TEP1 Polyclonal Antibody (A01)

Total Page：16

File Type：pdf, Size：1020Kb

Produktinformation Diagnostik & molekulare Diagnostik Laborgeräte & Service Zellkultur & Verbrauchsmaterial Forschungsprodukte & Biochemikalien Weitere Information auf den folgenden Seiten! See the following pages for more information! Lieferung & Zahlungsart Lieferung: frei Haus Bestellung auf Rechnung SZABO-SCANDIC Lieferung: € 10,- HandelsgmbH & Co KG Erstbestellung Vorauskassa Quellenstraße 110, A-1100 Wien T. +43(0)1 489 3961-0 Zuschläge F. +43(0)1 489 3961-7 [email protected] • Mindermengenzuschlag www.szabo-scandic.com • Trockeneiszuschlag • Gefahrgutzuschlag linkedin.com/company/szaboscandic • Expressversand facebook.com/szaboscandic TEP1 polyclonal antibody (A01) Catalog # : H00007011-A01 規格 : [ 50 uL ] List All Specification Application Image Product Mouse polyclonal antibody raised against a partial recombinant TEP1. Western Blot (Recombinant protein) Description: ELISA Immunogen: TEP1 (NP_009041, 2529 a.a. ~ 2627 a.a) partial recombinant protein with GST tag. Sequence: ASMDSDASMDSEPTPHLKTRQRRKIHSGSVTALHVLPELLVTASKDRDV KLWERPSMQLLGLFRCEGSVSCLEPWLGANSTLQLAVGDVQGNVYFLN WE Host: Mouse Reactivity: Human Quality Control Antibody Reactive Against Recombinant Protein. Testing: Western Blot detection against Immunogen (37 KDa) . Storage Buffer: 50 % glycerol Storage Store at -20°C or lower. Aliquot to avoid repeated freezing and thawing. Instruction: MSDS: Download Datasheet: Download Applications Western Blot (Recombinant protein) Protocol Download ELISA Gene Information Entrez GeneID: 7011 GeneBank NM_007110 Accession#: Page 1 of 2 2016/5/22 Protein NP_009041 Accession#: Gene Name: TEP1 Gene Alias: TLP1,TP1,TROVE1,VAULT2,p240 Gene telomerase-associated protein 1 Description: Omim ID: 601686 Gene Ontology: Hyperlink Gene Summary: This gene product is a component of the ribonucleoprotein complex responsible for telomerase activity which catalyzes the addition of new telomeres on the chromosome ends. The telomerase-associated proteins are conserved from ciliates to humans. [provided by RefSeq Other TROVE domain family, member 1,telomerase protein component 1 Designations: Related Disease Breast cancer Breast Neoplasms Cardiovascular Diseases Diabetes Mellitus, Type 2 Edema Genetic Predisposition to Disease Lung Neoplasms Neoplasm Metastasis Pulmonary Disease, Chronic Obstructive Urinary Bladder Neoplasms Werner syndrome 服務條款 | 隱私權政策 | 著作及商標 | 網站地圖 ©2016 亞諾法生技股份有限公司 Abnova Corporation. 版權所有. Page 2 of 2 2016/5/22.

Copy Link

Recommended publications

Genomic Correlates of Relationship QTL Involved in Fore- Versus Hind Limb Divergence in Mice
Loyola University Chicago Loyola eCommons Biology: Faculty Publications and Other Works Faculty Publications 2013 Genomic Correlates of Relationship QTL Involved in Fore- Versus Hind Limb Divergence in Mice Mihaela Palicev Gunter P. Wagner James P. Noonan Benedikt Hallgrimsson James M. Cheverud Loyola University Chicago, [email protected] Follow this and additional works at: https://ecommons.luc.edu/biology_facpubs Part of the Biology Commons Recommended Citation Palicev, M, GP Wagner, JP Noonan, B Hallgrimsson, and JM Cheverud. "Genomic Correlates of Relationship QTL Involved in Fore- Versus Hind Limb Divergence in Mice." Genome Biology and Evolution 5(10), 2013. This Article is brought to you for free and open access by the Faculty Publications at Loyola eCommons. It has been accepted for inclusion in Biology: Faculty Publications and Other Works by an authorized administrator of Loyola eCommons. For more information, please contact [email protected]. This work is licensed under a Creative Commons Attribution-Noncommercial-No Derivative Works 3.0 License. © Palicev et al., 2013. GBE Genomic Correlates of Relationship QTL Involved in Fore- versus Hind Limb Divergence in Mice Mihaela Pavlicev1,2,*, Gu¨ nter P. Wagner3, James P. Noonan4, Benedikt Hallgrı´msson5,and James M. Cheverud6 1Konrad Lorenz Institute for Evolution and Cognition Research, Altenberg, Austria 2Department of Pediatrics, Cincinnati Children‘s Hospital Medical Center, Cincinnati, Ohio 3Yale Systems Biology Institute and Department of Ecology and Evolutionary Biology, Yale University 4Department of Genetics, Yale University School of Medicine 5Department of Cell Biology and Anatomy, The McCaig Institute for Bone and Joint Health and the Alberta Children’s Hospital Research Institute for Child and Maternal Health, University of Calgary, Calgary, Canada 6Department of Anatomy and Neurobiology, Washington University *Corresponding author: E-mail: [email protected].
