Winner at 3, 55,996 FRF. (Total: $9,522) =Night Spirit (IRE) (f, by Night Shift). In Eng, Winner at 3, 4,143 GBP. (Total: $6,781) =Vitesse (IRE) (f, by Royal Academy). In Eng, Winner at 3, 3,991 GBP. (Total: $5,762) Young Senor (c, by El Gran Senor). Sent to Ireland 1991. In Eng, 3 wins at 2 and 4, 61,995 GBP. 2nd Krug Superlative S. (ENG), Feilden S. (ENG). 3rd Fed Brewery Pils Lager Beeswing S. [G3] (ENG). (Total: $105,965) Sire. Betty's Pet (f, by Dehere). In NA, Winner at 3, $38,648. Dam of 3 Foals, 3 To Race, 2 Winners. VAULCLUSE (f, by A.P. Indy). In US, 3 wins at 2 and 3, $95,400. Won Suncoast S. (TAM, $30,000). Ntr Tampa Bay Downs 1m 40y 01:39.36 2008. Toymaker (c, by Woodman). In US, Winner at 3, 4, 5 and 6, $79,680. Eastern Diamond (f, by Diamond Shoal (GB)). In Eng, 3 wins at 3, $22,854. (Total: $22,854) Glasnot (c, by Nodouble). In NA, Winner at 3 and 4, $17,554. Ms Urbana (f, by Danzig Connection). In NA, Winner at 3, $6,940. Dam of 5 Foals, 5 To Race, 4 Winners. Urbana Light (f, by Colony Light). In NA, 4 wins at 2 and 3, $95,192. 3rd Nancy's Glitter Handicap [L] (CRC, $13,850), Liberada Handicap-R (CRC, $4,032). Victoria's Light (f, by Colony Light). In PR, 14 wins, 2 to 6, $116,350. Candles (f, by Colony Light). In PR, 17 wins, 2 to 6, $105,055. That's Outrageous (f, by De Niro). In NA, 8 wins, 4 to 6, $83,742. In US, Placed at 8, $1,380. (Total: $85,122) Capable (f, by Capote). In NA, Unplaced at 2. Dam of 6 Foals, 6 To Race, 5 Winners. End of Discussion (g, by Aristocrat). In US, 2 wins at 3, placed at 4, 2013, $15,784. 3rd Silver Cup Futurity [N] (ARP, $4,559). Loose N Capable (g, by Langfuhr). In US, 4 wins at 4 and 5, $87,707. Draiman (g, by Boundary). In NA, Winner at 2, $6,668. In US, 2 wins at 3, $36,700. (Total: $43,368) Crown Capers (f, by Chief's Crown). In NA, Unplaced at 4. Sent to Ireland 1999. In Ire, Winner at 2, 10,864 EUR. (Total: $9,959) Cassava (f, by Known Fact). In NA, Winner at 4, $8,681. Star of Paris (f, by Dayjur). Unraced. Dam of 7 Foals, 7 To Race, 2 Winners. ELUSIVE CITY (c, by Elusive Quality). Hwt Colt At 2 In France 2002. In NA, Unplaced at 4. In Eng, Placed at 2, 22,490 GBP. In Fr, Winner at 2, 142,850 EUR.
