Facebook Like: Parsi Times Winners Pg

*FIND THE KIDDIES CONTEST WINNERS ON PAGE 7. SATURDAY, AUGUST 23, 2014 VOL. 4 - ISSUE 18 :: PAGES 20 :: ` 2/-

RNI NO. MAHBIL/2011/39373 Regn. No. MH/MR/South-348/2012-14 WWW.PARSI-TIMES.COM

TWITTER https://twitter.com/TheParsiTimes

Bumper Contest FaceBook Like: Parsi Times Winners Pg. 03

B.P.P. Trustees Pg. 06

Community Matters Pg. 10

Mamaiji Explains Khordad Roj Pg. 19 A Grand Celebration>Pg. 05 An Extraordinary Launch >Pg. 08 SATURDAY, AUGUST 23, 2014 P.T. will now be delivered to your doorstep fresh and early, Saturday morning from Depots ĂĐƌŽƐƐDĂŚĂƌĂƐŚƚƌĂĂŶĚ'ƵũĂƌĂƚ͘ZĞůĂƟǀĞƐĞǀĞƌǇǁŚĞƌĞĐĂŶƌĞĂĚǁŝƚŚǇŽƵ͊dĂůŬƚŽŚĞĂƌ 02 ƌĞŐƵůĂƌWĂƉĞƌǁĂůůĂĂŶĚĐŽŶŶĞĐƚǁŝƚŚƵƐĂƚ;ϬϮϮͿϲϲϯϯϬϰϬϰĨŽƌŵŽƌĞŝŶĨŽƌŵĂƟŽŶ͘ Editorial CONTEST #1 WINNERR Dear Readers, The Mid Term exams are putting pressure on our kids everywhere and giving parents high blood pressure too! But it’s Khordad Sal today! Time to &+(&.287&+2.52 WDNHDEUHDNIURPWKDWELRORJ\DQGPDWKHPDWLFVDQGÀQGWKDWVSHFLDO)DPLO\ Chemistry over a nice meal and a visit to the Agiary to wish Zarathustra, a Happy Happy Birthday! $ZHHNKDVSDVVHGVLQFH1HZ

FaceBook Like: Parsi Times TWITTER https://twitter.com/TheParsiTimes

NOTICE Those recipients who have still not collected their ,'&DUGVIURPWKH=7),RIÀFHDUHNLQGO\UHTXHVWHG to do so at the earliest before 30th Aug. 2014. )RULQTXLU\FDOODW=7),RIÀFH Contact: 9967458459 / 8652190527

6PHOOWKHURVHV You still Dear Editor, have time Last week, my friend in Godrej Baug received a Rose and a copy of the Letter that MLA Mangal Prabhat Lodha to win! sent to Prime Minister Modi requesting him to set aside Rs. 5 Crores a year for helping Parsis visit Iran, something like the Haj Tours for Muslims. In Nana Chowk Area the same letter was circulated with Daar-ni-pori! I wonder what is happening suddenly. Till a while Contest #2 ago I was given to understand that the BPP was a cash rich Trust. Today I am confused. Why does someone What I about outside of the Community have to suggest that we are Parsi New Year… QRWDEOHWRJRRQRXURZQÀQDQFHVWRVHH,UDQLIZHZDQW Read about to? Prophet Zarathustra WIN Today, I opened the newspaper (a regular national on Khordad Sal. GDLO\ WRÀQGDQDUWLFOHGHGLFDWHGWRWKLVWRSLF(YHQWKH Rs.2000/- CASH reporter there suggests that this is just a scheme to win votes in the upcoming Election! Tell us in 100 words or less Friends, eat the Daar-ni-pori, enjoy the smell of the what you truly love about rose! But please, pay for your own trip to Iran if you Navroze! want to go and don’t vote just because you got a gift from someone. It is bad enough that our Country is divided Mail it to us at: by Communal politics. Let us not be the ones to stir up FRQWULEXWH#SDUVLWLPHVFRP more of it! or post it to Parsi Times, Respectfully, 102, Vikas Building, 11 Bank Sohrab P. 6WUHHW)RUW0XPEDL

POINT TO NOTE: It’s the message, not the messenger you might be mad at! 'HWDLOV Please Note: The opinions expressed in ‘Letters to the Editor’ are those of Readers and contributors and do not necessarily express the opinion of our Contest deadline: 27th August 6 p.m. Publication. We reserve only the right to ‘edit for quality’ and the right to not Winner will be announced in ǡƤ or expression. If anyone has any doubts and issues about the content of the Parsi Times Issue on the letters, they are requested to contact the individual authors if his/ her details 30 of August 2014. are mentioned. SATURDAY, AUGUST 23 , 2014 Community Coverage 03 Watch out for hoardings across Mumbai City wishing our Readers and others a wonderful New Year!

Contest #4

1st Prize Rs. 8001/- 2nd Prize Rs. 4000/- 3rd Prize Rs. 3000/-

Winners may contact the Parsi Times Office from 11am to 5pm (Monday to Thursday) on 66330405 9: NUMISMATIC 10: PUNDOLE 11: BURHANPUR 12: COMMUNICATE 10: PUNDOLE 11: BURHANPUR 12: COMMUNICATE 9: NUMISMATIC 1: ESTATE 2: HYATT REGENCY 3: UDVADA 4: CARAMEL 5: BILLION 6: AAVOJI 7: COMPUTERISED EYE 8: 25 AAVOJI 5: BILLION 6: 4: CARAMEL 3: UDVADA REGENCY 2: HYATT 1: ESTATE

$1$33($/)520)52+$5)281'$7,21 Frohar Foundation is well known for the Tele-Serial “HUMTATA HUKHTA HVARSHTA” i.e. “Good Thoughts, Good Words, Good Deeds” focusing on Ancient Zoroastrian Culture & Heritage and way of life. This Unique Tele Serial is one of its kind in the world. We have also started a new Tele- Serial “Asha Vahishta” “Sarvottam Satya’, which is on Air at present on Zee Jagran Zee Network. Frohar Foundation is also involved in a very small way in other welfare and charitable activities like helping destitute women and children, giving MEDICAL AID to the needy, awarding EDUCATIONAL SCHOLARSHIPS, distributing Exercise Books to students, rehabilitating poor families and has helped hundreds of XQIRUWXQDWHSHRSOHRI6XUDWZKRKDGEHHQUHQGHUHGKRPHOHVVDQGGHVWLWXWHGXHWRWKHÁRRGVE\FUHDWLQJ DVSHFLDOÁRRGUHOLHIIXQG With a view to perpetuate the memory of Mrs. Silloo Parvez Mahava, our Ex-Trustee, a social worker par excellence, we have started “The Silloo P. Mahava Memorial Fund” which focuses on the needy and helpless persons in the society. Frohar Foundation also organizes Educational Exhibitions on Ancient Culture and Heritage periodically, in order to create awareness specially among the younger generation. Recently we have opened ‘Frohar Lodge’ at Udvada which is available to all Zoroastrians visiting Iranshah $WDVKEHKUDP6DKHE8GYDGDDWDYHU\QRPLQDOUDWHDQGWKLVZLOOEHEHQHÀFLDOWRWKHOHVVSULYLOHJHGRIRXU Community. :H ORRN IRUZDUG WR FRQWLQXHG ÀQDQFLDO VXSSRUW IURP PHPEHUV RI RXU &RPPXQLW\2Q WKH DXVSLFLRXV occasions of Pateti, New Year and Khordad Sal, we urge you to contribute towards these important Community projects by sending your valuable contributions/ donations. The Donations are exempted under section 80G of the Income Tax Act. Please draw the Cheques In favour of FROHAR FOUNDATION cross and order and send them to the following address: 12, 12,KARANI KARANI HOUSE, HOUSE, OFF. OFF. DR. DR. CAWASJI CAWASJI HORMUSJIHORMUSJI STREET,STREET, DHOBI DHOBI TALAO, TALAO, MUMBAI-400 MUMBAI-400 0002. 0002. For FROHAR FOUNDATION

[Trustee] SATURDAY, AUGUST 23, 2014 04 Bend it like Bawa! A fun look at what’s going on around us. Caution: To be taken with heavy doses of humour!

