CALCOCO2 Maxpab Rabbit Polyclonal Antibody (D01)

Total Page：16

File Type：pdf, Size：1020Kb

CALCOCO2 Maxpab Rabbit Polyclonal Antibody (D01)

CALCOCO2 MaxPab rabbit Gene Summary: The protein encoded by this gene is a polyclonal antibody (D01) subunit of nuclear domain 10 (ND10) bodies. ND10 bodies are nuclear domains appearing Catalog Number: H00010241-D01 immunohistochemically as ten dots per nucleus. They are believed to be associated with the nuclear matrix on Regulatory Status: For research use only (RUO) the basis of their resistance to nuclease digestion and salt extraction. ND10 proteins are removed from the Product Description: Rabbit polyclonal antibody raised nucleus by herpes simplex virus-1 infection and may against a full-length human CALCOCO2 protein. have a role in viral life cycles. [provided by RefSeq] Immunogen: CALCOCO2 (NP_005822.1, 1 a.a. ~ 446 References: a.a) full-length human protein. 1. Caspase-11 activation requires lysis of pathogen-containing vacuoles by IFN-induced GTPases. Sequence: Meunier E, Dick MS, Dreier RF, Schurmann N, MEETIKDPPTSAVLLDHCHFSQVIFNSVEKFYIPGGDVT Kenzelmann Broz D, Warming S, Roose-Girma M, CHYTFTQHFIPRRKDWIGIFRVGWKTTREYYTFMWVT Bumann D, Kayagaki N, Takeda K, Yamamoto M, Broz LPIDLNNKSAKQQEVQFKAYYLPKDDEYYQFCYVDED P Nature. 2014 May 15;509(7500):366-70. doi: GVVRGASIPFQFRPENEEDILVVTTQGEVEEIEQHNKE 10.1038/nature13157. Epub 2014 Apr 16. LCKENQELKDSCISLQKQNSDMQAELQKKQEELETLQ 2. The ubiquitin ligase parkin mediates resistance to SINKKLELKVKEQKDYWETELLQLKEQNQKMSSENEK intracellular pathogens. Manzanillo PS, Ayres JS, MGIRVDQLQAQLSTQEKEMEKLVQGDQDKTEQLEQL Watson RO, Collins AC, Souza G, Rae CS, Schneider KKENDHLFLSLTEQRKDQKKLEQTVEQMKQNETTAMK DS, Nakamura K, Shiloh MU, Cox JS Nature. 2013 Sep KQQELMDENFDLSKRLSENEIICNALQRQKERLEGEN 4. doi: 10.1038/nature12566. DLLKRENSRLLSYMGLDFNSLPYQVPTSDEGGARQNP GLAYGNPYSGIQESSSPSPLSIKKCPICKADDICDHTLE QQQMQPLCFNCPICDKIFPATEKQIFEDHVFCHSL Host: Rabbit Reactivity: Human Applications: IP, WB-Tr (See our web site product page for detailed applications information) Protocols: See our web site at http://www.abnova.com/support/protocols.asp or product page for detailed protocols Storage Buffer: No additive Storage Instruction: Store at -20°C or lower. Aliquot to avoid repeated freezing and thawing. Entrez GeneID: 10241 Gene Symbol: CALCOCO2 Gene Alias: MGC17318, NDP52 Page 1/1 Powered by TCPDF (www.tcpdf.org).