Load more

Recommended publications
  • Consigned by Barouche Stud (Ireland) Ltd Seattle Slew Bold
    Consigned by Barouche Stud (Ireland) Ltd 1227 1227 Bold Reasoning Seattle Slew Capote (USA) My Charmer Bald Eagle CAPOTE WEST Too Bald (USA) Hidden Talent (2004) Mr Prospector Madam West Gone West Bay Or Brown Mare Secrettame (USA) Vice Regent (1996) Lantana Lady Friendly Ways Covered by BORN TO SEA (IRE). Last Service May 18th; believed in foal. Pregnancy Certificate available, see Conditions of Sale. CAPOTE WEST (USA): 2 wins at 3 in U.S.A. and £32,679 and placed 6 times; Dam of 2 winners: 2008 Not covered in 2007 2009 f. Capeslew (IRE) by Cape Cross (IRE): winner at 2; also placed at 3, 2012 in U.S.A. 2010 f. Sister Slew (IRE) by Kheleyf (USA): winner at 3, 2013 and placed. 2011 f. Lady Sparkler (IRE) by Tamayuz (GB): ran once at 2, 2013. 2012 Barren 2013 f. by Cape Cross (IRE). 1st dam MADAM WEST (USA): winner at 3 in U.S.A. and £28,503 and placed 7 times; dam of 3 foals; 2 runners; 2 winners: WESTERN ART (USA) (g. by Hennessy (USA)): winner at 2 viz. Aaim Dragon S., L., placed twice. Capote West (USA): see above. 2nd dam LANTANA LADY (CAN): 4 wins at 2 to 4 in U.S.A. and £147,136 inc. Selene S., Gr.2 and Ontario Bicentennial Damsel S., L., placed 9 times inc. 2nd Wonder Where S., Gr.2, Fury S., L., Lady Angela S., 3rd Ontario Colleen S., Gr.3, La Prevoyante S. and Nandi S.; dam of 10 foals; 10 runners; 7 winners inc.: MINERAL WELLS (USA) (c.
    [Show full text]
  • UNDER CAUTION:Layout 1 12/4/13 10:08 AM Page 1
    UNDER CAUTION:Layout 1 12/4/13 10:08 AM Page 1 UNDER CAUTION A.P. Indy—Coldheartedcat, by Storm Cat Ranked in the Top Five Leading Freshman Sires in 2011 By Horse of the Year and classic winner A. P. INDY, leading sire twice, sire of 140 stakes winners, including champions BERNARDINI, MINESHAFT, RAGS TO RICHES, MARCHFIELD, MALIBU MOON, EYE OF THE LEOPARD and TEMPERA. Out of the winning STORM CAT mare Coldheartedcat. She is a half-sister to classic winner CAVEAT, DEW LINE, BALTIC CHILL and Winters’ Love dam of TRANQUILITY LAKE ($1,662,390), and leading California sire BENCHMARK; granddam of AFTER MARKET ($903,685, sire), COURAGEOUS CAT ($1,165,760, Shoemaker Mile S.-G1, etc.) and JALIL. 2014 FEE: $1,500-LIVE FOAL-SECOND MARE FREE 2 LIFETIME BREEDINGS PER YEAR, NO ADDITIONAL COST $1,500 to be paid when 2014 contract is signed and returned. This offer applies to first 10 bookings in 2014. Property of Medallion Hill Farm LLC SK RACING STABLE Inquiries to (925) 550-2383 or (925) 354-5237 14728 Cool Valley Road, Valley Center, California 92082 (760) 443-9523 / FAX (760) 751-9523 e-mail: [email protected] 184 www.ctba.com California Thoroughbred 2014 Stallion Directory www.ctba.com UnderCautioncs406201ORIGJockeyClubPageSent11-8-2013-NoChange11-27-2013-1245pm :Layout 1 11/27/13 12:48 PM Page1 UNDER CAUTION 2001 Chestnut - Height 16.1 - Dosage Profile: 7-14-19-0-0; DI: 3.21; CD: +0.70 RACE AND (STAKES) RECORD Bold Ruler Boldnesian Age Starts 1st 2nd 3rd Earnings Alanesian Bold Reasoning 2 3 1 0 0 $18,300 Hail to Reason 61 foals, 10 SWs 3 3 0 1 0 2,200 Reason to Earn Sailing Home Seattle Slew Round Table 4 11 2 1 1 36,045 1050 foals, 114 SWs Poker Glamour 5 14 2 1 3 41,700 My Charmer Jet Action 31 5 3 4 $98,245 12 foals, 4 SWs Fair Charmer Myrtle Charm A.P.