)227%$// MANCHESTER CITY AND LIVERPOOL START OFF ON A WINNING NOTE IN THE ENGLISH PREMIER LEAGUE The Barclay’s English Premier League is one of the ewareeware of thesethese viruses,vir forever. To register yourself countrymen to rise to their toughest football leagues in the joke goes, “Isnebola, in the national database of full potential, realize their the world and features some Usnebola, kaisebola, organ donors, log onto: www. responsibilities and shape of the most popular clubs on B the planet. With clubs like kahanbola, kab-bola, tu-bola, organdonationday.in. (why their own destinies. To this wo-bola, maine-bola, yeh- wait for a non-existent vulture direction, he pushed people Manchester United, Arsenal, bola are more dangerous than to feed on your carcass, towards cleanliness, sought Chelsea and Liverpool aiming to EBOLA. possibly after a year or more, protection of women by claim the most prestigious EPL Over 1 million people GIVE sight or life to a fellow urging parents to ensure their title. This year’s battle for the highest prize in football will be Binaisha M. Surti the one to watch out for. The much awaited English Premier League season has begun with a lot of excitement in the world over arena. Defending champions Manchester City started off with a 2-0 victory over Newcastle with their star forwards David Silva and Sergio Aguero scoring for them at St. James Park. The runner-up last season Liverpool won against their Southampton counterpart 2-1. Raheem Sterling opened Liverpool’s account by scoring in the 23rd minute. Daniel Sturridge continued attacking by scoring his goal in the 79th minute, from a Raheem Sterling assist. Although Liverpool hardly looked convincing, they still won themselves 3 points in what was a very competitive second half. Sterling and Sturridge were have been affected by human being. HOW DOES boys are raised right, told MPs in full form not showing any signs of World Cup fatigue. ‘Ebola’ in Africa and there IT GET ANY BETTER THAN to create model villages with 7(11,6 is ‘no early end in sight’, THAT?). their MPLAD funds, nudged FEDERER, SERENA CLINCH TITLES WHO has warned, calling And to sum up in the industry to move towards IN WESTERN AND SOUTHERN OPEN Switzerland’s Roger Federer for extraordinary measures. words of Kiran Mujumdar “zero defect” manufacturing, beat Spain’s David Ferrer 6-3, According to researchers, Shaw (Chairperson and MD, and asked bureaucrats to stop 1-6, 6-2, winning his 80th VP24, the Ebola protein works Biocon)- “Sharing the gift of ÀJKWLQJ DPRQJ WKHPVHOYHV career title and sixth at the by preventing the transcription life is the ultimate gift that and get on with their common Cincinnati Masters. The world factor STAT1, which carries you can give anyone on Organ task of governance. Stressing 1R LV XQEHDWHQ LQ VL[ ÀQDOV interferon’s antiviral message, Donation Day”. Recently in on cleanliness and sanitation, in Cincinnati, also winning the from entering the nucleus an article in Parsi Times Ms. he pushed for a “Swaccha tournament in 2005, 2007, and initiating an immune Piroja Jokhi wrote, in her Bharat”- making towns and 2009, 2010 and 2012. Serena response. As part of a rapid incisive and erudite style, villages litter-free – and :LOOLDPVZRQKHUÀUVW&LQFLQQDWLWLWOHZLWKDFRQYLQFLQJ immune response, the cell shattering all the misplaced building toilets for girls in all win over Ana Ivanovic. World No. 1 Serena now has 62 career allows STAT1 an “emergency and underlying myths on the schools. Saying that providing :7$WLWOHVEXWZRQKHUÀUVW:HVWHUQDQG6RXWKHUQ2SHQWLWOH access lane” to the nucleus. subject that have sought to be FOHDQOLQHVV ZDV WKH ÀUVW in her sixth attempt. Rather than block all nuclear enforced by a certain section of step in respecting the poor, &5,&.(7 transfer, however, VP24 our Community. Such people he promised a drive to be MAHELA GETS A FAIRYTALE SEND OFF FROM TEST CRICKET focuses on blocking STAT1’s will realise their folly the launched on October 2 with a Sri Lanka’s most stylish and “emergency access lane”. (If day they or their loved ones 2019 deadline to achieve the elegant batsman of all time \RX FDQ ÀJXUH RXW WKLV« WHOO require a life saving transplant task. Mahela Jayawardene was given us). That it’s fatal is obvious. of some organ and there is Namo’s speech has had an unforgettable farewell as he 500,000 people die every none available. (I hasten to a ripple effect on the price of played his last test match for his year in India, awaiting organ add, I am not being morbid or tomatoes and green chillies. A country. Sri Lanka sweeped the donors. Only 3% of patients prophetic- just stating a fact!). man fainted in the vegetable series with a 2-0 victory over Pakistan. The 37 year old ended awaiting a kidney transplant Namo’s Independence market in far-out suburban his 17 year old test streak with actually get one. A 100,000 Day speech from the Virar when the sabziwalla UXQVLQWHVWVZLWKDQDYHUDJHRI people are on the waiting list ramparts of the Red Fort left sold him a kilo of them at RAVI SHASTRI APPOINTED DIRECTOR OF TEAM INDIA FOR THE ODI SERIES IN for corneal transplants at any the nation with a feeling of Rs. 50, down from Rs. 100 ENGLAND given time. So when a patient mixed reactions. But primary last week. Though some After India’s terrible defeat to England, needs an organ transplant, amongst them was the one of passersby claim he slipped on the BCCI has decided to appoint Ravi the prayers come thick and “Hope and a Positive direction DEDQDQDSHHO«$QGZLWKWKH Shastri to oversee and guide the Indian fast. From friends and family, to inclusive governance”. His prices of chillies’ having come WHDPGXULQJWKH2',VVHULHVVWDUWLQJWKLV (we Parsis included), they maiden I-Day speech was down a tad, “Radio-Mirchi” month against England. Duncan Fletcher wait and pray for “Divine PDUNHG ZLWK PDQ\ ÀUVWV decided to cancel a proposal will continue as head coach while Shastri intervention”. Their prayers notably by scrapping the to re-christen itself “Radio- will be the overall in-charge of cricket can only be answered by YOU. Nehruvian vestige, the Namak”. affairs. With this major change let us all Sign up to be somebody’s Planning Commission, and by Wishing all our readers hope that good fortune comes the Indian savior. And once you choose ending his extempore speech and well-wishers Saal- Team’s way... to give life after you have with the slogan “Vande Mubarak and all success in gone, you choose to live Mataram”. Modi exhorted this New Year 1384. SATURDAY, AUGUST 23 , 2014 Community Coverage 05 B. K. S. Iyengar breathes his last K. S. Iyengar, who performance was deemed helped introduce the inadequate. Mr. Iyengar, then B.practice of yoga to a teenager, was the youngest the Western world died on member of the Maharaja of Wednesday in Pune at the age Mysore’s entourage, and was of 95. Mr. Iyengar, who was asked to demonstrate his noticeably weak during his ability to stretch and bend his childhood, credited yoga with body for visiting dignitaries saving his life. and guests. Born Bellur Krishnamachar A meeting in 1952 with the Sundararaja Iyengar on violinist Yehudi Menuhin, an Dec. 14, 1918, into a poor early yoga devotee, proved family in the southern state to be a turning point, and of Karnataka, which was Mr. Iyengar began traveling at the time in the middle of with Mr. Menuhin, eventually DQ LQÁXHQ]D RXWEUHDN WKH opening institutes on six famous Yoga teacher was the continents. 11th of 13 children. Three of his Among his devotees were siblings died before reaching my legs were spindly, and the novelist Aldous Huxley, adulthood, and he watched my stomach protruded in an the actress Annette Bening his father, a teacher, die of ungainly manner. My head and the designer Donna appendicitis when he was 9 used to hang down, and I had Karan, as well as a who’s who years old. Mr. Iyengar himself to lift it with great effort.” RI SURPLQHQW ,QGLDQ ÀJXUHV contracted tuberculosis, +LV ÀUVW WHDFKHU ZDV KLV including the cricketer Sachin typhoid and malaria; by the brother-in-law, a Brahmin Tendulkar and the Bollywood time he began studying yoga, scholar who had set up a school siren Kareena Kapoor. He at 16, he was painfully frail. of yoga at the Jaganmohan famously taught Queen Speaking of his early years, Palace, and who sometimes Elizabeth of Belgium, 85 at the he wrote, “My arms were thin, denied his student food if his time, to stand on her head. Minister of Minority Affairs celebrates with the Community elebrating Navroze with the local CCommunity in New Delhi was Minister for Minority Affairs, Najma Heptulla. In her address to the 250 plus gathering at the Delhi Parsi Anjuman, she spoke of her admiration for the Community and her close Parsi friends. She said, ‘I am well aware of the Community’s good qualities, concerns, and the Parsis’ sense of humour. I will offer all support to the Community for resolving various concerns, including the dwindling numbers. It is up to the Community to than 25 students from the Parsi to the Delhi Parsi Anjuman decide what steps they would Community at the ceremony. and spoke of his plans to like to take to overcome this Also at the celebration, translate the Gathas into challenge.” Rohinton Fali Nariman English some time in the near Ms. Heptulla gave away (Supreme Court Judge) future. scholarship prizes to more thanked everyone for coming

