MOR SPIRIT Dkb/Br, 2013

Total Page:16

File Type:pdf, Size:1020Kb

Load more

Enters Stud in 2019 MOR SPIRIT dkb/br, 2013 Dosage (4-0-14-0-0); DI: 1.57; CD: 0.44 See gray pages—Nearctic RACE AND (BLACK TYPE) RECORD Storm Cat, 1983 Storm Bird, by Northern Dancer Age Starts 1st 2nd 3rd Earned 8s, BTW, $570,610 Giant's Causeway, 1997 1,414 f, 177 BTW, 2.94 AEI Terlingua, by Secretariat 2 4 2(1) 2(1) 0 $288,400 13s, BTW, $3,078,989 3 5 1(1) 2(2) 0 $388,000 2,429 f, 186 BTW, 1.76 AEI Mariah's Storm, 1991 Rahy, by Blushing Groom Eskendereya, ch, 2007 16s, BTW, $724,895 4 5 3(3) 1(1) 0 $992,000 14 f, 11 r, 8 w, 2 BTW Immense, by Roberto Totals 14 6(5) 5(4) 0 $1,668,400 6s, BTW, $725,700 390 f, 18 BTW, 1.42 AEI Seattle Slew, 1974 Bold Reasoning, by Boldnesian Won At 2 7.53 AWD 17s, BTW, $1,208,726 Los Alamitos Futurity (G1, $350,500, 8.5f in 1:43.54, Aldebaran Light, 1996 1,050 f, 111 BTW, 3.69 AEI My Charmer, by Poker 5s, wnr, $18,660 dftg. Toews On Ice, I’malreadythere, Urlacher, Frank 12 f, 8 r, 5 w, 2 BTW Altair, 1991 Alydar, by Raise a Native Conversation, Hollywood Don, Sorryaboutnothing). Unraced A maiden special weight race at SA ($68,100, 8f in 8 f, 5 r, 4 w, 1 BTW Stellar Odyssey, by Northern Dancer ¼ 1:37.48, by 4 , dftg. Urlacher, Uninvited, Nightly Dixieland Band, 1980 Northern Dancer, by Nearctic News, Wise Tale, Bruntino, Recalibrating). 24s, BTW, $441,320 2nd Kentucky Jockey Club S (G2, 8.5f, to Airoforce, dftg. Dixie Union, 1997 1,306 f, 111 BTW, 1.89 AEI Mississippi Mud, by Delta Judge Mo Tom, Gun Runner, Annual Report, My Majestic 12s, BTW, $1,233,190 806 f, 48 BTW, 1.40 AEI She's Tops, 1989 Capote, by Seattle Slew Flight, Perfect Saint, Tom’s Ready, Rated R Superstar, Im a Dixie Girl, dkb/br, 2002 18s, BTW, $200,880 Nana Looch, Derby Express, Force It, Uncle Jerry). 11s, BTW, $167,320 4 f, 3 r, 2 w, 1 BTW She's a Talent, by Mr. Prospector Won At 3 8 f, 6 r, 5 w, 1 BTW Allen's Prospect, 1982 Mr. Prospector, by Raise a Native Robert B. Lewis S (G3, $150,345, 8.5f in 1:43.21, 7.59 AWD 7s, BTW, $56,100 dftg. Uncle Lino, I Will Score, Dressed in Hermes, Im Out First, 1993 1,050 f, 63 BTW, 1.29 AEI Change Water, by Swaps 56s, BTW, $438,628 Let’s Meet in Rio, Path of David). 11 f, 10 r, 6 w, 2 BTW Sequins, 1987 Northern Fashion, by Northern Dancer 2nd Santa Anita Derby (G1, 9f, to Exaggerator, dftg. 4s, wnr, $19,490 Uncle Lino, Danzing Candy, Diplodocus, Denman’s 13 f, 11 r, 9 w, 2 BTW Brilliant Touch, by Gleaming Call, Smokey Image, Iron Rob). Inbreeding: 5SX5sX4DX5D Northern Dancer; 3sX5D Seattle Slew; 5SX5D Raise a Native. San Felipe S (G2, 8.5f, to Danzing Candy, dftg. Exaggerator, Uncle Lino, Smokey Image, I Will Score). G2, to 5, 2018), Show Stealer (2nd La Canada S, G2, Paulson H. Dam of GREAT HUNTER ($976,260, Won At 4 Santa Maria S, G2, etc.), Emmzy (2nd Indiana Oaks, Lane’s End Breeders’ Futurity, G1A, Robert B. Mohegan Sun Metropolitan H (G1, $1,200,000, 8f in G2), Ladies Night (3rd Mazarine S, G3A, Ontario Lewis S, G2, 2nd Del Mar Futurity, G2, Best Pal S, 1:33.71, by 6¼, dftg. Sharp Azteca, Tommy Colleen S, G3T, to 3, 2018), Last Voyage (3rd UAE Two G2, Hollywood Juvenile Championship S, G3, 3rd Macho, Awesome Slew, Economic Model, Rally Thousand Guineas Sponsored By Al Tayer Motors, G3 Bessemer Trust Breeders’ Cup Juvenile, G1, sire), Cry, Tom’s Ready, Solid Wager, Virtual Machine, in UAE, to 3, 2018), Pop Keenan (2nd Banjo Picker Glitzen Glory ($102,710, 2nd Cozy Lace S). Denman’s Call, Mohaymen, Inside Straight). Sprint S, etc., to 4, 2018), Flashaway (2nd Charlie NEW YORK HOLIDAY. 6 wins, 4 to 11, $124,067. Steve Sexton Mile S (G3, $200,000, 8f in 1:36.86, by Barley S, 3rd Toronto Cup S, etc., to 6, 2018), My BRILLIANT SERMON. 11 wins, 4 to 8, $118,573. 53, dftg. Texas Chrome, Iron Fist, Shotgun Sweet Stella (2nd Dixie Belle S, Martha Washington S, EVENING STAR. 2 wins at 4, $53,802. Dam of Kowboy, American Dubai, F J Uncle Vic). to 4, 2018), Escondera (3rd Coronation Futurity, to 4, STELLAR WIND ($2,903,200, champion 3yo filly, Essex H ($250,000, 8.5f in 1:41.62, by 2½, dftg. 2018), Easy to Say (3rd Tale of the Cat S), Frosty Apple Blossom H, G1, Beholder Mile S, G1, Santa Domain’s Rap, Madefromlucky, Dazzling Gem, Friday (2nd Sunshine Millions Filly and Mare Turf S, to Anita Oaks, G1, Clement L. Hirsch S, G1 twice, Secret Passage, Shotgun Kowboy, Dalmore). 