    [Show full text]
  • Kentucky Derby, Flamingo Stakes, Florida Derby, Blue Grass Stakes, Preakness, Queen’S Plate 3RD Belmont Stakes
    Northern Dancer 90th May 2, 1964 THE WINNER’S PEDIGREE AND CAREER HIGHLIGHTS Pharos Nearco Nogara Nearctic *Lady Angela Hyperion NORTHERN DANCER Sister Sarah Polynesian Bay Colt Native Dancer Geisha Natalma Almahmoud *Mahmoud Arbitrator YEAR AGE STS. 1ST 2ND 3RD EARNINGS 1963 2 9 7 2 0 $ 90,635 1964 3 9 7 0 2 $490,012 TOTALS 18 14 2 2 $580,647 At 2 Years WON Summer Stakes, Coronation Futurity, Carleton Stakes, Remsen Stakes 2ND Vandal Stakes, Cup and Saucer Stakes At 3 Years WON Kentucky Derby, Flamingo Stakes, Florida Derby, Blue Grass Stakes, Preakness, Queen’s Plate 3RD Belmont Stakes Horse Eq. Wt. PP 1/4 1/2 3/4 MILE STR. FIN. Jockey Owner Odds To $1 Northern Dancer b 126 7 7 2-1/2 6 hd 6 2 1 hd 1 2 1 nk W. Hartack Windfields Farm 3.40 Hill Rise 126 11 6 1-1/2 7 2-1/2 8 hd 4 hd 2 1-1/2 2 3-1/4 W. Shoemaker El Peco Ranch 1.40 The Scoundrel b 126 6 3 1/2 4 hd 3 1 2 1 3 2 3 no M. Ycaza R. C. Ellsworth 6.00 Roman Brother 126 12 9 2 9 1/2 9 2 6 2 4 1/2 4 nk W. Chambers Harbor View Farm 30.60 Quadrangle b 126 2 5 1 5 1-1/2 4 hd 5 1-1/2 5 1 5 3 R. Ussery Rokeby Stables 5.30 Mr. Brick 126 1 2 3 1 1/2 1 1/2 3 1 6 3 6 3/4 I.
    [Show full text]
  • FLATTER Bay Horse; Foaled 1999 Bold Reasoning Seattle Slew
    FLATTER Bay Horse; foaled 1999 Bold Reasoning Seattle Slew ................... My Charmer A.P. Indy ........................ Secretariat Weekend Surprise........... Lassie Dear FLATTER Raise a Native Mr. Prospector ................ Gold Digger Praise ............................ (1994) Northern Dancer Wild Applause ................ Glowing Tribute By A.P. INDY (1989). Horse of the year, classic winner of $2,979,815, Belmont S. [G1], etc. Leading sire twice, sire of 142 black-type winners, 11 champions, including Mineshaft [G1] ($2,283,402), Rags to Riches [G1] ($1,342,528), Bernardini [G1] ($3,060,480), and of Aptitude [G1] ($1,965,410), Stephen Got Even [G1] ($1,019,200), Pulpit [G1] ($728,200). 1st dam PRAISE, by Mr. Prospector. 2 wins at 3, $61,180. Dam of 6 foals, 4 winners-- CONGRATS (c. by A.P. Indy). 7 wins, 2 to 5, $818,960, in N.A./U.S., San Pasqual H. [G2] (SA, $90,000), Alysheba S. [L] (CD, $70,432), 2nd Santa Anita H. [G1] (SA, $200,000), Memorial Day H. [G3] (CRC, $20,000), Ack Ack H. [L] (HOL, $15,570), 3rd Hollywood Gold Cup H. [G1] (HOL, $90,000), Jim Dandy S. [G2] (SAR, $55,000), Washington Park H. [G2] (AP, $38,500), San Antonio H. [G2] (SA, $30,000). (Total: $998,960). Sire. Flatter (c. by A.P. Indy). Subject stallion. Fete (g. by Horse Chestnut (SAF)). 11 wins at 3 and 4, $310,208. Gigger (g. by Go for Gin). 4 wins, 2 to 6, $100,590. 2nd dam WILD APPLAUSE, by Northern Dancer. 5 wins in 10 starts at 2 and 3, $240,136, Diana H.-G2, Comely S.-G3, 2nd Test S.-G2, 3rd Mother Goose S.-G1.