[Show full text]
Variation in the Anopheles Gambiae TEP1 Gene Shapes Local Population Structures of Malaria Mosquitoes
Variation in the Anopheles gambiae TEP1 Gene Shapes Local Population Structures of Malaria Mosquitoes D i s s e r t a t i o n Zur Erlangung des akademischen Grades D o c t o r r e r u m n a t u r a l i u m (Dr. rer. nat.) Im Fach Biologie eingereicht an der Lebenswissenschaftlichen Fakultät der Humboldt-Universität zu Berlin von BSc. (Biochemistry and Molecular Biology), MSc. (Biochemistry) Evans Kiplangat Rono Präsidentin der Humboldt-Universität zu Berlin: Prof. Dr.-Ιng. Dr. Sabine Kunst Dekan der Lebenswissenschaftlichen Fakultät: Prof. Dr. Bernhard Grimm Gutachter/innen: 1. Dr. Elena A. Levashina 2. Prof. Dr. Arturo Zychlinski 3. Prof. Dr. Susanne Hartmann Eingereicht am: Donnerstag, 04.05.2017 Tag der mündlichen Prüfung: Donnerstag, 29.06.2017 ii Zusammenfassung Abstract Zusammenfassung Rund eine halbe Million Menschen sterben jährlich im subsaharischen Afrika an Malaria Infektionen, die von der Anopheles gambiae Mücke übertragen werden. Die Allele (*R1, *R2, *S1 und *S2) des A. gambiae complement-like thioester-containing Protein 1 (TEP1) bestimmen die Fitness der Mücken, welches die männlichen Fertilität und den Resistenzgrad der Mücke gegen Pathogene wie Bakterien und Malaria- Parasiten. Dieser Kompromiss zwischen Reproduktion und Immunnität hat Auswirkungen auf die Größe der Mückenpopulationen und die Rate der Malariaübertragung, wodurch der TEP1 Lokus ein Primärziel für neue Malariakontrollstrategien darstellt. Wie die genetische Diversität von TEP1 die genetische Struktur natürlicher Vektorpopulationen beeinflusst, ist noch unklar. Die Zielsetzung dieser Doktorarbeit waren: i) die biogeographische Kartographierung der TEP1 Allele und Genotypen in lokalen Malariavektorpopulationen in Mali, Burkina Faso, Kamerun, und Kenia, und ii) die Bemessung des Einflusses von TEP1 Polymorphismen auf die Entwicklung humaner P.
[Show full text]
Mouse Tep1 Conditional Knockout Project (CRISPR/Cas9)
https://www.alphaknockout.com Mouse Tep1 Conditional Knockout Project (CRISPR/Cas9) Objective: To create a Tep1 conditional knockout Mouse model (C57BL/6J) by CRISPR/Cas-mediated genome engineering. Strategy summary: The Tep1 gene (NCBI Reference Sequence: NM_009351 ; Ensembl: ENSMUSG00000006281 ) is located on Mouse chromosome 14. 55 exons are identified, with the ATG start codon in exon 2 and the TGA stop codon in exon 55 (Transcript: ENSMUST00000006444). Exon 10 will be selected as conditional knockout region (cKO region). Deletion of this region should result in the loss of function of the Mouse Tep1 gene. To engineer the targeting vector, homologous arms and cKO region will be generated by PCR using BAC clone RP23-321A24 as template. Cas9, gRNA and targeting vector will be co-injected into fertilized eggs for cKO Mouse production. The pups will be genotyped by PCR followed by sequencing analysis. Note: Mice homozygous for a disruption in this gene show no obvious phenotype. No changes are seen in telomerase activity or telomere length. Exon 10 starts from about 19.88% of the coding region. The knockout of Exon 10 will result in frameshift of the gene. The size of intron 9 for 5'-loxP site insertion: 4878 bp, and the size of intron 10 for 3'-loxP site insertion: 990 bp. The size of effective cKO region: ~610 bp. The cKO region does not have any other known gene. Page 1 of 8 https://www.alphaknockout.com Overview of the Targeting Strategy Wildtype allele gRNA region 5' gRNA region 3' 1 10 11 12 13 55 Targeting vector Targeted allele Constitutive KO allele (After Cre recombination) Legends Exon of mouse Tep1 Homology arm cKO region loxP site Page 2 of 8 https://www.alphaknockout.com Overview of the Dot Plot Window size: 10 bp Forward Reverse Complement Sequence 12 Note: The sequence of homologous arms and cKO region is aligned with itself to determine if there are tandem repeats.