6, 2018), Turkish Tabby (2nd Camilla Urso S, 3rd Zenyatta S, G1, Summertime Oaks, G2, Santa Ysabel 2nd San Antonio S (G2, 8.5f, to Hoppertunity, dftg. Tranquility Lake S, to 5, 2018), Escondido (3rd Clasico S, G3, Torrey Pines S, G3, 2nd Longines Breeders’ Accelerate, El Huerfano, Hard Aces, Dalmore, Dia de los Padres S), Celestial Sighting (2nd Bolton Cup Distaff, G1, Vanity Mile S, G1, to 6, 2018). Avanti Bello). Landing S, Lady Finger S), Bella Anatola (3rd 4th dam SIRE LINE Albuquerque Distaff H, to 5, 2018), Mio Me (3rd BRILLIANT TOUCH. Dam of 9 foals, including— MOR SPIRIT is by ESKENDEREYA, black-type stakes Ultrafleet S), Meditteraneanpearl (3rd Clasico Roberto Gleam Out. 2 wins at 3 in Fr, placed in NA, $50,232, winner of 4 races, $725,700, Wood Memorial S (G1), Clemente S), Eskenformore (2nd Louisiana Cup Distaff 2nd Prix Berteux (G3 in Fr). Fasig-Tipton Fountain of Youth S (G2), Pilgrim S. S, to 5, 2018), Little Emma (2nd Beverly J. Lewis S), BRABAZON. 6 wins, 3 to 9, in Eng and Fr, $65,037. To November 4, 2018: Sired 5 crops, 390 foals, 302 rnrs Whiteheelgirl (3rd Martha Washington S, to 3, 2018), COOLTRAX. 6 wins at 3 and 4, $37,817. Meraki (77%), 210 wnrs (54%), 58 2yo wnrs (15%), 18 BTW (5%), (2nd Lafayette S, to 4, 2018), etc. ESKENDEREYA’S 2018 black-type stakes winners 5th dam 1.42 AEI, 1.69 CI, 211 sale yrlgs, avg $70,810, 1.53 TNA. are DUTCH PARROT, MITOLE, IN THE MOOD, SAND INDIAN NURSE. Unraced. Dam of 18 foals, incl.— In 2018: 43 2yos, 18 2yo rnrs, 4 2yo wnrs, 6 BTW, 26 sale DANCER, PURE LEMON (in PR), AMATTEROFTIME. WISE NURSE. 5 wins, 2 to 4, $62,031, Marguerite S. yrlgs, avg $89,280. Dam of SYDNEYS NURSE ($83,230, Sheepshead ESKENDEREYA has sired PURE LEMON (champion FAMILY Bay H, etc.), RESIDENT NURSE ($82,783, Pageant older female in PR, Clasico Roberto Clemente S twice, 1st dam S, G3T, Searching S), Buck the System ($85,962, Clasico Vuelve Candy B S twice, Clasico Dia de la Mujer IM A DIXIE GIRL. 3 wins at 2, $167,320, Pepsi 3rd Sanford S). Granddam of ROCK POINT ISABELLA SINGS S, etc., to 5, 2018), (Mrs. Revere S, Bassinet S, Colleen S, 2nd Astarita S (G3), Parts ($362,604, Federico Tesio S, G3, 2nd Wood G2T, Lambholm South Endeavour S, G3T, Eatontown Unknown S, 3rd Gowell S. Dam of 8 foals, incl.— Memorial Invitational S, G1, 3rd Preakness S, G1, S, G3T, My Charmer H, G3T, Miss Liberty S, Little MOR SPIRIT (Subject stallion). etc., sire), SPECIAL CARE ($158,102, sire). ESKENFORMONEY Silver S, etc.), (Turnback the Alarm SHEIKINATOR (by Curlin). 9 wins, 2 to 7, 2018, Peace Pipe. 11 wins, 3 to 6, $81,991, 2nd Christmas H, G3, Rampart S, G3, 2nd Azeri S, G2, Gulfstream $353,486. H, Lakefront H. Sire. Park Oaks, G2, Molly Pitcher S, G3 twice, etc.), IM A DIXIE DIVA (Henny Hughes). 3 wins, 2 to 5, SEA NURSE. 4 wins, 2 to 5. Producer. Dam of Paddy MITOLE (Chick Lang S, Bachelor S, 2nd Gazebo S, to 3, $79,728. Jay, Ragtime Baby, El Coronado (in PR). DUTCH PARROT 2018), (Lady Jacqueline S, 3rd Mari IN FOR THE MONEY (Eskendereya). Winner at 2 and PRINCESS RED WING. Winner at 4. Dam of STONEY CALI THIRTY SEVEN Hulman George S, to 4, 2018), 3, $38,036. LONESOME ($161,940), NIROBI ($143,017, in Italy). SAND DANCER (Powder Break S twice, etc.), SWEETHEARTOFDIXIE (Mr. Greeley). Winner at 3, LITTLE FIREFLY. Winner at 2 in Ire. Producer. (Woodhaven S, 2nd Hill Prince S, G2T, to 3, 2018), $27,090. Producer. Granddam of QUEEN RUNING (in Italy). WATCH THIS CAT (Las Cienegas S, 2nd Daisycutter H), HILL INDIAN. Placed at 2 and 3. Dam of KYO (in Fr). LET US BE GLAD (Dixie Poker Ace S, to 6, 2018), 2nd dam Granddam of ALL RAIN (in Fr), MINUTE EXPRESS. RIGHT THERE (Landaluce S, 3rd Chandelier S, G1, IM OUT FIRST. 10 wins, 2 to 5, $438,628, Lady Hallie NATIVE NURSE. Placed at 2 and 3. Dam of California Oaks), LIGHTS OF MEDINA (Weber City Miss H, Wabash S, Falling Leaves S, Wintergreen S, 2nd MELODIST ($280,878, champion 3yo filly in Italy, S, 2nd Black-Eyed Susan S, G2), AMATTEROFTIME Bassinet S, Wabash S, 3rd Sixty Sails H (G3), Kildangan Stud Irish Oaks, G1 in Ire, Oaks d’Italia, (New Jersey Breeders H, to 3, 2018), IN THE MOOD Falling Leaves S, Fairway Fun S, Maryland Million G1 in Italy, etc.), LOVE SIGN ($934,827, Beldame S, (Cincinnati Trophy S, 2nd DRF Bets Bourbonette Oaks, Lassie S, American Beauty Breeders’ Cup S.
Recommended publications
  • UNDER CAUTION:Layout 1 12/4/13 10:08 AM Page 1