)HHG%DFN FRQWULEXWH#SDUVLWLPHVFRP SATURDAY, AUGUST 23, 2014 06 Parsi Point

REPLY TO DINSHAW TAMBOLY

Dear Editor, Dear Editor, Tamboly does not seem to have any objection in this Mr. Dinshaw Tamboly’s rejoinder to Khojeste Mistree This letter is in response to Mr. Dinshaw Tamboly’s particular case of diverting these funds from the poor, article published in the Parsi Times dated 26th July only because the moneys are coming into his newly and my letter was published in your paper on 26th July ,KHOGEDFNUHVSRQGLQJWRWKHVDPHGXHWRWKH formed Prayer Hall Trust and it suits his own agenda of 2014. In the rejoinder, Mr. Tamboly has been vocal festivities of the season and hence this short delay. radical reform! In fact, it is extraordinary that Messrs in his indignation at our response to his initial letter Mr. Tamboly’s Filibustering Skills: .DQJDDQG.KXVURNKDQZKRKDYHWDNHQWKH%337UXVWHHV regarding his views on the Renegade Priests case. It is 0U7DPERO\LVYHU\VNLOOHGDWÀOLEXVWHULQJLVVXHVE\ to court three times, in the last 7 years have the gall to be expected. Mr. Tamboly’s ideology and views are deliberately misleading the reader. In his letter to the WRVWDWHSXEOLFO\WKDW%33PRQH\VVKRXOGQRWEHVSHQW diametrically opposite to ours regarding maintaining Parsi Times, Mr. Tamboly has somewhat smugly stated, by the Institution to defend these cases! What this our Parsi / Irani Zarthoshti identity, our traditions, that the late Mr. Dara Kadva retracted his statement LQHIIHFWPHDQVLVWKDWZKHQSHRSOHVXHWKH%33LQ customs and practices and listening to our learned High against him in his now defunct paper, “Parsidom”. &RXUW WKH %337UXVWHHV PXVW PHHNO\ VXEPLW WR WKHLU Priests in matters of religion. And therefore he would What Mr. Tamboly does not reveal is that the helpless demands and compromise the power and position of GHÀQLWHO\QRWZDQWXVWKH%33WRÀJKWWKH5HQHJDGH Mr. Kadva did so out of “majboori”, as that was the WKH%336KDPHRQDQ\HOHFWHG7UXVWHHZKRVXFFXPEV Priests Case. Consider the following – condition attached by Mr. Tamboly, when Mr. Kadva to such obvious tactics, using the excuse of conserving Mr. Dinshaw Tamboly was in favour of giving was given funds he desperately needed for his illness. funds for the poor! equal voting rights to non-Parsi spouses in WZO For Mr. Tamboly to gloat over this unfortunate episode Mr. Tamboly’s Antipathy Towards Our Present Day International. is nothing short of being offensive to Mr. Dara Kadva’s Senior High Priests: Mr. Dinshaw Tamboly is a Trustee of a Trust whose soul and dignity. Mr. Tamboly’s antipathy towards the senior learned ,WLVFRPPRQNQRZOHGJHDERXW0U7DPERO\·VPLVXVH High Priests is legendary, the exception being when a object is to establish a cosmopolitan Agiary. of WZO funds meant for the poor farmers in Gujarat to member of the clergy sings his tune of reform, in which 7KHVDPH0U7DPERO\DV%337UXVWHHZDVSXVKLQJ support his journalist friend Mr. Rusi Dhondy, who by no case the Priest is great and should be respected. From WKH%33WRMRLQD:RUOG%RG\ZKLFKZRXOGKDYHKDG means was a deserving case to be given charitable funds, Mr. Tamboly’s writings and actions, it is clear that he FRQYHUWV %UD]LOLDQV5XVVLDQVHWF DVPHPEHUV brought immense disrepute to the institution of WZO. has no respect and never has had, for the learned High $VD%337UXVWHH7DPERO\KDGVWURQJO\SXVKHGIRU 2QRXUSDUWZHDUHQRWVHHNLQJWRMXVWLI\WKHOHJDO Priests, unless they are compliant to his wishes. His JLYLQJD&UHPDWHQL%XQJOLDW'RRQJHUZDGL expenses incurred in the Renegade Priests litigation, contempt for the academic excellence of the senior $JDLQ LW LV KH ZKR KDV ÀOHG DQ DIÀGDYLW LQ WKH DV 0U7DPERO\DOOHJHV 7KH %337UXVW 'HHG ZDV VHW High Priests, arises from his ignorance of the religion &UHPDWHQL%XQJOLFDVH ZKLFKLVSUHVHQWO\LQWKH XSVSHFLÀFDOO\IRU'RNKPHQDVKLQLDWWKH'RRQJHUZDGL and his arrogance, which is padded by WZO money and +LJK&RXUW ZKLFKLVVWURQJO\DJDLQVW'RNKPHQLVKLQL Complex and the two Fire Temples. Thus, it becomes should be viewed in that light. DQG VXSSRUWV JLYLQJ D &UHPDWH QL %XQJOL DW RXUGXW\DV%337UXVWHHVWRHQVXUHWKDWDQ\WKLQJZKLFK We have repeated ad-nauseumWKDWWKH%337UXVWHHV Doongerwadi. LVSHUFHLYHGWREHDWKUHDWWRDQ\RIRXU%33FRQWUROOHG XQDQLPRXVO\ LQ -XQH GHEDUUHG 0DGRQ DQG 0LU]D 0U7DPERO\KDVDOVRÀOHGDQDIÀGDYLWLQWKH6XSUHPH religious institutions, should be dealt with fortitude and for their irreligious activities because the High Priests Court in support of the renegade Priests who have VWULFWQHVV,IWKH%33LVWDNHQWRWKH+RQ·EOH+LJK&RXUW of their ecclesiastical diocese (panths KDG GHEDUUHG EHHQGHIURFNHGE\WKHLURZQHFFOHVLDVWLFDOSDQWKV in Mumbai by a group of radical reformist three times them, from being hamsharik with other Priests. It and “banned” by the High Priests, in the very same ZLWKRXW DQ\ FRQVLGHUDWLRQ WR OHJDO FRVWV DQG WKHVH VKRXOGDOVREHERUQHLQPLQGWKDWWKHHQWLUH%RDUGRI UHIRUPLVW OLNH 0U 7DPERO\ KDYH D SHUVRQDO UHOLJLRXV WKH %33 ZDV GHPRFUDWLFDOO\ HOHFWHG RQ D WUDGLWLRQDO Renegade Priests case. DJHQGDWKHQVKRXOGZHDVWKH7UXVWHHVRIWKH%33MXVW platform, and in our manifestos we had agreed to It is again Mr. Tamboly who is a Trustee of the Prayer remain quiet spectators? We believe that, the Order of consult the High Priests in all religious matters and Hall Trust whose object is to build and maintain a WKH'LYLVLRQ%HQFKDIIHFWVPDQ\LVVXHVUHOLJLRXVDQG uphold the traditions of the faith and this clearly, Mr. ¶EXQJOL· LQ WKH %0& :RUOL &UHPDWRULXP FRPSOH[ otherwise, as stated in your published article dated Tamboly abhors! For this he has solicited funds from Charitable ,IRQHLVWRWDNH0U7DPERO\·VUDWLRQDOHWR $UHOLJLRQFDQQRWDVDQLQVWLWXWLRQVXUYLYHRQVHOÀVK Trusts and received Rs. 1.8 crores from the A. H. LWVORJLFDOFRQFOXVLRQWKHQDQ\FDVHÀOHGE\DOLWLJDQW individualistic ideas, and with the fashions and passions Wadia Charities, whose main Trustee is Mr. Munchi DJDLQVWWKH%33H[FOXGLQJSURSHUW\KRXVLQJOLWLJDWLRQ of the moment. It is vital to note that, the Division Cama. Tamboly’s hypocrisy is clearly exposed should not be responded to, so that all those moneys %HQFK2UGHUFRPSOHWHO\UHPRYHVWKHUHOLJLRXVDXWKRULW\ here as he is not objecting to A. H. Wadia charity can be channelled for charitable purposes! During of the High Priests. It was held in the judgment that IXQGVEHLQJXWLOL]HGIRUFRQVWUXFWLQJDIDFLOLW\IRU 0U7DPERO\·V RZQ WHQXUH DV D %33 7UXVWHHODNKV RI RQFH DQ ´LQLWLDWHµ 3ULHVW LV RUGDLQHG LW LV EHWZHHQ cremation which already exists, rather than being Rupees were spent on litigation on the resignation and him and the “supreme religious faith”. The Judgment used for ‘the poor and needy’, merely because withdrawal of the 4 Trustees, Mr. Tamboly himself being thereby sets out that a Zoroastrian Priest does not these funds are coming into his Trust and it suits RQH RI WKH IRXU 6LQFH WKDW OLWLJDWLRQ ZDV QRW IXQGHG have to submit to any ecclesiastical authority and can his radical reformist agenda. through Mr. Tamboly’s largesse but, was in fact funded SUHWW\PXFKGRDVKHZLOOV6RIRUH[DPSOHLID3ULHVW It would be foolish to expect Mr. Tamboly and others IURP%33IXQGVLVLWQRWWKHKHLJKWRIK\SRFULV\IRU0U decides that in the course of his duty, he only wants to OLNH KLP ZKR DUH SXUVXLQJ D FOHDU UHIRUPLVW DJHQGD Tamboly to now advise us otherwise? do one karda in a Jashan, or give only one boi and not Misuse of Charitable Funds for the Poor by Mr. Tamboly: SHUIRUP ÀYH ERLV LQ D FRQVHFUDWHG )LUH7HPSOHWKHQ WRHYHUVXSSRUWRUXQGHUVWDQGWKH%33·VVWDQGRQWKH $GGLWLRQDOO\ ZH DUH FHUWDLQO\ QRW ´VHHNLQJ WR under the present decision of the Hon’ble High Court is Renegade Priests Case. In fact, one has to expect that justify the current expenditure on the grounds that the OLIWHGQR%337UXVWHHFDQWDNHREMHFWLRQWRWKLVDVWKH they will try to put hurdles at every stage. No cogent WZO Trust had allegedly done something similar in the errant Priest is not accountable to anyone except his UHDVRQLQJZLOOHYHUEULQJ0U7DPERO\RURWKHUVOLNHKLP past”, as Mr. Tamboly alleges. As mentioned earlier, “supreme religious faith”. The fact that Mr. Tamboly WRDFFHSWRXUSRLQWRIYLHZ7KHUHIRUHZHUHDOL]HWKH WKH %33 7UXVW 'HHG LV PHDQW IRU WKH SURWHFWLRQ DQG is willing to support such a judgement is expected of )HHG%DFN futility of us repeatedly, trying to convince Mr. Tamboly SUHVHUYDWLRQ RI 'RNKPHQDVKLQL LQ WKH 'RRQJHUZDGL him, seeing that he is constantly challenging the time or other reformists to see or understand our point of Complex as well as the two Fire Temples. Our allegation honoured beliefs, customs and traditions of our religion. YLHZ%XWZKDWZHÀQGJDOOLQJLVWKHGRXEOHVWDQGDUGV is that since a Prayer Hall for cremation purposes is %337UXVWHHV$UH1RW6HOÀVK hypocrisy and sanctimonious babble that is indulged in being constructed by Mr. Tamboly from funds given We are not serving our own interests nor do we by those opposing this Case, without understanding the from the A. H. Wadia Trust, is it not hypocritical for Mr. wish to further our political aspirations, as Mr. Tamboly