Copy Link

Recommended publications

A Computational Approach for Defining a Signature of Β-Cell Golgi Stress in Diabetes Mellitus
Page 1 of 781 Diabetes A Computational Approach for Defining a Signature of β-Cell Golgi Stress in Diabetes Mellitus Robert N. Bone1,6,7, Olufunmilola Oyebamiji2, Sayali Talware2, Sharmila Selvaraj2, Preethi Krishnan3,6, Farooq Syed1,6,7, Huanmei Wu2, Carmella Evans-Molina 1,3,4,5,6,7,8* Departments of 1Pediatrics, 3Medicine, 4Anatomy, Cell Biology & Physiology, 5Biochemistry & Molecular Biology, the 6Center for Diabetes & Metabolic Diseases, and the 7Herman B. Wells Center for Pediatric Research, Indiana University School of Medicine, Indianapolis, IN 46202; 2Department of BioHealth Informatics, Indiana University-Purdue University Indianapolis, Indianapolis, IN, 46202; 8Roudebush VA Medical Center, Indianapolis, IN 46202. *Corresponding Author(s): Carmella Evans-Molina, MD, PhD ([email protected]) Indiana University School of Medicine, 635 Barnhill Drive, MS 2031A, Indianapolis, IN 46202, Telephone: (317) 274-4145, Fax (317) 274-4107 Running Title: Golgi Stress Response in Diabetes Word Count: 4358 Number of Figures: 6 Keywords: Golgi apparatus stress, Islets, β cell, Type 1 diabetes, Type 2 diabetes 1 Diabetes Publish Ahead of Print, published online August 20, 2020 Diabetes Page 2 of 781 ABSTRACT The Golgi apparatus (GA) is an important site of insulin processing and granule maturation, but whether GA organelle dysfunction and GA stress are present in the diabetic β-cell has not been tested. We utilized an informatics-based approach to develop a transcriptional signature of β-cell GA stress using existing RNA sequencing and microarray datasets generated using human islets from donors with diabetes and islets where type 1(T1D) and type 2 diabetes (T2D) had been modeled ex vivo. To narrow our results to GA-specific genes, we applied a filter set of 1,030 genes accepted as GA associated.
[Show full text]
A Genome-Wide CRISPR Screen Identifies Regulators of Beta Cell
bioRxiv preprint doi: https://doi.org/10.1101/2021.05.28.445984; this version posted May 28, 2021. The copyright holder for this preprint (which was not certified by peer review) is the author/funder, who has granted bioRxiv a license to display the preprint in perpetuity. It is made available under aCC-BY-NC-ND 4.0 International license. 1 A genome-wide CRISPR screen identifies regulators of beta cell 2 function involved in type 2 diabetes risk 3 Antje K Grotz1, Elena Navarro-Guerrero2, Romina J Bevacqua3,4, Roberta Baronio2, Soren K 4 Thomsen1, Sameena Nawaz1, Varsha Rajesh4,5, Agata Wesolowska-Andersen6, Seung K Kim3,4, 5 Daniel Ebner2, Anna L Gloyn1,4,5,6,7* 6 1. Oxford Centre for Diabetes, Endocrinology and Metabolism, Radcliffe Department of Medicine, 7 University of Oxford, Oxford, OX3 7LE, UK. 8 2. Target Discovery Institute, Nuffield Department of Medicine, University of Oxford, Oxford OX3 9 7FZ, UK. 10 3. Department of Developmental Biology, Stanford University School of Medicine, Stanford, CA, 11 USA. 12 4. Stanford Diabetes Research Centre, Stanford School of Medicine, Stanford University, Stanford, 13 CA, USA 14 5. Department of Pediatrics, Division of Endocrinology, Stanford School of Medicine, Stanford 15 University, Stanford, CA, USA. 16 6. Wellcome Centre for Human Genetics, Nuffield Department of Medicine, University of Oxford, 17 Oxford, OX3 7BN, UK. 18 7. Oxford NIHR Biomedical Research Centre, Oxford University Hospitals Trust, Oxford, OX3 19 7LE, UK. 20 21 *Correspondence: Anna L. Gloyn, Division of Endocrinology, Department of Pediatrics, Stanford School of 22 Medicine, Stanford University, Stanford, CA, USA.