    [Show full text]
  • SUNDARBAN :Layout 1 12/4/13 1:15 PM Page 1
    SUNDARBAN :Layout 1 12/4/13 1:15 PM Page 1 SUNDARBAN A.P. Indy—Desert Tigress, by Storm Cat $1.7 million 2007 Keeneland September Yearling Earned $103,340 as the winner of 4 races, including his maiden win by 8 3/4 lengths going gate-to-wire at 1 1/16 miles as the 123-pound highweight. Out of DESERT TIGRESS, by Storm Cat, sister to GROUP 3-winning sire HURRICANE CAT who has six group winners in France and Chile from his first two crops to race & second dam is champion older mare SKY BEAUTY,9GRADE 1 wins, including FILLY TRIPLE CROWN. Third dam is multiple GRADE 1 winner MAPLEJINSKY and this is the family of champions GOLD BEAUTY & DAYJUR, BREEDERS’ CUP DISTAFF (G1) winner PLEASANT HOME ($1,378,070) & multiple 2012 GRADE 1 winner POINT OF ENTRY. By Horse of the Year and Classic winner A.P. INDY, sire of the earners of more than $120 million & 11 champions, including BERNARDINI, MINESHAFT, RAGS TO RICHES, TEMPERA, etc. 2014 FEE: $2,500-LIVE FOAL First foals are two-year-olds of 2014 Standing at MILKY WAY FARM Inquiries to Linda Madsen 34174 De Portola Road, Temecula, California 92592 (909) 241-6600 e-mail: [email protected] • http://www.thoroughbredinfo.com/showcase/sundarban.htm 154 California Thoroughbred 2014 Stallion Directory www.ctba.com SUNDARBAN CS403401ORIGJockeyClubPageSent11-8-2013-1stChngLoretta11-27-2013-1052am:Layout 1 11/27/13 10:53 AM Page1 SUNDARBAN 2006 Bay - Height 16.2 - Dosage Profile: 8-12-21-1-0; DI: 2.65; CD: +0.64 Bold Ruler RACE AND (STAKES) RECORD Boldnesian Alanesian Age Starts 1st 2nd 3rd Earnings Bold Reasoning Hail to Reason 2 unraced 61 foals, 10 SWs Reason to Earn Sailing Home Seattle Slew 3 1 0 0 0 $170 Round Table 1050 foals, 114 SWs 4 9430 98,635 Poker Glamour My Charmer 5 6002 4,535 Jet Action 12 foals, 4 SWs 16 4 3 2 $103,340 Fair Charmer Myrtle Charm A.P.
    [Show full text]
  • DARK BAY OR BROWN COLT Barn 9 Hip No
    Consigned by Penn Sales, Agent II Hip No. Barn 316 DARK BAY OR BROWN COLT 9 Foaled May 31, 2004 Bold Reasoning Seattle Slew ...................... My Charmer Capote .............................. Bald Eagle Too Bald............................ Hidden Talent DARK BAY OR His Majesty BROWN COLT Frosty the Snowman ......... Frosty Skater Frosty Peace ..................... (1995) Hold Your Peace Peace Line ........................ Miss K. L. Roman By CAPOTE (1984). Champion 2-year-old colt, stakes winner of $714,470, Breeders' Cup Juvenile [G1], etc. Among the leading sires, sire of 14 crops of racing age, 747 foals, 617 starters, 52 stakes winners, 425 win- ners of 1280 races and earning $31,561,972 in N.A., including champi- ons Boston Harbor ($1,934,605, Breeders' Cup Juvenile [G1], etc.), Surf- ing Home (J & B Met [G1], etc.), and of Basim [G3] (hwt. at 2 in Ireland), Acceptable ($713,020, Kentucky Cup Classic Preview H. [G3], etc.). 1st dam Frosty Peace, by Frosty the Snowman. 12 wins, 3 to 5, $122,031, 3rd Claiming Crown Tiara S.-R (CBY, $12,500). Dam of 3 registered foals, 3 of racing age, including a 2-year-old of 2005, 2 to race, no winners, including-- Mysterious Peace (f. by Cryptoclearance). Placed at 3, 2004, $7,840. 2nd dam PEACE LINE, by Hold Your Peace. Dam of 9 foals, 8 winners, including-- Frosty Peace (f. by Frosty the Snowman). Stakes-placed winner, above. Opening Line. 8 wins, 2 to 4, $92,877. Dam of 3 winners, including-- SWAMP LINE (g. by Swamp King). 3 wins at 2 and 3, $164,608, Frost King S.-R (WO, $64,680(CAN)), 2nd Achievement H.-R (WO, $29,106(CAN)).