Case, or having read the Judgment or understanding 7DPERO\WRDFFHSWWKHVHIXQGV 5VFURUHV PHDQW alleges. We are being truthful and forthright with what FRQWULEXWH#SDUVLWLPHVFRP the implications and repercussions of this Judgement for charity, but now being misused to build a cremation we promised the electorate in 2008, which is to uphold ZKLFKWKH%33LVFKDOOHQJLQJ prayer hall facility, instead of those funds being spent the time tested tenets and practices of the faith and We suppose we all have to accept that East is East RQWKHSRRU"0U7DPERO\WKLQNVWKDWWKH&RPPXQLW\ WR VHHN JXLGDQFH IURP WKH +LJK 3ULHVWV LQ UHOLJLRXV and West is West and the twain shall never meet. is made up of fools, when in response to our above PDWWHUVZKHQQHFHVVDU\:HDUHEHLQJWUXHWRWKH%33 challenge, he states that the Prayer Hall Trust directs and the Parsi/Irani Community, whom we have been that moneys should be spent for “the case of the Prayer elected to serve. We wonder whether Mr. Tamboly can Yazdi Desai Hall”. The question really is, ... Where are the funds VWDQGEHIRUHKLV0DNHUDQGVD\WKHVDPHIRUWKHUROH %337UXVWHH for the Prayer Hall coming from? And the answer to WKDW KH KDV SOD\HG ZKHQ KH ZDV D %337UXVWHH VRPH that question is that they are coming from a Charitable years ago!! 7UXVWZKHUHDVWKH\FRXOGEHEHWWHUXWLOL]HGLQIHHGLQJ :LWKNLQGUHJDUGV FORWKLQJ DQG VKHOWHULQJ WKH XQGHUSULYLOHJHG %XW 0U Khojeste P. Mistree SATURDAY, AUGUST 23 , 2014 07

Varun Pir 8 years

Daneesh Khosravi 9 years

YOU WIN WINNER Rs.2000/- Mahnaz H. Pestonjamasp 9 years

Winner may contact the Parsi Times Office from Jimmy Lord 63(&,$/$:$5'((6 11 am to 5 pm (Monday to Thursday) on 66330405 63(&,$/$:$5'((6 4 years

World for All, the Hi Everyone!! Animal welfare I’m Duke. I am NGO has teamed 0XIÀQ is a up with Parsi a spunky little playful, gorgeous Times for this guy who loves to one month exclusive column! play with toys. old baby and This week, it features Paperballs, empty loves to cuddle loving animals that need homes and could boxes, scratchpads especially do with the love and you name it. He while sleeping. care of affectionate Parsi households. Please Jelly and Fish absolutely adore their would be suitable So whether you live alone and are call/SMS food and cuddles. They have great for a family as he is looking for a companion or you want 9004257179 to to teach your children responsible love very friendly with fun jumping on on each other and adopt! and caretaking, or if you simply love when sleepy they will lie across your everyone. animals, here is a a hopeful soul who deserves a chance to make you happy! legs or chest most happily. TO ADOPT : Please Call/SMS 9820496099 08 SATURDAY, AUGUST 23, 2014

