H00026031-B01P 規格 : [ 50 Ug ] List All

Total Page：16

File Type：pdf, Size：1020Kb

OSBPL3 purified MaxPab mouse polyclonal antibody (B01P) Catalog # : H00026031-B01P 規格 : [ 50 ug ] List All Specification Application Image Product Mouse polyclonal antibody raised against a full-length human OSBPL3 Western Blot (Transfected lysate) Description: protein. Immunogen: OSBPL3 (NP_663162.1, 1 a.a. ~ 820 a.a) full-length human protein. Sequence: MMSDEKNLGVSQKLVSPSRSTSSCSSKQGSRQDSWEVVEGLRGEMNY TQEPPVQKGFLLKKRKWPLKGWHKRFFYLDKGILKYAKSQTDIEREKLH GCIDVGLSVMSVKKSSKCIDLDTEEHIYHLKVKSEEVFDEWVSKLRHHRM enlarge YRQNEIAMFPHEVNHFFSGSTITDSSSGVFDSISSRKRSSISKQNLFQTGS NVSFSCGGETRVPLWLQSSEDMEKCSKDLAHCHAYLVEMSQLLQSMDV LHRTYSAPAINAIQVPKPFSGPVRLHSSNPNLSTLDFGEEKNYSDGSETS SEFSKMQEDLCHIAHKVYFTLRSAFNIMSAEREKLKQLMEQDASSSPSAQ VIGLKNALSSENSRDENRALVHQLSNESRLSITDSLSEFFDAQEVLLSPSS SENEISDDDSYVSDISDNLSLDNLSNDLDNERQTLGPVLDSGREAKSRRR TCLPAPCPSSSNISLWNILRNNIGKDLSKVAMPVELNEPLNTLQRLCEELE YSELLDKAAQIPSPLERMVYVAAFAISAYASSYYRAGSKPFNPVLGETYE CIREDKGFQFFSEQVSHHPPISACHAESRNFVFWQDVRWKNKFWGKSM EIVPIGTTHVTLPVFGDHFEWNKVTSCIHNILSGQRWIEHYGEIVIKNLHDD SCYCKVNFIKAKYWSTNAHEIEGTVFDRSGKAVHRLFGKWHESIYCGGG SSSACVWRANPMPKGYEQYYSFTQFALELNEMDPSSKSLLPPTDTRFR PDQRFLEEGNLEEAEIQKQRIEQLQRERRRVLEENHVEHQPRFFRKSDD DSWVSNGTYLELRKDLGFSKLDHPVLW Host: Mouse Reactivity: Human Quality Control Antibody reactive against mammalian transfected lysate. Testing: Storage Buffer: In 1x PBS, pH 7.4 Storage Store at -20°C or lower. Aliquot to avoid repeated freezing and thawing. Instruction: MSDS: Download Datasheet: Download Applications Western Blot (Transfected lysate) Page 1 of 2 2016/5/23 Western Blot analysis of OSBPL3 expression in transfected 293T cell line (H00026031- T01) by OSBPL3 MaxPab polyclonal antibody. Lane 1: OSBPL3 transfected lysate(90.2 KDa). Lane 2: Non-transfected lysate. Protocol Download Gene Information Entrez GeneID: 26031 GeneBank NM_145322.1 Accession#: Protein NP_663162.1 Accession#: Gene Name: OSBPL3 Gene Alias: DKFZp667P1518,KIAA0704,MGC21526,ORP-3,ORP3,OSBP3 Gene oxysterol binding protein-like 3 Description: Omim ID: 606732 Gene Ontology: Hyperlink Gene Summary: This gene encodes a member of the oxysterol-binding protein (OSBP) family, a group of intracellular lipid receptors. Most members contain an N-terminal pleckstrin homology domain and a highly conserved C- terminal OSBP-like sterol-binding domain. Several transcript variants encoding different isoforms have been identified. [provided by RefSeq Other OSBP-related protein Designations: 3,OTTHUMP00000122490,OTTHUMP00000122491,oxysterol-binding protein 3,oxysterol-binding protein-like protein 3,oxysterol-binding protein-related protein 3 Related Disease Kidney Failure, Chronic Tobacco Use Disorder 服務條款 | 隱私權政策 | 著作及商標 | 網站地圖 ©2016 亞諾法生技股份有限公司 Abnova Corporation. 版權所有. Page 2 of 2 2016/5/23.