[Show full text]
Global Ubiquitylation Analysis of Mitochondria in Primary Neurons
bioRxiv preprint doi: https://doi.org/10.1101/2021.04.01.438131; this version posted April 1, 2021. The copyright holder for this preprint (which was not certified by peer review) is the author/funder, who has granted bioRxiv a license to display the preprint in perpetuity. It is made available under aCC-BY-NC 4.0 International license. Global ubiquitylation analysis of mitochondria in primary neurons identifies physiological Parkin targets following activation of PINK1 Odetta Antico1#, Alban Ordureau2#, Michael Stevens1, Francois Singh1, Marek φ Gierlinski3, Erica Barini1 , Mollie L. Rickwood1, Alan Prescott4, Rachel Toth1, Ian G. Ganley1, J. Wade Harper2*, and Miratul M. K. Muqit1* 1MRC Protein Phosphorylation and Ubiquitylation Unit, School of Life Sciences, University of Dundee, Dundee, United Kingdom, DD1 5EH, U.K. 2Department of Cell Biology, Harvard Medical School, Boston, MA 02115, USA 3Data Analysis Group, Division of Computational Biology, School of Life Sciences, University of Dundee, Dundee, United Kingdom, DD1 5EH, U.K. 4Dundee Imaging Facility, School of Life Sciences, University of Dundee, Dundee, United Kingdom, DD1 5EH, U.K #Denotes Equal Contribution φCurrent address: AbbVie Deutschland GmbH & Co, Knollstr, 67061, Ludwigshafen, Germany *Correspondence: [email protected] or [email protected] Keywords Neurons, PINK1, Parkin, ubiquitin, Parkinson’s disease, Mitochondria, Running Title: Ubiquitin analysis of mitochondria in neurons 1 bioRxiv preprint doi: https://doi.org/10.1101/2021.04.01.438131; this version posted April 1, 2021. The copyright holder for this preprint (which was not certified by peer review) is the author/funder, who has granted bioRxiv a license to display the preprint in perpetuity.
[Show full text]
Mechanistic Insights Into the Interactions of NAP1 with the SKICH Domains of NDP52 and TAX1BP1
Mechanistic insights into the interactions of NAP1 with the SKICH domains of NDP52 and TAX1BP1 Tao Fua, Jianping Liua, Yingli Wanga, Xingqiao Xiea, Shichen Hua, and Lifeng Pana,1 aState Key Laboratory of Bioorganic and Natural Products Chemistry, Center for Excellence in Molecular Synthesis, Shanghai Institute of Organic Chemistry, University of Chinese Academy of Sciences, Chinese Academy of Sciences, 200032 Shanghai, China Edited by Beth Levine, The University of Texas Southwestern, Dallas, TX, and approved October 30, 2018 (received for review July 3, 2018) NDP52 and TAX1BP1, two SKIP carboxyl homology (SKICH) domain- enterica Typhimurium, and the depolarized mitochondria (mitoph- containing autophagy receptors, play crucial roles in selective agy) (15–18). In addition, NDP52 was reported to mediate selective autophagy. The autophagic functions of NDP52 and TAX1BP1 are autophagic degradations of retrotransposon RNA (19) and specific regulated by TANK-binding kinase 1 (TBK1), which may associate functional proteins, including DICER and AGO2 in the miRNA with them through the adaptor NAP1. However, the molecular pathway and MAVS in immune signaling (20, 21). Notably, genetic mechanism governing the interactions of NAP1 with NDP52 and mutation of NDP52 is directly linked to Crohn’s disease, a type of TAX1BP1, as well as the effects induced by TBK1-mediated phos- inflammatory bowel disease likely caused by a combination of en- phorylation of NDP52 and TAX1BP1, remains elusive. Here, we vironmental, immune, and bacterial factors (22). Except for the report the atomic structures of the SKICH regions of NDP52 and diverse central coiled-coil region, NDP52 and TAX1BP1 share a TAX1BP1 in complex with NAP1, which not only uncover the mech- highly similar domain structure (Fig.