3DUVL7LPHVSHHNVLQRQWKHDFWLRQDWWKHODXQFKRI0RWLYDWLRQDO6SHDNHUDQG&RUSRUDWH7UDLQHU0LQRFKHU3DWHO·VÀUVWERRNDQGEULQJV\RXWKHGHWDLOV

he book Ordinary to Mr. Minoche Extraordinary – Your TPathway to Success and Happiness by Minocher Patel was AboutAb Minocher launched on August 14, 2014 at 0U0U 0LQRFKHU 3DWHO LV WKH )RXQGHU 'LUHFWRU the 15th Narsee Monjee College RIRI (FROH 6ROLWDLUH ,QGLD·V )LUVW 5HVLGHQWLDO of Commerce and Economics, ))LQLVKLQJL 6FKRRO DQG ,QWHUQDWLRQDO &RUSRUDWH Umang Festival. 77UDLQLQJU &RQVXOWDQF\ +H LV ,QGLD·V /HDGLQJ The Guest of Honor at the MMotivational Speaker and Corporate Trainer of Launch was Huma Qureshi, ,Q,QWHUQDWLRQDO5HSXWHW the acclaimed star of renowned 0U3DWHOLVZHOONQRZQLQWKH&RUSRUDWH6HFWRULQ0U ÀOPV OLNH Gangs of Wasseypur, ,QGLDDQG$EURDGIRUKLVSURJUDPVRQ²0RWLYDWLRQ,QGLD Ek Thi Daayan, Dedh Ishqiya and /HDGHUVKLS/HDGHUV %XVLQHVV (WLTXHWWH 6HOOLQJ 6NLOOV DQG D-Day. Also in attendance was &RPPXQLFDWLRQ6NLOOV&RPPXQLFD India’s leading holistic health Even if you don’t come OverOthltddhht the last decade he has trained over 100,000 individuals all over India guru and wellness expert Mickey DQGDEURDGDQGFRQGXFWHGWUDLQLQJSURJUDPVIRUWKHFRUSRUDWHVHFWRUDQG Mehta. Last but not least, Mr. from a privileged background VWXGHQWFRPPXQLW\LQFRXQWULHVOLNH8$(7KDLODQG6UL/DQNDDQG6ZLW]HUODQG Viraf Patel, best known for his or have the required resources; IRU%OXH&KLSFRPSDQLHVOLNH8QLOHYHU7DWD+RXVLQJ7&6+&/:LSUR,GHD lead role in India’s popular soap it need not stop you from &HOOXODU8QLOHYHU%3/9ROWDV.30*5HOLDQFH&DSLWDO6KDUDI*URXS 8$( opera Ek Bund Ishq, added his shine 0DKDUDMD,QGXVWULHV 6UL/DQND WRQDPHDIHZ+HLVDOVRWKHYLVLWLQJIDFXOW\ and glamour to the occasion. Our achieving your dreams. IRUVRPHRIWKHWRSQRWFKPDQDJHPHQWLQVWLWXWHVRIWKHFRXQWU\+LVKLJKO\ other distinguished guests include PRWLYDWLQJ VHPLQDUV DQG ZRUNVKRSV DUH ZHOO NQRZQ IRU WKHLU KLJK TXDOLW\ Jatin Pandit the music composer, FRQWHQWEDFNHGE\KLVXQLTXHDQGHQWHUWDLQLQJVW\OHRIGHOLYHU\0U3DWHO LV ,QGLDCV OHDGLQJ 6XFFHVV DQG ,PDJH &RDFK IRU &(2·V 6HQLRU 0DQDJHUV 3ROLWLFLDQVDQG3URIHVVLRQDOVIURPWKHHQWHUWDLQPHQWLQGXVWU\ 0U3DWHOKDVUHFHLYHGQXPHURXVDZDUGVDFFODLPLQJKLPDV,QGLD·V/HDGLQJ 0RWLYDWLRQDOVSHDNHU+HKDVUHFHLYHGWKH1DWLRQDO$FKLHYHPHQW$ZDUGIRU ([FHOOHQFHLQ(GXFDWLRQDQG7UDLQLQJDWWKHKDQGVRI8QLRQ0LQLVWHURI6WDWH IRU3ODQQLQJ0U095DMDVHNKDUDQLQ1HZ'HOKL+HKDVDOVRUHFHLYHG WKH,QGLUD*DQGKL3UL\DGDUVKDQL$ZDUGIRURXWVWDQGLQJ6HUYLFH$FKLHYHPHQWV DQG &RQWULEXWLRQ LQ WKH ÀHOG RI (GXFDWLRQ DQG7UDLQLQJRQ WK 1RYHPEHU LQ 1HZ 'HOKL 7KLV SUHVWLJLRXV DZDUG KDV EHHQ HDUOLHU DZDUGHG WR UHQRZQHG SHUVRQDOLWLHV OLNH 0RWKHU7HUHVD5XVL 0RGL 1DYMRW 6LQJK 6LGKX $FWRU5DMQLNDQWDQG3DQGLW+DULSUDVDG&KDXUDVLD On 14th$SULO 0U 3DWHO UHFHLYHG ´7KH .DWKD 8.*OREDO ([FHOOHQFH $ZDUGµDWWKH+RXVHRI/RUGV/RQGRQIRUHPHUJLQJDVRQHRIWKH%HVW0RVW 3RZHUIXO DQG (QWHUWDLQLQJ 0RWLYDWLRQDO 6SHDNHUV ,QGLD KDV SURGXFHG LQ UHFHQWWLPHV ,Q 6HSWHPEHU KH ZDV LQYLWHG DV D 7KRXJKW /HDGHU WR VSHDN RQ 7KH 3RZHURI+DSS\/HDGHUVKLSDWWKH*OREDO,QGLDQ%XVLQHVV0HHW *,%0 KHOG DW WKH 0DUULRWW 0DUTXLV7LPHV 6TXDUH 0DQKDWWDQ LQ 1HZ

activists to create awareness The disparity between male on Women’s Empowerment and female commences even and protestors demand before they are born. reforms in law and order. Female infanticide is one However, all this seems to be such example which precedes perpetual drama. As long as all other despicable acts. the Universe exists, the good, Ironically, our society sweeps bad and ugly are here to stay. it under the carpet. The fact The question now before us is is unless there is a paradigm Daisy Zohrabi how do we restore the faith shift in our outlook there is not of our children in an ever so going to be much luminosity. hypocritical society? Mindsets need a makeover. n the wake of the ghastly How do we teach them the Families, Educational acts committed against fundamental rights like Justice, Institutions, Society and Iwomen and children Equality, Nations at much pandemonium created Liberty and large hold seems to be futile. There isn’t Dignity accountability a single day in the life of our which the for the so called, “India Shining”, that Constitution breakdown sexual harassment on women promised us of our value and children has ceased to years back? system. Each of increase. The daily tabloids As curious them is inter- cover half their pages with minds related and such atrocities and preventive impose inter-woven measures, but all in vain. questions like - Which India with the fabric of mutual The electronic media on the are we living in? The one which trust and none of these can other hand creates a forum ÁDVKHV RQ WKH ZRUOG PDS function in isolation. Each of for views and counterviews, for its upcoming economy these, partner the other and their effusion of angst, disgust DQG SURJUHVV LQ WKH ÀHOG RI if any of these spot blemishes in their own convictions An India where Ignited DQG FULWLFLVP RI ODZ MXVWLÀHG science and technology or \RX ÀQG SLHFHV RI GLVRUGHU and in all veracity alienate Minds come together to turn but worthless. Suddenly all the one which calls itself civil scattered and scathed all over. themselves from the vicious to ashes the depravity from enterprises big and small are but questions the authenticity A strong foundation is all it circle of unethical living. Only the face of the earth. Eureka!!! encouraging Self Defense for of its culture - after the takes to make Men of Integrity then can we dream of a “Free How great would that Women, NGOs are supporting barbaric acts seen recently? and Dignity. Men who believe Spirited India”. discovery be? SATURDAY, AUGUST 23, 2014 10 Parsi Point