[Show full text]
Telomere Shortening and Apoptosis in Telomerase-Inhibited Human Tumor Cells
Downloaded from genesdev.cshlp.org on September 28, 2021 - Published by Cold Spring Harbor Laboratory Press Telomere shortening and apoptosis in telomerase-inhibited human tumor cells Xiaoling Zhang,1 Vernon Mar,1 Wen Zhou,1 Lea Harrington,2 and Murray O. Robinson1,3 1Department of Cancer Biology, Amgen, Thousand Oaks, California 91320 USA; 2Amgen Institute/Ontario Cancer Institute, Toronto, Ontario M5G2C1 Canada Despite a strong correlation between telomerase activity and malignancy, the outcome of telomerase inhibition in human tumor cells has not been examined. Here, we have addressed the role of telomerase activity in the proliferation of human tumor and immortal cells by inhibiting TERT function. Inducible dominant-negative mutants of hTERT dramatically reduced the level of endogenous telomerase activity in tumor cell lines. Clones with short telomeres continued to divide, then exhibited an increase in abnormal mitoses followed by massive apoptosis leading to the loss of the entire population. This cell death was telomere-length dependent, as cells with long telomeres were viable but exhibited telomere shortening at a rate similar to that of mortal cells. It appears that telomerase inhibition in cells with short telomeres lead to chromosomal damage, which in turn trigger apoptotic cell death. These results provide the first direct evidence that telomerase is required for the maintenance of human tumor and immortal cell viability, and suggest that tumors with short telomeres may be effectively and rapidly killed following telomerase inhibition. [Key Words: TERT; telomere; dominant negative; proliferation; cancer] Received June 4, 1999; revised version accepted August 3, 1999. The termini of most eukaryotic chromosomes are com- TEP1 binds the telomerase RNA and associates with posed of terminal repeats called telomeres.
[Show full text]
Tetrahymena Proteins P80 and P95 Are Not Core Telomerase Components
Tetrahymena proteins p80 and p95 are not core telomerase components Douglas X. Mason*†, Chantal Autexier†‡, and Carol W. Greider*†§ *Department of Molecular Biology and Genetics, The Johns Hopkins University School of Medicine, Baltimore, MD 21205; and †Cold Spring Harbor Laboratory, Cold Spring Harbor, NY 11724 Communicated by Thomas J. Kelly, The Johns Hopkins University, Baltimore, MD, August 29, 2001 (received for review July 3, 2001) Telomeres provide stability to eukaryotic chromosomes and consist activity is still present in cells that lack these genes (34). EST1 of tandem DNA repeat sequences. Telomeric repeats are synthe- and EST3 physically interact with telomerase and telomerase sized and maintained by a specialized reverse transcriptase, termed RNA, indicating they are telomerase-associated proteins (33). In telomerase. Tetrahymena thermophila telomerase contains two human cells, telomerase-associated protein 1 (TEP1) and the essential components: Tetrahymena telomerase reverse transcrip- chaperone proteins hsp90 and p23 were found to interact with tase (tTERT), the catalytic protein component, and telomerase RNA the hTERT protein and telomerase activity (35, 36). The pro- that provides the template for telomere repeat synthesis. In addi- teins L22, hStau, and dyskerin bind human telomerase RNA and tion to these two components, two proteins, p80 and p95, were are associated with telomerase activity in cell extracts (37, 38). previously found to copurify with telomerase activity and to In the ciliate E. audiculatus, the protein p43 was identified by interact with tTERT and telomerase RNA. To investigate the role of copurification with TERT and telomerase activity (39). p43 is p80 and p95 in the telomerase enzyme, we tested the interaction physically associated with telomerase activity in cell extracts and of p80, p95, and tTERT in several different recombinant expression is a homologue of the human La protein (40).