[Show full text]
Agricultural University of Athens
ΓΕΩΠΟΝΙΚΟ ΠΑΝΕΠΙΣΤΗΜΙΟ ΑΘΗΝΩΝ ΣΧΟΛΗ ΕΠΙΣΤΗΜΩΝ ΤΩΝ ΖΩΩΝ ΤΜΗΜΑ ΕΠΙΣΤΗΜΗΣ ΖΩΙΚΗΣ ΠΑΡΑΓΩΓΗΣ ΕΡΓΑΣΤΗΡΙΟ ΓΕΝΙΚΗΣ ΚΑΙ ΕΙΔΙΚΗΣ ΖΩΟΤΕΧΝΙΑΣ ΔΙΔΑΚΤΟΡΙΚΗ ΔΙΑΤΡΙΒΗ Εντοπισμός γονιδιωματικών περιοχών και δικτύων γονιδίων που επηρεάζουν παραγωγικές και αναπαραγωγικές ιδιότητες σε πληθυσμούς κρεοπαραγωγικών ορνιθίων ΕΙΡΗΝΗ Κ. ΤΑΡΣΑΝΗ ΕΠΙΒΛΕΠΩΝ ΚΑΘΗΓΗΤΗΣ: ΑΝΤΩΝΙΟΣ ΚΟΜΙΝΑΚΗΣ ΑΘΗΝΑ 2020 ΔΙΔΑΚΤΟΡΙΚΗ ΔΙΑΤΡΙΒΗ Εντοπισμός γονιδιωματικών περιοχών και δικτύων γονιδίων που επηρεάζουν παραγωγικές και αναπαραγωγικές ιδιότητες σε πληθυσμούς κρεοπαραγωγικών ορνιθίων Genome-wide association analysis and gene network analysis for (re)production traits in commercial broilers ΕΙΡΗΝΗ Κ. ΤΑΡΣΑΝΗ ΕΠΙΒΛΕΠΩΝ ΚΑΘΗΓΗΤΗΣ: ΑΝΤΩΝΙΟΣ ΚΟΜΙΝΑΚΗΣ Τριμελής Επιτροπή: Aντώνιος Κομινάκης (Αν. Καθ. ΓΠΑ) Ανδρέας Κράνης (Eρευν. B, Παν. Εδιμβούργου) Αριάδνη Χάγερ (Επ. Καθ. ΓΠΑ) Επταμελής εξεταστική επιτροπή: Aντώνιος Κομινάκης (Αν. Καθ. ΓΠΑ) Ανδρέας Κράνης (Eρευν. B, Παν. Εδιμβούργου) Αριάδνη Χάγερ (Επ. Καθ. ΓΠΑ) Πηνελόπη Μπεμπέλη (Καθ. ΓΠΑ) Δημήτριος Βλαχάκης (Επ. Καθ. ΓΠΑ) Ευάγγελος Ζωίδης (Επ.Καθ. ΓΠΑ) Γεώργιος Θεοδώρου (Επ.Καθ. ΓΠΑ) 2 Εντοπισμός γονιδιωματικών περιοχών και δικτύων γονιδίων που επηρεάζουν παραγωγικές και αναπαραγωγικές ιδιότητες σε πληθυσμούς κρεοπαραγωγικών ορνιθίων Περίληψη Σκοπός της παρούσας διδακτορικής διατριβής ήταν ο εντοπισμός γενετικών δεικτών και υποψηφίων γονιδίων που εμπλέκονται στο γενετικό έλεγχο δύο τυπικών πολυγονιδιακών ιδιοτήτων σε κρεοπαραγωγικά ορνίθια. Μία ιδιότητα σχετίζεται με την ανάπτυξη (σωματικό βάρος στις 35 ημέρες, ΣΒ) και η άλλη με την αναπαραγωγική
[Show full text]
Anti-Galectin 8 Picoband Antibody Catalog # ABO12345
10320 Camino Santa Fe, Suite G San Diego, CA 92121 Tel: 858.875.1900 Fax: 858.622.0609 Anti-Galectin 8 Picoband Antibody Catalog # ABO12345 Specification Anti-Galectin 8 Picoband Antibody - Product Information Application WB Primary Accession O00214 Host Rabbit Reactivity Human, Mouse, Rat Clonality Polyclonal Format Lyophilized Description Rabbit IgG polyclonal antibody for Galectin-8(LGALS8) detection. Tested with WB in Human;Rat. Reconstitution Add 0.2ml of distilled water will yield a concentration of 500ug/ml. Anti- Galectin 8 Picoband antibody, ABO12345, Western blottingAll lanes: Anti Anti-Galectin 8 Picoband Antibody - Additional Galectin 8 (ABO12345) at 0.5ug/mlLane 1: Information Rat Brain Tissue Lysate at 50ugLane 2: Rat Kidney Tissue Lysate at 50ugLane 3: Human Gene ID 3964 Placenta Tissue Lysate at 50ugLane 4: HELA Whole Cell Lysate at 40ugLane 5: A431 Other Names Whole Cell Lysate at 40ugPredicted bind size: Galectin-8, Gal-8, Po66 36KDObserved bind size: 50KD carbohydrate-binding protein, Po66-CBP, Prostate carcinoma tumor antigen 1, PCTA-1, LGALS8 Anti-Galectin 8 Picoband Antibody - Background Calculated MW 35808 MW KDa Galectin-8 is a protein of the galectin family that in humans is encoded by the LGALS8 Application Details gene. This gene encodes a member of the Western blot, 0.1-0.5 µg/ml, Human, galectin family. Galectins are Rat<br> beta-galactoside-binding animal lectins with conserved carbohydrate recognition domains. Subcellular Localization The galectins have been implicated in many Cytoplasm . essential functions including development, differentiation, cell-cell adhesion, cell-matrix Tissue Specificity interaction, growth regulation, apoptosis, and Ubiquitous. Selective expression by RNA splicing.