r. Dinshaw Tamboly has strongly raised his voice There have been various articles published in the Parsi FRQGHPQLQJWKHXQHWKLFDODQGLOOHJDOFDVHVÀOHG By P.T. Writer Piroja Jokhi Times condemning the various unethical dictates and Magainst the two Priests for which crores of the demanding an explanation from the Trustees. I assume Community Trust Funds are squandered. When the voluminous amount spent on such that a copy of Parsi Times is delivered to them each week, and they have spare a trivial matter is revealed to the Community all are aghast and in one voice condemn time to read the content. If they have some valid reason they should come out in this hasty act. It has been published in the Mumbai Mirror about the crunch of funds open to express their views, but they have chosen to remain tight lipped. It was in BPP It is not a big surprise. The way public money is squandered over petty issues Mr. Cama who showed grace and personally explained the logical stand taken by without slightest hesitation, the outcome was a foregone conclusion. him. But contrary to our trust in him, it did not result in bold action. There are 7 We have wasted money on the proposed Aviary project, which has thankfully been elected Trustee on the panel, all answerable to their voters. The Community wants stalled otherwise we would have been paupers by now. We have thrown away over to know their stand on the matter. From legal, moral or religious point of view all 3 crores of our precious wealth to vindicate Priests. An eyewash Mobed Amelioration WKHVHDFWLRQVKDYHQRMXVWLÀFDWLRQ7KHVRFDOOHGUHQHJDGH3ULHVWVKDYHYROXQWHHUHG Scheme was introduced as a reward for their obedience. You cannot rob Peter and to offer their service only to those who wanted to be served. As professionals they pay Sam, by lifting money from other charities to extend charities to the Priests. In are paid for their service. The Community has never hesitated to pay for the service reality it was a theft from the Wadia Trust Funds. rendered by the Priests especially for the after death ceremonies of their dear ones. The two Priests are rendering professional service to the members of the Doongarwadi is an asset belonging to the Community. When the ceremonies Community for which they are paid for. What would have been the plight of the are to be performed for the members of our own Community there cannot be any people, if the so called Renegade Priests had not come to their rescue? The Trustees restrictions. When the Trust Deed was formulated, the settlers had no idea that the and High Priests had surmised that they can exert their authority and pressurize the main architects of the system, the vultures would not survive and that the system Community to bend before them. With the sudden turn of events the oppressors would collapse. Even in the past other methods of disposal of dead bodies prevailed, were non-plused and had no clues how to handle the situation. Disparate situation but there were no objections, nor were the traditional prayers and rituals denied to needs desperate measures. Their only object was to take revenge over the Priests at them. Earlier our Priests understood the Religion in a truly Religious manner and not ordained Fatwas in the name of Religion. The so called custodians of Religion have destroyed the true essence of our Religion; a Religion which gives maximum freedom An eyewash Mobed Amelioration Scheme was introduced to all. as a reward for their obedience. You cannot rob Peter and When you talk about our unique and ethnic identity, we are no more unique, we pay Sam, by lifting money from other charities to extend are today a laughing stock for the other Communities. We are no more revered for charities to the Priests. our wisdom, our integrity and the high values of morality we stood for. Such a small Community so rich in heritage has lost its pride, prestige and possession today. We better be remembered through the good deeds of our ancestors who brought glory to any cost whatever the consequences may be. the Community. It does not matter if we survive or go into oblivion, we, especially It is for the Community to decide which act was more religious, denying prayers during the last decade, have lost our prestige and position. for the souls of the dead, thereby hurting the sentiments of people who are in Performing prayers under any circumstances is not a crime in the book of Religion a state of bereavement or taking risk of losing their livelihood and standing by or in the Constitution. Now the blame game has started, each putting the onus on the oppressed in the hour of crises offering their service at the right time to the the others! The only way to end the matter is to lift the ban unconditionally, and a Community members, who as Zoroastrians wanted the last rites of their dear ones PRUHGLJQLÀHGZD\LVWRPDNHDPHQGVWHQGHUDQDSRORJ\DQGDOORZWKHFHUHPRQLHV performed in the traditional way. It was not out of choice, but out of compulsion to be performed at the Doongarwadi Bunglies thus bringing an end to this ugly and that they decided on cremation as it was the only alternative to dispose of the sordid drama. GHDG ERG\ RI WKHLU GHDU RQHV LQ D GLJQLÀHG ZD\)LUVW RI DOO VXFK D VPDOO PDWWHU The Trustees have now shifted the responsibility on the High Priests. The High could have been solved by mutual understanding. It was not a matter of such great LPSRUWDQFHWKDWUHTXLUHGLQWHUYHQWLRQRISXEOLFFRXUWVVDFULÀFLQJDYHU\ELJFKXQNRI the Trust money meant to be spent for the welfare of our Community. The primary It is for the Community to decide which act was more function of the Panchayat is to settle disputes without intervention of the court. religious, denying prayers for the souls of the dead, thereby As custodians of the Trust funds, the Trustees are answerable to the Community. If hurting the sentiments of people who are in a state of they had to spend money from their own pockets would the seven Trustee and the bereavement or taking risk of losing their livelihood and six high Priests been unanimous in their decision to spend such a voluminous amount on such a trivial matter? It was a Community matter and it should have been solved standing by the oppressed in the hour of crises offering within the Community. There are quite a number of legal experts in the Community, their service at the right time to the Community members, if the Trustees had the slightest concern about the waste of public money, they who as Zoroastrians wanted the last rights of their dear ones could have taken opinion from the legal experts within the Community before taking performed in the traditional way. such a hasty decision of going to the court. Even after the humiliating defeat in the High Court and a colossal loss of Trust money, they have the audacity to approach the Supreme Court! Is the verdict of the worthy High Court judges not enough to Priests have remained silent on the issue. After all our ancestors have been very convince them that they are on the wrong track? If they are still waiting for another, OLEHUDOWRSURYLGHXVPHDQVQRWNQRZLQJWKDWLWZLOOEHPLVXVHGWRÀJKWOLWLJDWLRQV more humiliating defeat no one can stop them, but it must be at their own cost and The Community has lost faith in the present board. Perhaps it is high time they put consequences. Have we ever heard people approaching the Supreme Court to get in their papers. justice for the crime of performing prayers? Only the uncivilized khap Community As stated by Mr. Mistry, besides the case of the ban on the Priests the whole lot of and the so called progressive Parsis can stoop so low. To solve the Community matters RWKHULVVXHVVXFKDVWKHLVVXHVRIHIÀFDF\IDLOXUHRI'RNKPHQDVKLQLWKHOHJLWLPDF\ within the Community we have two main Community publications, one advocating of cremation, admitting children of mixed marriages into our faith, the role and the orthodoxy, and the other newly formed Community publication, a mouthpiece of authorities of the Trustees, the role and the authorities of the High Priests which the reformist. Freedom is a fundamental right of a citizen and as long as it causes no were brought to the notice of the High Court are the issues that really matters. The harm to others there cannot be any curbs on it. Imagine going to the highest court of fact is we are not undermining the Dokhmenashini, the system has already been the land to get justice,- justice for what? Even for most heinous crimes like murder, undermined, failed and cannot be revived. Under the circumstances when we are people hesitate to approach the High Court, but here the leaders of the Community not able to provide an alternative to the Community, there is no other option but to and the guardians of our Religion are approaching the Supreme Court , for a crime, legalize cremation. About conversion when we have accepted to take the children of never known as a crime, in the history of humanity, a crime for performing prayers! It Parsi fathers married outside the Community, there is no reason why we should not is time the Trustees and High Priests who have restricted the performance of prayers, apply the same rule for the other gender. On the contrary mothers can exert more be made accountable and taken to task for depriving the Community from performing LQÁXHQFHRQWKHFKLOGWKDQWKHIDWKHU,IDVDOOHJHGWKHDXWKRULWLHVRIWKH7UXVWHHVLV last rights of the dead in their traditional way and restricting religious Priests from undermined, they themselves are to be blamed. The way elections were conducted, SHUIRUPLQJWKHLUGXW\7KHOHDVWZHFDQGRLVWRDVNWKHPWRUHSD\IRUDOOWKHÀQDQFLDO their high handed and arrogant behavior, total insensitivity towards the needs of the losses the Community suffered because of their unethical and meaningless Fatwas. Community, the complete mismanagement and misappropriation of the Trust Funds, SATURDAY, AUGUST 23, 2014 11