[Show full text]
Telomere Length Regulation in Mice Is Linked to a Novel Chromosome Locus
Proc. Natl. Acad. Sci. USA Vol. 95, pp. 8648–8653, July 1998 Cell Biology Telomere length regulation in mice is linked to a novel chromosome locus LINGXIANG ZHU*†,KAREN S. HATHCOCK*‡§,PRAKASH HANDE¶,PETER M. LANSDORP¶,MICHAEL F. SELDIN†, i AND RICHARD J. HODES‡ †Rowe Program in Genetics, Departments of Biological Chemistry and Medicine University of California, Davis, Davis, CA 95616; ‡Experimental Immunology Branch, National Cancer Institute, National Institutes of Health, Bethesda, MD 20892; ¶Terry Fox Laboratory for HematologyyOncology, British Columbia Cancer Research Center, 601 West 10th Avenue, Vancouver, BC V5Z 1L3, Canada; and iNational Institute on Aging, National Institutes of Health, Bethesda, MD 20892 Edited by Irving L. Weissman, Stanford University School of Medicine, Stanford, CA, and approved, May 20, 1998 (received for review September 15, 1997) ABSTRACT Little is known about the mechanisms that housed in the animal facility at PerImmune, Rockville, MD or regulate species-specific telomere length, particularly in mam- Bioqual, Rockville, MD. malian species. The genetic regulation of telomere length was Telomere Length Analysis. Single cell suspensions of spleen therefore investigated by using two inter-fertile species of were generated by conventional methods. Single cell suspen- mice, which differ in their telomere length. Mus musculus sions of liver were generated by incubating minced livers with (telomere length >25 kb) and Mus spretus (telomere length collagenase, type IV, (2 mgyml; Sigma) for 30 min at 37°C. 5–15 kb) were used to generate F1 crosses and reciprocal After depleting red blood cells, cell suspensions were mixed backcrosses, which were then analyzed for regulation of with an equal volume of 1.2% Incert Agarose (FMC) to make telomere length.
[Show full text]
Genetic Variants in the TEP1 Gene Are Associated with Prostate Cancer Risk and Recurrence
Prostate Cancer and Prostatic Diseases (2015) 18, 310–316 © 2015 Macmillan Publishers Limited All rights reserved 1365-7852/15 www.nature.com/pcan ORIGINAL ARTICLE Genetic variants in the TEP1 gene are associated with prostate cancer risk and recurrence CGu1,2,8,QLi2,3,4,8, Y Zhu1,2,8,YQu1,2, G Zhang1,2, M Wang2,3, Y Yang5,6, J Wang5,6, L Jin5,6,QWei3,7 and D Ye1,2 BACKGROUND: Telomere-related genes play an important role in carcinogenesis and progression of prostate cancer (PCa). It is not fully understood whether genetic variations in telomere-related genes are associated with development and progression in PCa patients. METHODS: Six potentially functional single-nucleotide polymorphisms (SNPs) of three key telomere-related genes were evaluated in 1015 PCa cases and 1052 cancer-free controls, to test their associations with risk of PCa. Among 426 PCa patients who underwent radical prostatectomy (RP), the prognostic significance of the studied SNPs on biochemical recurrence (BCR) was also assessed using the Kaplan–Meier analysis and Cox proportional hazards regression model. The relative telomere lengths (RTLs) were measured in peripheral blood leukocytes using real-time PCR in the RP patients. RESULTS: TEP1 rs1760904 AG/AA genotypes were significantly associated with a decreased risk of PCa (odds ratio (OR): 0.77, 95% confidence interval (CI): 0.64–0.93, P = 0.005) compared with the GG genotype. By using median RTL as a cutoff level, RP patients with TEP1 rs1760904 AG/AA genotypes tended to have a longer RTL than those with the GG genotype (OR: 1.55, 95% CI: 1.04–2.30, P = 0.031).