    UNDER CAUTION:Layout 1 12/4/13 10:08 AM Page 1

    UNDER CAUTION:Layout 1 12/4/13 10:08 AM Page 1 UNDER CAUTION A.P. Indy—Coldheartedcat, by Storm Cat Ranked in the Top Five Leading Freshman Sires in 2011 By Horse of the Year and classic winner A. P. INDY, leading sire twice, sire of 140 stakes winners, including champions BERNARDINI, MINESHAFT, RAGS TO RICHES, MARCHFIELD, MALIBU MOON, EYE OF THE LEOPARD and TEMPERA. Out of the winning STORM CAT mare Coldheartedcat. She is a half-sister to classic winner CAVEAT, DEW LINE, BALTIC CHILL and Winters’ Love dam of TRANQUILITY LAKE ($1,662,390), and leading California sire BENCHMARK; granddam of AFTER MARKET ($903,685, sire), COURAGEOUS CAT ($1,165,760, Shoemaker Mile S.-G1, etc.) and JALIL. 2014 FEE: $1,500-LIVE FOAL-SECOND MARE FREE 2 LIFETIME BREEDINGS PER YEAR, NO ADDITIONAL COST $1,500 to be paid when 2014 contract is signed and returned. This offer applies to first 10 bookings in 2014. Property of Medallion Hill Farm LLC SK RACING STABLE Inquiries to (925) 550-2383 or (925) 354-5237 14728 Cool Valley Road, Valley Center, California 92082 (760) 443-9523 / FAX (760) 751-9523 e-mail: [email protected] 184 www.ctba.com California Thoroughbred 2014 Stallion Directory www.ctba.com UnderCautioncs406201ORIGJockeyClubPageSent11-8-2013-NoChange11-27-2013-1245pm :Layout 1 11/27/13 12:48 PM Page1 UNDER CAUTION 2001 Chestnut - Height 16.1 - Dosage Profile: 7-14-19-0-0; DI: 3.21; CD: +0.70 RACE AND (STAKES) RECORD Bold Ruler Boldnesian Age Starts 1st 2nd 3rd Earnings Alanesian Bold Reasoning 2 3 1 0 0 $18,300 Hail to Reason 61 foals, 10 SWs 3 3 0 1 0 2,200 Reason to Earn Sailing Home Seattle Slew Round Table 4 11 2 1 1 36,045 1050 foals, 114 SWs Poker Glamour 5 14 2 1 3 41,700 My Charmer Jet Action 31 5 3 4 $98,245 12 foals, 4 SWs Fair Charmer Myrtle Charm A.P.
  • Kentucky Derby, Flamingo Stakes, Florida Derby, Blue Grass Stakes, Preakness, Queen’S Plate 3RD Belmont Stakes