the blatant irregularities in the housing allotments, total lack of harmony among the the issue with the offender We are not going to be held guilty for other’s Trustees, the Fatwas in the name of Religion, the blame game, the gross corruptions, offense, so why should we bother about the consequences of other’s acts? the several incidents of misuse of our Doonarwadi estates and colony premises and If it is felt that the sanctity of the holy place is damaged or lost by any means, lastly the colossal losses of the Trust Funds on various litigations on matters which can it be explained, how? To end this controversy, we may arrange to have a has no moral base, have not brought glory to the Trustees nor to the institution. separate Prayer Hall at a little distance away, somewhere in the vast expanse of If Mr. Tamboly has a low opinion about the Priests, it is the Priests who have the Doongarwadi premises. There should be no reason to deny this proposal. If at WRUHWURVSHFWDQGÀQGRXWZKHUHWKHIDXOW all there is any objection, with a little lies. To be born in the Priestly family is give and take we can reach an amicable not the only criteria to become worthy of Earlier our Priests understood the Religion in a truly Religious VROXWLRQ:HKDYHKDGHQRXJKRIFRQÁLFWV the high position one occupies. A Religious manner and not ordained Fatwas in the name of Religion. and controversies, and all that we need is Head should have the qualities of head an early settlement to the issue. Will the and heart. True Religion is based on love, leaders of the Community agreeable to compassion, tolerance and justice. If you truly develop these qualities in you, you compromise or they still chose to divide and rule. Not a Rupee will be spent from the will no doubt get respect and reverence. Community welfare funds for the construction of the new Prayer Hall and it will not Will the High Priests and the Trustees who are jointly responsible for this cause any obstruction to anyone. We have such vast estates at our disposal, a place unfortunate drama will clarify their stand on the matter to satisfy the Community? like a heaven on earth, we need not go out for a second-rate cosmopolitan Prayer The traditional last rites for the dead of the Parsi Community are performed at the Hall for performing prayers for the members of our own Community. Each member 7RZHURI6LOHQFHLQWKHWUDGLWLRQDOZD\DIWHUZKLFKWKHERGLHVDUHFRQÀQHGWRWKH of the Community has equal right to the property, and even the court has accepted Dokhmas. There are serious and valid assumption, that the dead bodies are in a it. As peace loving members of the Community we should respect the sentiments of pathetic condition rotting and putrefying. People have revealed the truth with sound others and agree to this simple proposal. It will not disturb the sanctity of the place, proof. Are you in a position to give a guarantee that the bodies are disintegrated and it will be the responsibility of the family members to deport the body for the last EHIRUHSXULÀFDWLRQVHWVLQ"$UH\RXLQDSRVLWLRQWRRIIHUDQ\DOWHUQDWLYHWRIXOÀOO disposal to the crematorium, thereafter the Sarosh uthamna and other ceremonies the need of the Community? Do you deny the right of the family members to decide can be performed at the Prayer Halls if the family Priests still decline to lift the stay RQWKHLUULJKWWRJLYHDGLJQLÀHGGLVSRVDOWRWKHLUGHDURQHV":KDWKDUPZLOOFRPH of four day ceremonies at the Agiaries. to the Community, or to any individual if, after all the traditional ceremonies are The Trustees, the High Priests of the Community, and the enlightened members of completed, the bodies are taken for cremation instead at the Dokhmas, and the the Community are invited to express their views openly and without any prejudice. remaining four days ceremonies continued in the traditional way at the Tower of If we start discussing, we can understand each other. We all accept that we should Silence? settle our problems within the Community and respecting each other’s point of view. When there is such a simple solution at hand why should we complicate May the new year bring some peace and good sense! the matter? If it is an offense against God’s commandment, God will settle Speak your mind and save the Community! Do you have something to say about Mrs. Jokhis’ view expressed in the Parsi Times, email us on [email protected] (subject: Mrs. Jokhis’ Article). 12 SATURDAY, AUGUST 23, 2014 SATURDAY, AUGUST 23, 2014 Classifieds 13 &$5+,5( &$7(5(56

Parsi Owned & Driven AUTHENTIC SWIFT D’ZIRE CAR BHING NE GHARUB (A.C. & IN GOOD HOME MADE PICKLES CONDITION) (PRAWNS, GHARUB, AVAILABLE ON HIRE GORKERI, METHIU, FOR OUTSTATION AND CHHUNDO & MIX VEG) WITHIN MUMBAI. WITHOUT RESERVATIVES CLASSIFIEDS PLEASE CONTACT AT REASONABLE RATES. ROHINTON - 9223395255 CONTACT MAHAFRIN 9833618528 %86,1(662))(5 YOUNG PARSI EMPLOYEE Travel Comfortably in Ask your regular paperwalla to call SPITAMAAN CREATION Brand New A/c (;+,%,7,216$/( AT A CORPORATE FIRM FAIR DEAL - SHOP INNOVA/SKODA RAPID Mr. Hemant (Atharva Enterprises), at Boyce Agiary Estate - Reasonable Rates & with The Distributor, on 098673 08063, LOOKING TO RENT A Tardeo. Excellent Service. Embroidered Kurties, To Udvada, Navsari, to get your copy of STUDIO APARTMENT 1LJKWLHV ZHVWHUQ 2XWÀW Surat, Mahableshwar, Sadra, Kusti, Toran. Shirdi, Goa etc. Parsi Times OR SMALL 1 – 2 BHK Bailiff & Sons Contact Navaaz APARTMENT, 9819620666 9819244454 / 9322279869 Ask your paperwalla for %8<,1* 6(//,1* P.T. now! Only Rs.8/- p.m. ANYWHERE IN SHYAM TRAVELS Travel in A/c Innova and AND Honda city to Udwada / )$%5,&$7256 3$&.(56 029(56 AROUND COLABA. Navsari / Surat / Shirdi / (/(&7521,&65(3$,56 Nashik / Pune / Panchgani DEEKAY PACKERS & MOVERS PLEASE CONTACT / Mahabaleshwar etc. and CLOCK REPAIRS National, International all over India. Repairs of English /German Clearing, Forwarding, 9820248686. 1 day Udwada – Rs.5,000/- +RXVHKROG*RRGV2IÀFHV for 7 persons Grandfather Clocks, Airport transfers – Quarter Chimers, Carriage Vehicles, Pets Rs.1,500/- also local, Clocks, Pocket / Wrist 14 Years Experience WORRIED WITH PROBLEMS Wedding & Navjote Kersi IMMEDIATE SOLUTION Watches. Contact: Cyrus Love Marriage, Business, &2,16127(6&2//(&7,216 functions +919892014580, Khambatta: 26042635, Freedom from Other CONTACT: 98203 67891 +919892922006 Women/Enemies 9820987891 9820895967, 9820257919. +263,7$/,7< House Problems, Muthkarni, Vashikaran, TRAVEL Comfortably in Washing Machine / TEMPO Trucks available Black Magic. Any Work 100% Mahindra Xylo, 3 Row Dishwasher / Dryer/ ON HIRE. We Undertake Microwave Oven / Satisfaction. A/C on hire at reasonable contracts of shifting RAZA BENGALI Refrigerator / AC / LCD / rate for Airport, Navjote, household furniture, etc, PLAZMA / LED 09756434001 Wedding, Outstation. Contact NATIONAL with skilled labout. Contact Hutoxi Contact Dutta (SAHIL) 9773158833 / 7$527 9819408576/9819648099. 24034358 9821319228 / 9820006236 One Year Gaurantee ASK ANY QUESTION. )256$/( Get Accurate Answer on phone. Pay later Rs 300 +20()851,6+,1* 6(59,&(6$9$,/$%/( per question. DANAIE Mistry 9769658808 diu“’u V$p„L$u“u kapC, ^prd®L$ Persian Sweets, 9$&$1&< Dry Fruits, õ’mp¡ / ‘pZu“p Ly$hp“u kapC Zoroastrian Carpets, / kp¡kpeV$u / dpmuep“u Required a full/part- time Female Assistant Ladies Garments ‘pZu“u V$p„L$uAp¡ (kpdp“ lV$pìep hNf) kapC dpV¡$ k„‘L®$ for NGO with 1-2 years Jehangir Sorab Irani ep¡Nu 9820776583 / experience with good 24110788, 97692 24266 command over English and 9167677673. Free Home Delivery basic computers. Contact Hufrish: 22846962/

(4cm X 4cm) Box Rs.500/per insert (4cm X 4cm) Box [email protected] Rs. 10/ per normal word 15 / bold JOSHUA OIL

On Every 3 Classified, 1 Free On Every 3 Classified, 1 Free Rheumatic Pain, ,17(5,25(;7(5,25 Stiff Joints Pain, Muscular Protection from Rain, Pain, Low Backaches, Please do note that while we are happy Sun-Rays, Mosquitoes, to bring the Community together via our