Copy Link

Recommended publications

Browsing Genes and Genomes with Ensembl
The Bioinformatics Roadshow Copenhagen, Denmark 16 & 17 June 2011 BROWSING GENES AND GENOMES WITH ENSEMBL EXERCISES AND ANSWERS Note: These exercises are based on Ensembl version 62 (13 April 2011). After in future a new version has gone live, version 62 will still be available at http://e62.ensembl.org. If your answer doesn’t correspond with the given answer, please consult the instructor. ______________________________________________________________ BROWSER ______________________________________________________________ Exercise 1 – Exploring a gene (a) Find the human F9 (Coagulation factor IX) gene. On which chromosome and which strand of the genome is this gene located? How many transcripts (splice variants) have been annotated for it? (b) What is the longest transcript? How long is the protein it encodes? How many exons does it have? Are any of the exons completely or partially untranslated? (c) Have a look at the external references for ENST00000218099. What is the function of F9? (d) Is it possible to monitor expression of ENST00000218099 with the CodeLink microarray? If so, can it also be used to monitor expression of the other two transcripts? (e) In which part (i.e. the N-terminal or C-terminal half) of the protein encoded by ENST00000218099 does its peptidase activity, responsible for the cleavage of factor X to yield its active form factor Xa, reside? (f) How many non-synonymous variants have been discovered for the protein encoded by ENST00000218099? (g) Is there a mouse ortholog predicted for the human F9 gene? (h) On which cytogenetic band and on which contig is the F9 gene located? Is there a BAC clone that contains the complete F9 gene? (i) If you have yourself a gene of interest, explore what information Ensembl displays about it! ______________________________________________________________ Answer (a) Go to the Ensembl homepage (http://www.ensembl.org).
[Show full text]
Supplemental Table S1
Entrez Gene Symbol Gene Name Affymetrix EST Glomchip SAGE Stanford Literature HPA confirmed Gene ID Profiling profiling Profiling Profiling array profiling confirmed 1 2 A2M alpha-2-macroglobulin 0 0 0 1 0 2 10347 ABCA7 ATP-binding cassette, sub-family A (ABC1), member 7 1 0 0 0 0 3 10350 ABCA9 ATP-binding cassette, sub-family A (ABC1), member 9 1 0 0 0 0 4 10057 ABCC5 ATP-binding cassette, sub-family C (CFTR/MRP), member 5 1 0 0 0 0 5 10060 ABCC9 ATP-binding cassette, sub-family C (CFTR/MRP), member 9 1 0 0 0 0 6 79575 ABHD8 abhydrolase domain containing 8 1 0 0 0 0 7 51225 ABI3 ABI gene family, member 3 1 0 1 0 0 8 29 ABR active BCR-related gene 1 0 0 0 0 9 25841 ABTB2 ankyrin repeat and BTB (POZ) domain containing 2 1 0 1 0 0 10 30 ACAA1 acetyl-Coenzyme A acyltransferase 1 (peroxisomal 3-oxoacyl-Coenzyme A thiol 0 1 0 0 0 11 43 ACHE acetylcholinesterase (Yt blood group) 1 0 0 0 0 12 58 ACTA1 actin, alpha 1, skeletal muscle 0 1 0 0 0 13 60 ACTB actin, beta 01000 1 14 71 ACTG1 actin, gamma 1 0 1 0 0 0 15 81 ACTN4 actinin, alpha 4 0 0 1 1 1 10700177 16 10096 ACTR3 ARP3 actin-related protein 3 homolog (yeast) 0 1 0 0 0 17 94 ACVRL1 activin A receptor type II-like 1 1 0 1 0 0 18 8038 ADAM12 ADAM metallopeptidase domain 12 (meltrin alpha) 1 0 0 0 0 19 8751 ADAM15 ADAM metallopeptidase domain 15 (metargidin) 1 0 0 0 0 20 8728 ADAM19 ADAM metallopeptidase domain 19 (meltrin beta) 1 0 0 0 0 21 81792 ADAMTS12 ADAM metallopeptidase with thrombospondin type 1 motif, 12 1 0 0 0 0 22 9507 ADAMTS4 ADAM metallopeptidase with thrombospondin type 1
[Show full text]