[Show full text]
De Novo T(12;17)(P13.3;Q21.3) Translocation with a Breakpoint Near
European Journal of Human Genetics (2007) 15, 570–577 & 2007 Nature Publishing Group All rights reserved 1018-4813/07 $30.00 www.nature.com/ejhg ARTICLE De novo t(12;17)(p13.3;q21.3) translocation with a breakpoint near the 50 end of the HOXB gene cluster in a patient with developmental delay and skeletal malformations Ying Yue1, Ruxandra Farcas1, Gundula Thiel2, Christiane Bommer3,Ba¨rbel Grossmann1, Danuta Galetzka1, Christina Kelbova4, Peter Ku¨pferling4, Angelika Daser1, Ulrich Zechner1 and Thomas Haaf*,1 1Institute for Human Genetics, Johannes Gutenberg University Mainz, Mainz, Germany; 2Human Genetic Practice, Berlin, Germany; 3Institute for Medical Genetics, Faculty of Medicine, Charite, Berlin, Germany; 4Human Genetic Practice, Cottbus, Germany A boy with severe mental retardation, funnel chest, bell-shaped thorax, and hexadactyly of both feet was found to have a balanced de novo t(12;17)(p13.3;q21.3) translocation. FISH with BAC clones and long- range PCR products assessed in the human genome sequence localized the breakpoint on chromosome 17q21.3 to a 21-kb segment that lies o30 kb upstream of the HOXB gene cluster and immediately adjacent to the 30 end of the TTLL6 gene. The breakpoint on chromosome 12 occurred within telomeric hexamer repeats and, therefore, is not likely to affect gene function directly. We propose that juxtaposition of the HOXB cluster to a repetitive DNA domain and/or separation from required cis-regulatory elements gave rise to a position effect. European Journal of Human Genetics (2007) 15, 570–577. doi:10.1038/sj.ejhg.5201795; published online 28 February 2007 Keywords: developmental delay; disease-associated balanced chromosome rearrangement; hexadactyly; HOXB; position effect; skeletal malformations Introduction with breakpoints and/or microdeletions well outside the Expression of some genes, in particular of developmental relevant genes.
[Show full text]
Supporting Information
Supporting Information SI materials and Methods Generation of Sirpα-/- mice: A neomycin resistant cassette was inserted into the Sirpα gene and replaced exons 2-4 and their flanking regions. The embryonic stem (ES) clones containing the mutated structure were selected and were microinjected into mouse blastocysts. Chimeric mice were produced and were confirmed to contain the mutant allele by genotyping. After extensively backcrossing with WT C57BL/6J mice (> ten generations), heterozygotes containing the mutant allele in C57BL/6J background were obtained and were further bred to obtain homozygous. PCR genotyping was performed using Sirpα gene-specific primers (Forward-1: 5’-ctgaaggtgactcagcctgagaaa and Reverse-1: 5’- actgatacggatggaaaagtccat; and neomycin cassette-specific primers (NeoF 5’-tgtgctcgacgttgtcactg and NeoR 5’-cgataccgtaaagcacgaggaagc). Western Blot (WB) analyses were performed to confirm depletion of Sirpα expression in bone marrow leukocytes, peripheral granulocytes and monocytes, peritoneal and spleen macrophages using mAb P84 and a polyclonal antibody against the Sirpα cytoplasmic tail (1). Antibodies and reagents: Rabbit mAbs against murine phospho-Syk (C87C1), Syk (D3Z1E) calreticulin (D3E6) and myosin IIA (3403) were purchased from Cell Signaling Technology (Danvers, MA). Rabbit anti–murine SHP-1 Ab (C19), goat anti-murine Scavenger receptor-A (SR-A) (E20) were purchased from Santa Cruz Biotechnology (Dallas, TX). Rabbit mAbs against murine calreticulin (EPR2907) and LDL receptor related protein 1 (LRP1) (EPR3724) were purchased from Abcam (Cambridge, MA). Rat mAbs against murine Cd47 (miap301) and Sirpα (P84) were purchased from BD Biosciences (San Jose, CA). LEAF-purified anti-mouse Cd16/32, anti-mouse Cd11b and anti-mouse IL- 17 were purchased from Biolegend (San Diego, CA).