    Kentucky Derby, Flamingo Stakes, Florida Derby, Blue Grass Stakes, Preakness, Queen’S Plate 3RD Belmont Stakes

    Northern Dancer 90th May 2, 1964 THE WINNER’S PEDIGREE AND CAREER HIGHLIGHTS Pharos Nearco Nogara Nearctic *Lady Angela Hyperion NORTHERN DANCER Sister Sarah Polynesian Bay Colt Native Dancer Geisha Natalma Almahmoud *Mahmoud Arbitrator YEAR AGE STS. 1ST 2ND 3RD EARNINGS 1963 2 9 7 2 0 $ 90,635 1964 3 9 7 0 2 $490,012 TOTALS 18 14 2 2 $580,647 At 2 Years WON Summer Stakes, Coronation Futurity, Carleton Stakes, Remsen Stakes 2ND Vandal Stakes, Cup and Saucer Stakes At 3 Years WON Kentucky Derby, Flamingo Stakes, Florida Derby, Blue Grass Stakes, Preakness, Queen’s Plate 3RD Belmont Stakes Horse Eq. Wt. PP 1/4 1/2 3/4 MILE STR. FIN. Jockey Owner Odds To $1 Northern Dancer b 126 7 7 2-1/2 6 hd 6 2 1 hd 1 2 1 nk W. Hartack Windfields Farm 3.40 Hill Rise 126 11 6 1-1/2 7 2-1/2 8 hd 4 hd 2 1-1/2 2 3-1/4 W. Shoemaker El Peco Ranch 1.40 The Scoundrel b 126 6 3 1/2 4 hd 3 1 2 1 3 2 3 no M. Ycaza R. C. Ellsworth 6.00 Roman Brother 126 12 9 2 9 1/2 9 2 6 2 4 1/2 4 nk W. Chambers Harbor View Farm 30.60 Quadrangle b 126 2 5 1 5 1-1/2 4 hd 5 1-1/2 5 1 5 3 R. Ussery Rokeby Stables 5.30 Mr. Brick 126 1 2 3 1 1/2 1 1/2 3 1 6 3 6 3/4 I.
  • FLATTER Bay Horse; Foaled 1999 Bold Reasoning Seattle Slew

    FLATTER Bay Horse; Foaled 1999 Bold Reasoning Seattle Slew

    FLATTER Bay Horse; foaled 1999 Bold Reasoning Seattle Slew ................... My Charmer A.P. Indy ........................ Secretariat Weekend Surprise........... Lassie Dear FLATTER Raise a Native Mr. Prospector ................ Gold Digger Praise ............................ (1994) Northern Dancer Wild Applause ................ Glowing Tribute By A.P. INDY (1989). Horse of the year, classic winner of $2,979,815, Belmont S. [G1], etc. Leading sire twice, sire of 142 black-type winners, 11 champions, including Mineshaft [G1] ($2,283,402), Rags to Riches [G1] ($1,342,528), Bernardini [G1] ($3,060,480), and of Aptitude [G1] ($1,965,410), Stephen Got Even [G1] ($1,019,200), Pulpit [G1] ($728,200). 1st dam PRAISE, by Mr. Prospector. 2 wins at 3, $61,180. Dam of 6 foals, 4 winners-- CONGRATS (c. by A.P. Indy). 7 wins, 2 to 5, $818,960, in N.A./U.S., San Pasqual H. [G2] (SA, $90,000), Alysheba S. [L] (CD, $70,432), 2nd Santa Anita H. [G1] (SA, $200,000), Memorial Day H. [G3] (CRC, $20,000), Ack Ack H. [L] (HOL, $15,570), 3rd Hollywood Gold Cup H. [G1] (HOL, $90,000), Jim Dandy S. [G2] (SAR, $55,000), Washington Park H. [G2] (AP, $38,500), San Antonio H. [G2] (SA, $30,000). (Total: $998,960). Sire. Flatter (c. by A.P. Indy). Subject stallion. Fete (g. by Horse Chestnut (SAF)). 11 wins at 3 and 4, $310,208. Gigger (g. by Go for Gin). 4 wins, 2 to 6, $100,590. 2nd dam WILD APPLAUSE, by Northern Dancer. 5 wins in 10 starts at 2 and 3, $240,136, Diana H.-G2, Comely S.-G3, 2nd Test S.-G2, 3rd Mother Goose S.-G1.
  • SUNDARBAN :Layout 1 12/4/13 1:15 PM Page 1