    [Show full text]
  • Tale of the Cat
    Tale Of The Cat Tale Of the Cat has an affinity for FAPPIANO line mares. For example his champion daughter She’s A Tiger is out of a mare by CAHILL ROAD, a brother to UNBRIDLED. Tale Of The Cat is also enjoying marked success with UNBRIDLED’S SONG mares, with 11% black-type winners. They include the Gr.2 winners Appealing Tale, Alpha Kitten and A Shin Top, as well as the Gr.1-placed Luminance. There is also a Gr.3 winner, Favorite Tale, with a dam by GRINDSTONE. As Tale Of The Cat’s Gr.2 winner Spellbinder is out of a mare by Fappiano’s son QUIET AMERICAN, more mares from the Fappiano line are justified. TALE OF THE CAT also has several other Graded winners inbred to MR PROSPECTOR, led by the Gr.1 winner Tale of Ekati (3x4) and the fast Forty Tales (3x3, with a dam by FORTY NINER). His champion son Gio Ponti is out of an ALYDAR mare (therefore inbred 4x3 to Raise A Native). He has only seven foals out of daughters of INDIAN CHARLIE, but they include two stakes winners. Tale Of The Cat is doing well with the HAIL TO REASON line. Tale of Ekati is from a mare by Halo’s top son SUNDAY SILENCE, and he also has stakes horses out of daughters of RED RANSOM (4 stakes winners from 24 foals), SILVER HAWK, CURE THE BLUES, KRIS S., ARCH, DYNAFORMER, PRIZED and SOUTHERN HALO. His top son Lion Heart is out of a mare inbred 2x4 to HAIL TO REASON and his top-class daughter Stopchargingmaria has a second dam by KRIS S.
    [Show full text]
  • Unraced Please Note: Nicking Stats and Interactive Nicking Are on The
    equineline.com Product 10N 05/04/13 11:21:51 EDT Kaput Dark Bay or Brown Horse; May 02, 2001 Unraced Click here for Interactive Nicking Bold Ruler, 54 dk b Boldnesian, 63 b Alanesian, 54 b Bold Reasoning, 68 dk b/ Hail to Reason, 58 br Reason to Earn, 63 b Sailing Home, 48 ch Seattle Slew, 74 dk b/ Round Table, 54 b Poker, 63 b Glamour, 53 b My Charmer, 69 b Jet Action, 51 ch Fair Charmer, 59 ch Myrtle Charm, 46 b Capote, 84 dk b/ =Nearco (ITY), 35 br *Nasrullah, 40 b =Mumtaz Begum (FR), 32 Bald Eagle, 55 b b Tiger, 35 br Siama, 47 b Too Bald, 64 dk b/ China Face, 40 b *Royal Gem II, 42 br Dark Star, 50 br Isolde, 38 br Hidden Talent, 56 b *Nasrullah, 40 b *Dangerous Dame, 51 ch Kaput =Lady Kells (IRE), 44 gr Dark Bay or Brown Horse Nearctic, 54 br Foaled May 02, 2001 Northern Dancer, 61 b in Kentucky Natalma, 57 b Vice Regent, 67 ch Unraced *Menetrier, 44 br Victoria Regina, 58 ch Victoriana, 52 b Deputy Minister, 79 dk b/ Bunty Lawless, 35 b Bunty's Flight, 53 dk b Broomflight, 47 blk Mint Copy, 70 dk b/ Jabneh, 52 b Shakney, 64 dk b/ Grass Shack, 51 blk Grechelle, 95 dk b/ Speak John, 58 b Hold Your Peace, 69 b Blue Moon, 48 b Meadowlake, 83 ch Raise a Native, 61 ch Suspicious Native, 72 ch Be Suspicious, 63 b Meadow Star, 88 ch Intentionally, 56 blk In Reality, 64 b My Dear Girl, 57 ch Inreality Star, 79 b Native Dancer, 50 gr Imanative, 64 gr Flolou, 59 b Breeder: Duzee Stable (KY) Inbreeding: *Nasrullah: 4S X 5S Dosage Profile: 8 0 6 0 0 Dosage Index: 3.67 Center of Distribution: +1.14 Please Note: Nicking Stats and Interactive Nicking are on the following page Copyright © 2013 The Jockey Club Information Systems, Inc.