[Show full text]
Worldwide Genetic Structure in 37 Genes Important in Telomere Biology
Heredity (2012) 108, 124–133 & 2012 Macmillan Publishers Limited All rights reserved 0018-067X/12 www.nature.com/hdy ORIGINAL ARTICLE Worldwide genetic structure in 37 genes important in telomere biology L Mirabello1, M Yeager2, S Chowdhury2,LQi2, X Deng2, Z Wang2, A Hutchinson2 and SA Savage1 1Clinical Genetics Branch, Division of Cancer Epidemiology and Genetics, National Cancer Institute, National Institutes of Health, Department of Health and Human Services, Bethesda, MD, USA and 2Core Genotyping Facility, National Cancer Institute, Division of Cancer Epidemiology and Genetics, SAIC-Frederick, Inc., NCI-Frederick, Frederick, MD, USA Telomeres form the ends of eukaryotic chromosomes and and differentiation were signiﬁcantly lower in telomere are vital in maintaining genetic integrity. Telomere dysfunc- biology genes compared with the innate immunity genes. tion is associated with cancer and several chronic diseases. There was evidence of evolutionary selection in ACD, Patterns of genetic variation across individuals can provide TERF2IP, NOLA2, POT1 and TNKS in this data set, which keys to further understanding the evolutionary history of was consistent in HapMap 3. TERT had higher than genes. We investigated patterns of differentiation and expected levels of haplotype diversity, likely attributable to population structure of 37 telomere maintenance genes a lack of linkage disequilibrium, and a potential cancer- among 53 worldwide populations. Data from 898 unrelated associated SNP in this gene, rs2736100, varied substantially individuals were obtained from the genome-wide scan of the in genotype frequency across major continental regions. It is Human Genome Diversity Panel (HGDP) and from 270 possible that the genes under selection could inﬂuence unrelated individuals from the International HapMap Project telomere biology diseases.
[Show full text]
Predicted Binding Sites for the Regulatory Small Vault Rnas on Messenger Rnas
Predicted Binding Sites for the Regulatory Small Vault RNAs on Messenger RNAs of Selected Genes Relating to Cancer, Multi-drug Resistance, and Inflammation Craig Jackson Predicted Binding Sites for the Regulatory Small Vault RNAs on Messenger RNAs of Selected Genes Relating to Cancer, Multi-drug Resistance, and Inflammation An Honors Thesis (HONRS 499) By Craig Jackson Thesis Advisor Dr. Carolyn Vann Ball State University Muncie, Indiana May 2010 Expected Date of Graduation May 2010 · r ~ J I LA ndcr or l"',cT, --h~: I 1. -r~ ;"t.I-;?v 2 Jj Abstract .Q '0 Vaults are large ribonucleoprotein particles believed to be involved in multidrug resistance and intracellular transport. The vault complex consists of three proteins and non-coding vault RNAs. It has been shown that the non-coding vault RNA encodes regulatory small vault RNAs (svRNAs). These svRNAs associate with the RNA-induced silencing complex and regulate gene expression similarly to microRNAs. It is unknown which genes the svRNAs regulate, but they are thought to regulate genes relating to multidrug resistance and intracellular antigen transport. I have selected several genes of interest relating to cancer, multidrug resistance, inflammation, and the autoimmune response to predict whether the svRNAs regulate these genes. Since the svRNAs regulate genes similarly to microRNA, I used microRNA target prediction tools to find potential functional binding sites for the svRNAs in the 3' untranslated regions of the selected gene messenger RNAs. I found several target sites that have a very high potential to be functional binding sites for the svRNAs. These results can be used to conduct experiments to verify that the svRNAs bind to the predicted target sites and regulate the expression of the targeted gene.
[Show full text]
Tissue-Specific Expression and Regulation of Sexually Dimorphic Genes in Mice
Downloaded from genome.cshlp.org on September 28, 2021 - Published by Cold Spring Harbor Laboratory Press Letter Tissue-specific expression and regulation of sexually dimorphic genes in mice Xia Yang,1 Eric E. Schadt,2 Susanna Wang,3 Hui Wang,4 Arthur P. Arnold,5 Leslie Ingram-Drake,3 Thomas A. Drake,6 and Aldons J. Lusis1,3,7 1Department of Medicine, David Geffen School of Medicine, University of California, Los Angeles, California 90095, USA; 2Rosetta Inpharmatics, LLC, a Wholly Owned Subsidiary of Merck & Co. Inc., Seattle, Washington 98109, USA; 3Department of Human Genetics, University of California, Los Angeles, California 90095, USA; 4Department of Statistics, College of Letters and Science, University of California, Los Angeles, California 90095, USA; 5Department of Physiological Science, and Laboratory of Neuroendocrinology of the Brain Research Institute, University of California, Los Angeles, California 90095, USA; 6Department of Pathology and Laboratory Medicine, University of California, Los Angeles, California 90095, USA We report a comprehensive analysis of gene expression differences between sexes in multiple somatic tissues of 334 mice derived from an intercross between inbred mouse strains C57BL/6J and C3H/HeJ. The analysis of a large number of individuals provided the power to detect relatively small differences in expression between sexes, and the use of an intercross allowed analysis of the genetic control of sexually dimorphic gene expression. Microarray analysis of 23,574 transcripts revealed that the extent of sexual dimorphism in gene expression was much greater than previously recognized. Thus, thousands of genes showed sexual dimorphism in liver, adipose, and muscle, and hundreds of genes were sexually dimorphic in brain.