    SUNDARBAN :Layout 1 12/4/13 1:15 PM Page 1

    SUNDARBAN :Layout 1 12/4/13 1:15 PM Page 1 SUNDARBAN A.P. Indy—Desert Tigress, by Storm Cat $1.7 million 2007 Keeneland September Yearling Earned $103,340 as the winner of 4 races, including his maiden win by 8 3/4 lengths going gate-to-wire at 1 1/16 miles as the 123-pound highweight. Out of DESERT TIGRESS, by Storm Cat, sister to GROUP 3-winning sire HURRICANE CAT who has six group winners in France and Chile from his first two crops to race & second dam is champion older mare SKY BEAUTY,9GRADE 1 wins, including FILLY TRIPLE CROWN. Third dam is multiple GRADE 1 winner MAPLEJINSKY and this is the family of champions GOLD BEAUTY & DAYJUR, BREEDERS’ CUP DISTAFF (G1) winner PLEASANT HOME ($1,378,070) & multiple 2012 GRADE 1 winner POINT OF ENTRY. By Horse of the Year and Classic winner A.P. INDY, sire of the earners of more than $120 million & 11 champions, including BERNARDINI, MINESHAFT, RAGS TO RICHES, TEMPERA, etc. 2014 FEE: $2,500-LIVE FOAL First foals are two-year-olds of 2014 Standing at MILKY WAY FARM Inquiries to Linda Madsen 34174 De Portola Road, Temecula, California 92592 (909) 241-6600 e-mail: [email protected] • http://www.thoroughbredinfo.com/showcase/sundarban.htm 154 California Thoroughbred 2014 Stallion Directory www.ctba.com SUNDARBAN CS403401ORIGJockeyClubPageSent11-8-2013-1stChngLoretta11-27-2013-1052am:Layout 1 11/27/13 10:53 AM Page1 SUNDARBAN 2006 Bay - Height 16.2 - Dosage Profile: 8-12-21-1-0; DI: 2.65; CD: +0.64 Bold Ruler RACE AND (STAKES) RECORD Boldnesian Alanesian Age Starts 1st 2nd 3rd Earnings Bold Reasoning Hail to Reason 2 unraced 61 foals, 10 SWs Reason to Earn Sailing Home Seattle Slew 3 1 0 0 0 $170 Round Table 1050 foals, 114 SWs 4 9430 98,635 Poker Glamour My Charmer 5 6002 4,535 Jet Action 12 foals, 4 SWs 16 4 3 2 $103,340 Fair Charmer Myrtle Charm A.P.
  • Sunrise Slew Barn 1 Hip No. 32

    Sunrise Slew Barn 1 Hip No. 32

    Consigned by Woodford Thoroughbreds, Agent Hip No. Sunrise Slew Barn 32 1 Boldnesian Bold Reasoning ................ Reason to Earn Seattle Slew ...................... Sunrise Slew Poker My Charmer ...................... Dark Bay or Fair Charmer Brown Mare; Northern Dancer foaled 2000 Danzig .............................. Pas de Nom Selling Sunshine .............. (1987) Boldnesian Bold Bikini ........................ Ran-Tan By SEATTLE SLEW (1974). Horse of the year, Triple Crown winner of $1,208,- 726, Belmont S. -G1 , etc. Leading sire, sire of 24 crops of racing age, 1103 foals, 783 starters, 111 black-type winners, 8 champions, 537 winners of 1544 races and earning $83,853,811. Leading broodmare sire 3 times and U.A.E., sire of dams of 220 black-type winners, including champions Cigar, Lemon Drop Kid, Hishi Akebono, Kawakami Princess, Escena, Golden Attraction, Mulca, Slew of Reality (ARG), Hello Seattle, Letsgoforit. 1st dam SELLING SUNSHINE, by Danzig. Placed at 3, $3,085. Dam of 11 other regis - tered foals, 11 of racing age, 10 to race, 4 winners, including-- BUYING RAIN (g. by Gulch). 9 wins, 3 to 9, $315,500, Bob Harding S. [L] (MTH, $36,000), 2nd John Henry S. (MED, $8,550), Basil Hall S. (PIM, $8,000), Charlie Eckman Mile S. (PIM, $8,000), 3rd John Henry S. [L] (MED, $10,000). Lifeguard (g. by Gulch). 13 wins, 3 to 7, $206,591. 2nd dam BOLD BIKINI , by Boldnesian. 6 wins at 3 and 4, $57,528, Jersey Belle H., etc. Half-sister to TOP KNIGHT ($545,684, champion 2-year-old colt), Hardy Hugh , Dancer's Vixen , Never Burn . Dam of 12 winners, including-- LAW SOCIETY (c.
  • Graydar Oxbow