    [Show full text]
  • MOR SPIRIT Dkb/Br, 2013
    Enters Stud in 2019 MOR SPIRIT dkb/br, 2013 Dosage (4-0-14-0-0); DI: 1.57; CD: 0.44 See gray pages—Nearctic RACE AND (BLACK TYPE) RECORD Storm Cat, 1983 Storm Bird, by Northern Dancer Age Starts 1st 2nd 3rd Earned 8s, BTW, $570,610 Giant's Causeway, 1997 1,414 f, 177 BTW, 2.94 AEI Terlingua, by Secretariat 2 4 2(1) 2(1) 0 $288,400 13s, BTW, $3,078,989 3 5 1(1) 2(2) 0 $388,000 2,429 f, 186 BTW, 1.76 AEI Mariah's Storm, 1991 Rahy, by Blushing Groom Eskendereya, ch, 2007 16s, BTW, $724,895 4 5 3(3) 1(1) 0 $992,000 14 f, 11 r, 8 w, 2 BTW Immense, by Roberto Totals 14 6(5) 5(4) 0 $1,668,400 6s, BTW, $725,700 390 f, 18 BTW, 1.42 AEI Seattle Slew, 1974 Bold Reasoning, by Boldnesian Won At 2 7.53 AWD 17s, BTW, $1,208,726 Los Alamitos Futurity (G1, $350,500, 8.5f in 1:43.54, Aldebaran Light, 1996 1,050 f, 111 BTW, 3.69 AEI My Charmer, by Poker 5s, wnr, $18,660 dftg. Toews On Ice, I’malreadythere, Urlacher, Frank 12 f, 8 r, 5 w, 2 BTW Altair, 1991 Alydar, by Raise a Native Conversation, Hollywood Don, Sorryaboutnothing). Unraced A maiden special weight race at SA ($68,100, 8f in 8 f, 5 r, 4 w, 1 BTW Stellar Odyssey, by Northern Dancer ¼ 1:37.48, by 4 , dftg. Urlacher, Uninvited, Nightly Dixieland Band, 1980 Northern Dancer, by Nearctic News, Wise Tale, Bruntino, Recalibrating).
    [Show full text]
  • Stallion Synopsis For: Instagrand
    STALLION SYNOPSIS FOR: INSTAGRAND PREPARED BY: ALAN PORTER PREPARED FOR: PM ADVERTISING LLC Pedigree Consultants are able to help you in all facets of your thoroughbred investment. Not only are we able to proven mating advice but we are also able to advise on mare selection, management and promotion of stallions, and selection and purchase of racing and breeding stock. For more information on the services visit www.pedigreeconsultants.com, email [email protected] or call +1 859 285 0431. INSTAGRAND A $1,2,000,000 two-year-old in training purchase, Instagrand was a debut winner by 10 lengths going five furlongs in 56:00, and followed up with 10¼ lengths victory in the Best Pal Stakes (G2), demonstrating himself to be one of the most spectacular juvenile colts to represent the sensational Leading Sire, and twice Leading Sire of Two-Year-Olds, Into Mischief. Into Mischief has sired the brilliant Goldencents out of a mare by Banker’s Gold, and four stakes winners, including multiple grade one winner Practical Joke, out of mares by Distorted Humor (sire of Flower Alley, Sharp Humor, Drosselmeyer, Maclean’s Music and Jimmy Creed). Banker’s Gold and Distorted Humor are both sons of Forty Niner, a stallion who could also be introduced through mares by Coronado’s Quest, Editor’s Note, End Sweep, Jules, Luhuk, Gold Fever, Roar (broodmare sire of an Into Mischief stakes winner), Trippi (broodmare sire of an Into Mischief graded winner) and Twining. The Into Mischief cross with mares from the Gone West branch of Mr. Prospector has also been a very successful one.