[Show full text]
Recurrent Allelic Deletions at Mouse Chromosomes 4 and 14 in Myc-Induced Liver Tumors
Oncogene (2002) 21, 1518 ± 1526 ã 2002 Nature Publishing Group All rights reserved 0950 ± 9232/02 $25.00 www.nature.com/onc Recurrent allelic deletions at mouse chromosomes 4 and 14 in Myc-induced liver tumors Yuanfei Wu1, Claire-AngeÂ lique Renard1, FrancËoise Apiou3, Michel Huerre2, Pierre Tiollais1, Bernard Dutrillaux3 and Marie Annick Buendia*,1 1UniteÂ de Recombinaison et Expression GeÂneÂtique (Inserm U163), Institut Pasteur, 28 rue du Dr. Roux, 75015 Paris, France; 2UniteÂ d'Histopathologie, Institut Pasteur, 28 rue du Dr. Roux, 75015 Paris, France; 3CNRS UMR 147, Institut Curie, 26 rue d'Ulm, Paris, France Transgenic mice expressing the c-Myc oncogene driven by Introduction woodchuck hepatitis virus (WHV) regulatory sequences develop hepatocellular carcinoma with a high frequency. To Hepatocellular carcinoma (HCC) is among the com- investigate genetic lesions that cooperate with Myc in liver monest cancers worldwide, with an increasing annual carcinogenesis, we conducted a genome-wide scan for loss of incidence in many countries (Bosch, 1997; El-Serag and heterozygosity (LOH) and mutational analysis of b-catenin Mason, 1999). In more than 80% of cases, HCC in 37 hepatocellular adenomas and carcinomas from development has been linked to chronic infection with C57BL/6 x castaneus F1 transgenic mice. In a subset of hepatitis B and C viruses. Other risk factors include these tumors, chromosome imbalances were examined by alcohol-related cirrhosis and dietary exposure to comparative genomic hybridization (CGH). Allelotyping a¯atoxin B1 (Schafer and Sorell, 1999). Allelotype with 99 microsatellite markers spanning all autosomes studies of human HCC have demonstrated recurrent revealed allelic imbalances at one or more chromosomes in loss of heterozygosity (LOH) at multiple chromosome 83.8% of cases.
[Show full text]
A Novel Pseudoknot Element Is Essential for the Action of a Yeast Telomerase
Downloaded from genesdev.cshlp.org on September 26, 2021 - Published by Cold Spring Harbor Laboratory Press A novel pseudoknot element is essential for the action of a yeast telomerase Yehuda Tzfati,1 Zachary Knight, Jagoree Roy, and Elizabeth H. Blackburn2 Department of Biochemistry and Biophysics, University of California San Francisco, San Francisco, California 94143-2200, USA Telomerase contains an essential RNA, which includes the template sequence copied by the reverse transcription action of telomerase into telomeric DNA. Using phylogenetic comparison, we identified seven conserved sequences in telomerase RNAs from Kluyveromyces budding yeasts. We show that two of these sequences, CS3 and CS4, are essential for normal telomerase function and can base-pair to form a putative long-range pseudoknot. Disrupting this base-pairing was deleterious to cell growth, telomere maintenance, and telomerase activity. Restoration of the base-pairing potential alleviated these phenotypes. Mutating this pseudoknot caused a novel mode of shifting of the boundaries of the RNA template sequence copied by telomerase. A phylogenetically derived model of yeast TER structure indicates that these RNAs can form two alternative predicted core conformations of similar stability: one brings the CS3/CS4 pseudoknot spatially close to the template; in the other, CS3 and CS4 move apart and the conformation of the template is altered. We propose that such disruption of the pseudoknot, and potentially the predicted telomerase RNA conformation, affects polymerization to cause the observed shifts in template usage. [Keywords: telomerase, yeast telomerase RNA; telomerase RNA pseudoknot; telomerase RNAsecondary structure; telomerase template miscopying] Supplemental material is available at http://www.genesdev.org. Received March 31, 2003; revised version accepted May 14, 2003.
[Show full text]