    Graydar Oxbow

    GRAYDAR OXBOW We have enjoyed tremendous success in standing/managing stallions over the last 20 years. KRIS S. SAINT BALLADO UNBRIDLED’S SONG 2 Dear Breeder, Taylor Made is a family owned and operated farm built on honesty, long-lasting relationships and horsemanship. Taylor Made Stallions’ mode of operation has always been – and remains – to focus on standing quality stallions that provide breeders great opportunities, whether they are breeding to race or sell. 2013 was a bounce-back year for commercial breeders, including a GSVRIVXYVRMRK/IIRIPERH7ITXIQFIVWEPIXLEXWE[KEMRWEGVSWWXLIFSEVHLMKLPMKLXIHF]WIZIR½KYVI]IEVPMRKWERHFSEWXMRK the third highest average of all time. The recent market results have proven that the well-conformed individual has re-emerged as the most important component SJEFY]IV´WWIPIGXMSRGVMXIVME,IVIEX8E]PSV1EHI[IQEOIWYVIIEGLSJSYVWXEPPMSRWVI¾IGXXLEXGSQTSRIRX3YVXIEQLEW been highly selective in providing the breeder a top group of well-conformed stallions whose progeny will be well received at the track and in the sales ring. Last year also marked a bittersweet landmark for one of the great sires of our time. While reaching 17 Grade 1 winners over his historic career in 2013, Unbridled’s Song passed away at the age of 20. Every person at Taylor Made has been touched by this amazing animal over the years. He leaves a lasting legacy that will never be forgotten across the industry he served so well. And yet there is much to look forward to in 2014. The legacy continues with our newest stallion, Graydar, the Grade 1-winning son of Unbridled’s Song. One of the most stunning physicals to come to the breeding shed in years, Graydar had a brilliant VEGIGEVIIVMRGPYHMRKEGSQQERHMRKZMGXSV]MRXLI(SRR,ERHMGET + EX+YPJWXVIEQ4EVO;IEVIGSR½HIRXLI[MPPFI a favorite among breeders as Taylor Made Stallions adds another chapter to its storied tradition.
  • 172 California Thoroughbred 2016 Stallion Directory Race

    172 California Thoroughbred 2016 Stallion Directory Race

    check daily updates on stallionregister.com STORM WOLF dkb/br, 2002 height 16.1 Dosage (5-1-8-0-0); DI: 2.50; CD: 0.79 See gray pages—Nearctic RACE AND (STAKES) RECORD Storm Bird, 1978 Northern Dancer, by Nearctic 6s, SW, $169,181 Age Starts 1st 2nd 3rd Earned Storm Cat, 1983 681 f, 64 SW, 2.27 AEI South Ocean, by New Providence 2 1 0 0 0 $2,640 8s, SW, $570,610 3 4 3(1) 0 0 $145,200 1,414 f, 181 SW, 2.95 AEI Terlingua, 1976 Secretariat, by Bold Ruler 17s, SW, $423,896 Totals 5 3(1) 0 0 $147,840 Stormin Fever, dkb/br, 1994 21s, SW, $484,664 11 f, 9 r, 6 w, 2 SW Crimson Saint, by Crimson Satan Won At 3 745 f, 32 SW, 1.15 AEI Seattle Slew, 1974 Bold Reasoning, by Boldnesian Lazaro Barrera Memorial S (gr. II, $150,000, 7f in 6.60 AWD 17s, SW, $1,208,726 1:22.26, by 6, dftg. Dover Dere, Ransom Demanded, Pennant Fever, 1989 1,050 f, 114 SW, 3.66 AEI My Charmer, by Poker 15s, wnr, $87,222 Thirsty Guy’s, Positive Prize, High Standards). 7 f, 5 r, 4 w, 3 SW Letty's Pennant, 1982 Bold Forbes, by Irish Castle A race at SA ($62,800, 6f in 1:09.13, by 7½, dftg. 19s, wnr, $48,100 Fallfree, Zats It, Cepheus Star, My Boy Joey, Miracle 11 f, 10 r, 9 w, 1 SW Nalees Flying Flag, by Hoist the Flag Maker).
  • Race and (Stakes) Record A.P