    [Show full text]
  • Sunrise Slew Barn 1 Hip No. 32
    Consigned by Woodford Thoroughbreds, Agent Hip No. Sunrise Slew Barn 32 1 Boldnesian Bold Reasoning ................ Reason to Earn Seattle Slew ...................... Sunrise Slew Poker My Charmer ...................... Dark Bay or Fair Charmer Brown Mare; Northern Dancer foaled 2000 Danzig .............................. Pas de Nom Selling Sunshine .............. (1987) Boldnesian Bold Bikini ........................ Ran-Tan By SEATTLE SLEW (1974). Horse of the year, Triple Crown winner of $1,208,- 726, Belmont S. -G1 , etc. Leading sire, sire of 24 crops of racing age, 1103 foals, 783 starters, 111 black-type winners, 8 champions, 537 winners of 1544 races and earning $83,853,811. Leading broodmare sire 3 times and U.A.E., sire of dams of 220 black-type winners, including champions Cigar, Lemon Drop Kid, Hishi Akebono, Kawakami Princess, Escena, Golden Attraction, Mulca, Slew of Reality (ARG), Hello Seattle, Letsgoforit. 1st dam SELLING SUNSHINE, by Danzig. Placed at 3, $3,085. Dam of 11 other regis - tered foals, 11 of racing age, 10 to race, 4 winners, including-- BUYING RAIN (g. by Gulch). 9 wins, 3 to 9, $315,500, Bob Harding S. [L] (MTH, $36,000), 2nd John Henry S. (MED, $8,550), Basil Hall S. (PIM, $8,000), Charlie Eckman Mile S. (PIM, $8,000), 3rd John Henry S. [L] (MED, $10,000). Lifeguard (g. by Gulch). 13 wins, 3 to 7, $206,591. 2nd dam BOLD BIKINI , by Boldnesian. 6 wins at 3 and 4, $57,528, Jersey Belle H., etc. Half-sister to TOP KNIGHT ($545,684, champion 2-year-old colt), Hardy Hugh , Dancer's Vixen , Never Burn . Dam of 12 winners, including-- LAW SOCIETY (c.
    [Show full text]
  • Graydar Oxbow
    GRAYDAR OXBOW We have enjoyed tremendous success in standing/managing stallions over the last 20 years. KRIS S. SAINT BALLADO UNBRIDLED’S SONG 2 Dear Breeder, Taylor Made is a family owned and operated farm built on honesty, long-lasting relationships and horsemanship. Taylor Made Stallions’ mode of operation has always been – and remains – to focus on standing quality stallions that provide breeders great opportunities, whether they are breeding to race or sell. 2013 was a bounce-back year for commercial breeders, including a GSVRIVXYVRMRK/IIRIPERH7ITXIQFIVWEPIXLEXWE[KEMRWEGVSWWXLIFSEVHLMKLPMKLXIHF]WIZIR½KYVI]IEVPMRKWERHFSEWXMRK the third highest average of all time. The recent market results have proven that the well-conformed individual has re-emerged as the most important component SJEFY]IV´WWIPIGXMSRGVMXIVME,IVIEX8E]PSV1EHI[IQEOIWYVIIEGLSJSYVWXEPPMSRWVI¾IGXXLEXGSQTSRIRX3YVXIEQLEW been highly selective in providing the breeder a top group of well-conformed stallions whose progeny will be well received at the track and in the sales ring. Last year also marked a bittersweet landmark for one of the great sires of our time. While reaching 17 Grade 1 winners over his historic career in 2013, Unbridled’s Song passed away at the age of 20. Every person at Taylor Made has been touched by this amazing animal over the years. He leaves a lasting legacy that will never be forgotten across the industry he served so well. And yet there is much to look forward to in 2014. The legacy continues with our newest stallion, Graydar, the Grade 1-winning son of Unbridled’s Song. One of the most stunning physicals to come to the breeding shed in years, Graydar had a brilliant VEGIGEVIIVMRGPYHMRKEGSQQERHMRKZMGXSV]MRXLI(SRR,ERHMGET + EX+YPJWXVIEQ4EVO;IEVIGSR½HIRXLI[MPPFI a favorite among breeders as Taylor Made Stallions adds another chapter to its storied tradition.
    [Show full text]