[Show full text]
Table S1. 103 Ferroptosis-Related Genes Retrieved from the Genecards
Table S1. 103 ferroptosis-related genes retrieved from the GeneCards. Gene Symbol Description Category GPX4 Glutathione Peroxidase 4 Protein Coding AIFM2 Apoptosis Inducing Factor Mitochondria Associated 2 Protein Coding TP53 Tumor Protein P53 Protein Coding ACSL4 Acyl-CoA Synthetase Long Chain Family Member 4 Protein Coding SLC7A11 Solute Carrier Family 7 Member 11 Protein Coding VDAC2 Voltage Dependent Anion Channel 2 Protein Coding VDAC3 Voltage Dependent Anion Channel 3 Protein Coding ATG5 Autophagy Related 5 Protein Coding ATG7 Autophagy Related 7 Protein Coding NCOA4 Nuclear Receptor Coactivator 4 Protein Coding HMOX1 Heme Oxygenase 1 Protein Coding SLC3A2 Solute Carrier Family 3 Member 2 Protein Coding ALOX15 Arachidonate 15-Lipoxygenase Protein Coding BECN1 Beclin 1 Protein Coding PRKAA1 Protein Kinase AMP-Activated Catalytic Subunit Alpha 1 Protein Coding SAT1 Spermidine/Spermine N1-Acetyltransferase 1 Protein Coding NF2 Neurofibromin 2 Protein Coding YAP1 Yes1 Associated Transcriptional Regulator Protein Coding FTH1 Ferritin Heavy Chain 1 Protein Coding TF Transferrin Protein Coding TFRC Transferrin Receptor Protein Coding FTL Ferritin Light Chain Protein Coding CYBB Cytochrome B-245 Beta Chain Protein Coding GSS Glutathione Synthetase Protein Coding CP Ceruloplasmin Protein Coding PRNP Prion Protein Protein Coding SLC11A2 Solute Carrier Family 11 Member 2 Protein Coding SLC40A1 Solute Carrier Family 40 Member 1 Protein Coding STEAP3 STEAP3 Metalloreductase Protein Coding ACSL1 Acyl-CoA Synthetase Long Chain Family Member 1 Protein
[Show full text]
Autocrine IFN Signaling Inducing Profibrotic Fibroblast Responses by a Synthetic TLR3 Ligand Mitigates
Downloaded from http://www.jimmunol.org/ by guest on September 28, 2021 Inducing is online at: average * The Journal of Immunology published online 16 August 2013 from submission to initial decision 4 weeks from acceptance to publication http://www.jimmunol.org/content/early/2013/08/16/jimmun ol.1300376 A Synthetic TLR3 Ligand Mitigates Profibrotic Fibroblast Responses by Autocrine IFN Signaling Feng Fang, Kohtaro Ooka, Xiaoyong Sun, Ruchi Shah, Swati Bhattacharyya, Jun Wei and John Varga J Immunol Submit online. Every submission reviewed by practicing scientists ? is published twice each month by http://jimmunol.org/subscription Submit copyright permission requests at: http://www.aai.org/About/Publications/JI/copyright.html Receive free email-alerts when new articles cite this article. Sign up at: http://jimmunol.org/alerts http://www.jimmunol.org/content/suppl/2013/08/20/jimmunol.130037 6.DC1 Information about subscribing to The JI No Triage! Fast Publication! Rapid Reviews! 30 days* Why • • • Material Permissions Email Alerts Subscription Supplementary The Journal of Immunology The American Association of Immunologists, Inc., 1451 Rockville Pike, Suite 650, Rockville, MD 20852 Copyright © 2013 by The American Association of Immunologists, Inc. All rights reserved. Print ISSN: 0022-1767 Online ISSN: 1550-6606. This information is current as of September 28, 2021. Published August 16, 2013, doi:10.4049/jimmunol.1300376 The Journal of Immunology A Synthetic TLR3 Ligand Mitigates Proﬁbrotic Fibroblast Responses by Inducing Autocrine IFN Signaling Feng Fang,* Kohtaro Ooka,* Xiaoyong Sun,† Ruchi Shah,* Swati Bhattacharyya,* Jun Wei,* and John Varga* Activation of TLR3 by exogenous microbial ligands or endogenous injury-associated ligands leads to production of type I IFN.