    Race and (Stakes) Record A.P

    Entered Stud in 2015 TRITAP gr/ro, 2009 Dosage (6-5-10-1-0); DI: 2.67; CD: 0.73 See gray pages—Bold Ruler RACE AND (STAKES) RECORD A.P. Indy, 1989 Seattle Slew, by Bold Reasoning Age Starts 1st 2nd 3rd Earned 11s, SW, $2,979,815 Pulpit, 1994 1,184 f, 163 SW, 2.89 AEI Weekend Surprise, by Secretariat 2 3 0 2 0 $20,200 6s, SW, $728,200 3 4 2 1 0 $101,736 919 f, 79 SW, 1.85 AEI Preach, 1989 Mr. Prospector, by Raise a Native Tapit, gr/ro, 2001 15s, SW, $304,656 4 2 0 1(1) 0 $34,000 14 f, 12 r, 12 w, 1 SW Narrate, by Honest Pleasure Totals 9 2 4(1) 0 $155,936 6s, SW, $557,300 866 f, 70 SW, 2.33 AEI Unbridled, 1987 Fappiano, by Mr. Prospector Won At 3 7.45 AWD 24s, SW, $4,489,475 An allowance race at CD ($52,000, 9.5f in 1:58.12, Tap Your Heels, 1996 566 f, 49 SW, 2.65 AEI Gana Facil, by Le Fabuleux 9s, SW, $47,275 NTR, dftg. Suns Out Guns Out, Shun, Charlie’s the 10 f, 6 r, 3 w, 1 SW Ruby Slippers, 1982 Nijinsky II, by Northern Dancer Man, Kid Sidney, Starforce, Chalybeate Springs). 14s, wnr, $83,760 A maiden special weight race at Sar ($80,000, 7f in 13 f, 13 r, 10 w, 2 SW Moon Glitter, by In Reality 1:22.56, dftg. Cape Glory, Joking, D’tiger, In Seattle Slew, 1974 Bold Reasoning, by Boldnesian Speight Ofitall, Chief Gaga, Dattts Happy, Guilt Trip, 17s, SW, $1,208,726 Avarice, Starter, Grand Rapids).
  • Breeding Intelligence 20/20 Broodmare Analysis 20/20 Broodmare Analysis

    Breeding Intelligence 20/20 Broodmare Analysis 20/20 Broodmare Analysis

    Breeding Intelligence 20/20 Broodmare Analysis 20/20 Broodmare Analysis Victoire (CAN, 2014, Congrats X Arabis) Location Prepared for Kentucky, USA David Whitford Fee Range Date USD 10,000 - USD 75,000 23/12/2020 Specied Stallions Stallion Match Explained The Stallion Match page shows Graded Results List Columns Stakes Winners from around the world CSI or “Common Similarity Index” is a measure of how close the pedigree of the Graded Stakes Winner that have a similar pedigree to your matches the hypo-mating. In general, values above 18 proposed mating. Based on the indicate a strong similarity. As a rule of thumb, if the concept of “Dig for Gold where Gold results list shows 4 or more horses with CSI of 18 or above, it is usually a good mating. If it shows 2 or has been found before”, it makes sense more horses with CSI above 20, it is usually an that your breeding plans should look exceptional mating. (The Results List is sorted by the CSI column, so the closest matches will appear at the to replicate pedigrees of champion top.) runners and the analysis should look at the entire pedigree. Exact Matches E is for “Exact” matches - this column shows a count of the number of ancestors in the 5-gen pedigree Results List which appear in Exactly the same position. This list will appear on the left side of the page after you click the “Match Similar Pedigrees” button. It A 20/20 Mating shows Graded Stakes winning horses that have a A 20/20 mating occurs when a pattern has two or similar pedigree to your proposed mating more Graded Stakes Winners with CSI values above 20.
  • Friesan Fire Bay Ridgling; Apr 30, 2006 View Complete Auction History 18 Starts, G2 Winner Click Here for Interactive Nicking

    Friesan Fire Bay Ridgling; Apr 30, 2006 View Complete Auction History 18 Starts, G2 Winner Click Here for Interactive Nicking

    equineline.com Product 10N 12/16/19 17:03:15 EST Friesan Fire Bay Ridgling; Apr 30, 2006 View Complete Auction History 18 Starts, G2 winner Click here for Interactive Nicking Bold Ruler, 54 dk b Boldnesian, 63 b Alanesian, 54 b Bold Reasoning, 68 dk b/ Hail to Reason, 58 br Reason to Earn, 63 b Sailing Home, 48 ch Seattle Slew, 74 dk b/ Round Table, 54 b Poker, 63 b Glamour, 53 b My Charmer, 69 b Jet Action, 51 ch Fair Charmer, 59 ch Myrtle Charm, 46 b A.P. Indy, 89 dk b/ *Nasrullah, 40 b Bold Ruler, 54 dk b Miss Disco, 44 b Secretariat, 70 ch *Princequillo, 40 b Somethingroyal, 52 b Imperatrice, 38 dk b Weekend Surprise, 80 b Tom Fool, 49 b Buckpasser, 63 b Busanda, 47 blk Lassie Dear, 74 b Sir Gaylord, 59 dk b Gay Missile, 67 b Missy Baba, 58 b Friesan Fire Bay Ridgling Northern Dancer, 61 b Foaled Apr 30, 2006 Vice Regent, 67 ch in Kentucky Victoria Regina, 58 ch Deputy Minister, 79 dk b/ 18 Starts Bunty's Flight, 53 dk b G2 winner Mint Copy, 70 dk b/ Shakney, 64 dk b/ Dehere, 91 b Bold Ruler, 54 dk b Secretariat, 70 ch Somethingroyal, 52 b Sister Dot, 85 b Damascus, 64 b Sword Game, 76 dk b/ Bill and I, 65 dk b/ Bollinger (AUS), 99 b =Star Kingdom (IRE), 46 =Biscay (AUS), 65 ch ch =Marscay (AUS), 79 ch =Magic Symbol (AUS), 56 ch To Market, 48 ch Bint Marscay (AUS), 90 ch Heart of Market, 67 b Accroche Coeur, 59 b Sir Ivor, 65 b *Sir Tristram, 71 b Isolt, 61 b =Eau d'Etoile (NZ), 82 b Prince Bright, 65 ch =Fille d'Etoile (NZ), 71 ch =Ascalon (NZ), 59 ch Breeder: Grapestock LLC (KY) Inbreeding: Secretariat: 3S X 4D Dosage Profile: 5 12 17 0 0 Bold Ruler: 4S X 5S X 5D Dosage Index: 3.00 Somethingroyal: 4S X 5D Center of Distribution: +0.65 Most Recent Auction Result: Sale Price: RNA $725,000 Sale: Keeneland Association September 2007 Yearling Sale Consignor: Vinery View Complete Auction History Please Note: Nicking Stats and Interactive Nicking are on the following page Copyright © 2019 The Jockey Club Information Systems, Inc.
  • LUCKY PULPIT Ch, 2001