CLASSIFIED RATES Lumbago & Fixed/Folding Roof, Classified Section we are not responsible &ODVVLÀHG'LVSOD\ ,QÁDPHDW$Q\&RQGLWLRQV Mosquitoe Roll-up Net, and do not endorse any product or service Gauranteed Relief PVC-U Windows, Doors, advertised in our Classified Section and will from pain, not be held responsible by any third party for Stop Leakages, Bamboo the content of the ad space. 5XQQLQJ7H[W&ODVVLÀHG No Side Effects Curtain, Also Wall Paper, Contact 9769021742 Carpet, Signage Display Time: 10 am - 5 pm 09224228828 Printed and Published by Cyrus M. Shroff on behalf of Kersi Jamshed Randeria, From 102, Vikas Building, 11 Bank Street, Fort, Mumbai - 1. Printed at Dangat Media Private Limited, Mehra Centre, Marwah Estate, Saki Vihar Road, Mumbai - 400 072. (GLWRU)UH\DQ%KDWKHQD&RQWDFW1RV$GYW)D[2IÀFH7LPLQJDPWRSP0RQGD\)ULGD\

SATURDAY, AUGUST 23, 2014 P.T. will now be delivered to your doorstep fresh and early, Saturday morning ĨƌŽŵĞƉŽƚƐĂĐƌŽƐƐDĂŚĂƌĂƐŚƚƌĂĂŶĚ'ƵũĂƌĂƚ͘ZĞůĂƟǀĞƐĞǀĞƌǇǁŚĞƌĞĐĂŶƌĞĂĚǁŝƚŚ ǇŽƵ͊ŽŶŶĞĐƚǁŝƚŚƵƐĂƚ;ϬϮϮͿϲϲϯϯϬϰϬϰĨŽƌŵŽƌĞŝŶĨŽƌŵĂƟŽŶ͘ 19

Joining the Parsi Times pages with Whenever we surf the net, we use a browser such as Internet some fun, Explorer, Firefox or Chrome. Most browsers (depending on the interesting and quirky VHWWLQJV FDSWXUH RXU VXUÀQJ KDELWV DQG RQOLQH EHKDYLRXU DQG things to do then transfer the meta data to advertising and data aggregating Dear Mamaiji, online, is companies. They will in turn, serve you with ads which are in You always make me read the Gujarati Yazdi Tantra. tune with your browsing habits. This is an indirect invasion of our calendar date from the front page of the A Chartered Accountant by privacy, without our knowledge. Parsi Times. Today is Khordad Roj. What training, Computer Consultant There are several socially responsible web advertising does that mean? by Profession, Entrepreneur companies, who offer you a way to opt out of this hidden tracking. Dear Dikri, Developer by hobby and Khordad Roj Just proceed to www.aboutads.info/choices and your browser will Today is . Khordad Amesha dƌĂŝŶĞƌŝŶŚŝƐůĞŝƐƵƌĞƟŵĞ͘ Spenta is the Divinity for Good Health, Wholesomeness, Welfare Look up his latest blog www. be automatically analysed for hidden advertising tracking. You can leading to Perfection. Health is not just physical in nature but also ConsumerResources.in for then choose to opt out of these companies, separately or all at once. refers to mental and emotional wellbeing. Which is Wholeness, some useful resources, and They will then stop pushing your data out without your knowledge. which leads to Healing. A healed person is happy and focussed on-lyne.blogspot.in for some This is a great tool to protect your privacy and everyone must use it on the welfare of self and others. Yet healing is a continuous ŵŽƌĞŝŶƚĞƌĞƐƟŶŐdĞĐŚ^ƚƵī͘ once in a month to update their opt-outs. journey while one is in the body. While Perfection is the goal, it is almost impossible to attain it completely. Yet one may continue to strive for what comes closest : Excellence. Praying to Khordaad $PVKDVSDQG LV FRQVLGHUHG YHU\ EHQHÀFLDO ZKHQ RQH LV IDFLQJ FKDOOHQJHV DQG GLIÀFXOLWLHV LQ RQHV MRE FDUHHU EXVLQHVV HWF Victoria Sponge (Zoroastrians may pray the Khordaad Yasht). Khordaad is also Ingredients: associated with the element of water, which metaphysically is 175 grams soft butter associated with one’s emotions. Taking care of one’s emotions in a 1 cup castor sugar healthy manner leads to good physical health, thus being healed, thus becoming wholesome and moving on towards Excellence 3 eggs creamy. and possible Perfection. With inputs from Parvez J. Daruwala ôFXSVÁRXU Pour into the cake tins. Bake in a pre- 1½ teaspoons baking powder heated oven at 160 degrees Celsius till Vanilla essence done. Directions: Purveen Dubash is a chef with many knives in her pretty home Grease two 7 inch cake tins. kitchen cabinet. From TV anchor to educator to author she is armed Name ... Pourushasp F. Mehta. Combine all the ingredients. Beat with culinary skills to put your tummy into a hypnotic state. We are proud to present to you her recipes which have the unique I work at... Concept P.R., India’s leading Public with a rotary beater till thick and distinction of being not only simple to follow but yummy to taste! Relations firm. I work as... Sr. Manager – Sports/Lifestyle P.R. That basically means... Handling public relations for clients. Dear Wife My work day begins with... Greeting my colleagues with a smile. I love this about my job...Networking with the top notch Why do I need to say that you are the best wife and the best mother? corporate thought leaders/celebs in the sports & lifestyle sector Why Do I need to respect you? is a great learning and gives me a kick. Why do I believe that when I approach you I need to fold my hands in front of you? I wish this would change about my job... I don’t wish to During the imprisonment of 20 years till now I saw you totally dedicated change anything about my job. to your child and your husband. I have been working here for ... 5 months. You are not tired of putting water and food in her mouth since 20 years, or bathing her, I head to office and head back home at these times... cleaning her up ten times a day, dressing her up, spending sleepless nights Official timings - 9.30 – 6.30. with a continuous fear in your body mind and soul about her safety and future. Some of the things that make up my work day…Client 6DFULÀFLQJDOO\RXURXWLQJVDQGEHLQJZLWK\RXUIULHQGV servicing, drafting press releases and PR plans/proposals, Every morning you woke up with the hope that she will be normal today morning press release dissemination to the media and follow ups, news coverage tracking, managing events/press conferences, and every night you said “it did not happen” no problem it will happen tomorrow. leading, motivating and enjoying. Hats Off to you my wife. Someone I think has an interesting job is… I surely do. I am You just not did all but have done it with a smile, optimistic and have an attitude of gratitude. I believe in the law kisses and hugs while actually doing it at all times. Hats Off to you my wife. of attraction and attract the best. With all the negative comments and without the support of elders in your family you managed it all. You were unmoved and carried on graciously. Hats Off to you my wife. You never made me do anything although I wanted to help. You also did the entire household work single handedly besides this. Hats Off to you my wife It is very painful to watch all this because you are very dear to me. The height of our thanks to you is much lower than your dedication. Therefore with two folded hands I intend to approach you at all times when I come to you and I also wish to give new heights to our relationship and standup to your expectations. Thank You Love. You are a wonderful star. Maneck.

Did you know? * The Star-Spangled Banner, the US national anthem, was composed in 1812 on a ship, the ‘Minden’, built by the Wadias. :DGLD*URXSIRXQGHU/RYML1XVVHUZDQMHH:DGLDZDVRQHRIWKH,QGLD·VÀUVWPDVWHUVKLSEXLOGHUV FaceBook * Nowrojee Nusserwanjee Wadia started Bombay Dyeing in a humble red-brick shed. Like: Parsi Times Newspaper

* In 1971, then 26-year-old Nusli Wadia saved Bombay Dyeing from a takeover bid from R.P. Goenka.kaa. TWITTER https://twitter.com/TheParsiTimes Parsi Times - English and Gujarati. SATURDAY, AUGUST 23, 2014 Regd. No. MH/MR/South-348/2012-14. Published on 23rd August, 2014, 2QUVGFCV/WODCK2CVTKMC%JCPPGN5QTVKPI2QUV1H°EG/WODCK 20 on every Saturday.