[Show full text]
Re-Analysis of Public Genetic Data Reveals a Rare X-Chromosomal Variant Associated with Type 2 Diabetes
ARTICLE DOI: 10.1038/s41467-017-02380-9 OPEN Re-analysis of public genetic data reveals a rare X-chromosomal variant associated with type 2 diabetes Sílvia Bonàs-Guarch et al.# The reanalysis of existing GWAS data represents a powerful and cost-effective opportunity to gain insights into the genetics of complex diseases. By reanalyzing publicly available type 2 1234567890 diabetes (T2D) genome-wide association studies (GWAS) data for 70,127 subjects, we identify seven novel associated regions, five driven by common variants (LYPLAL1, NEUROG3, CAMKK2, ABO, and GIP genes), one by a low-frequency (EHMT2), and one driven by a rare variant in chromosome Xq23, rs146662057, associated with a twofold increased risk for T2D in males. rs146662057 is located within an active enhancer associated with the expression of Angiotensin II Receptor type 2 gene (AGTR2), a modulator of insulin sensitivity, and exhibits allelic specific activity in muscle cells. Beyond providing insights into the genetics and pathophysiology of T2D, these results also underscore the value of reanalyzing publicly available data using novel genetic resources and analytical approaches. Correspondence and requests for materials should be addressed to J.M.M. (email: [email protected]) or to D.T. (email: [email protected]) #A full list of authors and their affliations appears at the end of the paper NATURE COMMUNICATIONS | (2018) 9:321 | DOI: 10.1038/s41467-017-02380-9 | www.nature.com/naturecommunications 1 ARTICLE NATURE COMMUNICATIONS | DOI: 10.1038/s41467-017-02380-9 uring the last decade, hundreds of genome-wide associa- Results Dtion studies (GWAS) have been performed with the aim Overall analysis strategy.
[Show full text]
Genes Prioritized by Expression in Fetal Brains
HHS Public Access Author manuscript Author ManuscriptAuthor Manuscript Author Mol Psychiatry Manuscript Author . Author Manuscript Author manuscript; available in PMC 2018 March 23. Published in final edited form as: Mol Psychiatry. 2018 April ; 23(4): 993–1000. doi:10.1038/mp.2017.114. ASD Restricted and Repetitive Behaviors Associated at 17q21.33: Genes Prioritized by Expression in Fetal Brains Rita M. Cantor, PhD1,2,*, Linda Navarro, MS1, Hyejung Won, PhD3, Rebecca L. Walker, BS3, Jennifer K. Lowe, PhD3, and Daniel H. Geschwind, MD, PhD1,2,3 1Department of Human Genetics, David Geffen School of Medicine at UCLA, 695 Charles E. Young Drive, South, Los Angeles, CA 90095 – 7088 2Center for Neurobehavioral Genetics, Department of Psychiatry, David Geffen School of Medicine at UCLA, 695 Charles E. Young Drive, South, Los Angeles, CA 90095 – 7088 3Neurogenetics Program, Department of Neurology, David Geffen School of Medicine at UCLA, 695 Charles E. Young Drive, South, Los Angeles, CA 90095 – 7088 Abstract Autism Spectrum Disorder (ASD) is a behaviorally defined condition that manifests in infancy or early childhood as deficits in communication skills and social interactions. Often, restricted and repetitive behaviors (RRBs) accompany this disorder. ASD is polygenic and genetically complex, so we hypothesized that focusing analyses on intermediate core component phenotypes, such as RRBs, can reduce genetic heterogeneity and improve statistical power. Applying this approach, we mined Caucasian GWAS data from two of the largest ASD family cohorts, the Autism Genetics Resource Exchange (AGRE) and Autism Genome Project (AGP). Of the twelve RRBs measured by the Autism Diagnostic Interview-Revised (ADI-R), seven were found to be significantly familial and substantially variable, and hence, were tested for genome-wide association in 3 104 ASD affected children from 2 045 families.
[Show full text]