    LUCKY PULPIT Ch, 2001

    LUCKY PULPIT ch, 2001 height 16.0 Dosage (8-7-13-0-0); DI: 3.31; CD: 0.82 See gray pages—Bold Ruler RACE AND (STAKES) RECORD Seattle Slew, 1974 Bold Reasoning, by Boldnesian Age Starts 1st 2nd 3rd Earned 17s, SW, $1,208,726 2 6 2 2(1) 1(1) $95,260 A.P. Indy, 1989 1,050 f, 114 SW, 3.66 AEI My Charmer, by Poker 3 7 0 1(1) 2(1) $47,454 11s, SW, $2,979,815 1,184 f, 163 SW, 2.89 AEI Weekend Surprise, 1980 Secretariat, by Bold Ruler 4 8 1(1) 1 2(1) $55,214 31s, SW, $402,892 5 1 0 1(1) 0 $12,000 Pulpit, b, 1994 6s, SW, $728,200 14 f, 12 r, 9 w, 4 SW Lassie Dear, by Buckpasser Totals 22 3(1) 5(3) 5(3) $209,928 919 f, 79 SW, 1.85 AEI Mr. Prospector, 1970 Raise a Native, by Native Dancer Won At 2 7.66 AWD 14s, SW, $112,171 A race at Dmr ($70,200, 5.5f in 1:04.92). Preach, 1989 1,178 f, 181 SW, 3.98 AEI Gold Digger, by Nashua A maiden special weight race at Hol ($57,200, 5.5f, turf). 15s, SW, $304,656 14 f, 12 r, 12 w, 1 SW Narrate, 1980 Honest Pleasure, by What a Pleasure 2nd Pinjara S (8f, turf, to Rush Into Heaven, by a nose, 27s, SW, $188,856 dftg. Nister Bere, Presumption, True Contender, Kissin 11 f, 7 r, 7 w, 1 SW State, by Nijinsky II Ty, General Moody, Learman, etc.).
  • SLEW's TIZNOW Dkb/Br, 2005

    SLEW's TIZNOW Dkb/Br, 2005

    SLEW’S TIZNOW dkb/br, 2005 Dosage (4-0-8-0-0); DI: 2.00; CD: 0.67 See gray pages—Matchem RACE AND (BLACK TYPE) RECORD Relaunch, 1976 In Reality, by Intentionally Age Starts 1st 2nd 3rd Earned 18s, BTW, $278,100 Cee's Tizzy, 1987 725 f, 87 BTW, 2.66 AEI Foggy Note, by The Axe II 2 3 1 1(1) 0 $140,300 6s, wnr, $173,150 3 3 2(2) 0 0 $107,570 740 f, 28 BTW, 1.58 AEI Tizly, 1981 Lyphard, by Northern Dancer 6s, wnr, $6,209 4 3 0 0 0 $9,000 Tiznow, b, 1997 15s, BTW, $6,427,830 11 f, 9 r, 8 w Tizna, by Trevieres 5 5 1 1(1) 1(1) $64,230 1,477 f, 78 BTW, 1.63 AEI Totals 14 4(2) 2(2) 1(1) $321,100 Seattle Song, 1981 Seattle Slew, by Bold Reasoning 7.71 AWD 9s, BTW, $295,321 Won At 2 Cee's Song, 1986 352 f, 20 BTW, 1.75 AEI Incantation, by Prince Blessed 18s, wnr, $82,225 A maiden special weight race at Sar ($62,000, 7f in 15 f, 13 r, 9 w, 4 BTW Lonely Dancer, 1975 Nice Dancer, by Northern Dancer 1:23.44, by 4¼). 10s, wnr, $3,873 2nd Lane’s End Breeders’ Futurity (G1A, 8.5f, to 15 f, 13 r, 12 w, 2 BTW Sleep Lonely, by Pia Star Wicked Style, dftg. Old Man Buck, Adriano, Tend, Seattle Slew, 1974 Bold Reasoning, by Boldnesian The Roundhouse, Fidelio, Briarwood Circle, Ready 17s, BTW, $1,208,726 Set, Referee, Mikimoto’s Mojo, Gold Train).