Association of Gene Ontology Categories with Decay Rate for Hepg2 Experiments These Tables Show Details for All Gene Ontology Categories
Supplementary Table 1: Association of Gene Ontology Categories with Decay Rate for HepG2 Experiments These tables show details for all Gene Ontology categories. Inferences for manual classification scheme shown at the bottom. Those categories used in Figure 1A are highlighted in bold. Standard Deviations are shown in parentheses. P-values less than 1E-20 are indicated with a "0". Rate r (hour^-1) Half-life < 2hr. Decay % GO Number Category Name Probe Sets Group Non-Group Distribution p-value In-Group Non-Group Representation p-value GO:0006350 transcription 1523 0.221 (0.009) 0.127 (0.002) FASTER 0 13.1 (0.4) 4.5 (0.1) OVER 0 GO:0006351 transcription, DNA-dependent 1498 0.220 (0.009) 0.127 (0.002) FASTER 0 13.0 (0.4) 4.5 (0.1) OVER 0 GO:0006355 regulation of transcription, DNA-dependent 1163 0.230 (0.011) 0.128 (0.002) FASTER 5.00E-21 14.2 (0.5) 4.6 (0.1) OVER 0 GO:0006366 transcription from Pol II promoter 845 0.225 (0.012) 0.130 (0.002) FASTER 1.88E-14 13.0 (0.5) 4.8 (0.1) OVER 0 GO:0006139 nucleobase, nucleoside, nucleotide and nucleic acid metabolism3004 0.173 (0.006) 0.127 (0.002) FASTER 1.28E-12 8.4 (0.2) 4.5 (0.1) OVER 0 GO:0006357 regulation of transcription from Pol II promoter 487 0.231 (0.016) 0.132 (0.002) FASTER 6.05E-10 13.5 (0.6) 4.9 (0.1) OVER 0 GO:0008283 cell proliferation 625 0.189 (0.014) 0.132 (0.002) FASTER 1.95E-05 10.1 (0.6) 5.0 (0.1) OVER 1.50E-20 GO:0006513 monoubiquitination 36 0.305 (0.049) 0.134 (0.002) FASTER 2.69E-04 25.4 (4.4) 5.1 (0.1) OVER 2.04E-06 GO:0007050 cell cycle arrest 57 0.311 (0.054) 0.133 (0.002)
[Show full text]
Structural Basis of Sterol Recognition and Nonvesicular Transport by Lipid
Structural basis of sterol recognition and nonvesicular PNAS PLUS transport by lipid transfer proteins anchored at membrane contact sites Junsen Tonga, Mohammad Kawsar Manika, and Young Jun Ima,1 aCollege of Pharmacy, Chonnam National University, Bukgu, Gwangju, 61186, Republic of Korea Edited by David W. Russell, University of Texas Southwestern Medical Center, Dallas, TX, and approved December 18, 2017 (received for review November 11, 2017) Membrane contact sites (MCSs) in eukaryotic cells are hotspots for roidogenic acute regulatory protein-related lipid transfer), PITP lipid exchange, which is essential for many biological functions, (phosphatidylinositol/phosphatidylcholine transfer protein), Bet_v1 including regulation of membrane properties and protein trafficking. (major pollen allergen from birch Betula verrucosa), PRELI (pro- Lipid transfer proteins anchored at membrane contact sites (LAMs) teins of relevant evolutionary and lymphoid interest), and LAMs contain sterol-specific lipid transfer domains [StARkin domain (SD)] (LTPs anchored at membrane contact sites) (9). and multiple targeting modules to specific membrane organelles. Membrane contact sites (MCSs) are closely apposed regions in Elucidating the structural mechanisms of targeting and ligand which two organellar membranes are in close proximity, typically recognition by LAMs is important for understanding the interorga- within a distance of 30 nm (7). The ER, a major site of lipid bio- nelle communication and exchange at MCSs. Here, we determined synthesis, makes contact with almost all types of subcellular or- the crystal structures of the yeast Lam6 pleckstrin homology (PH)-like ganelles (10). Oxysterol-binding proteins, which are conserved domain and the SDs of Lam2 and Lam4 in the apo form and in from yeast to humans, are suggested to have a role in the di- complex with ergosterol.
[Show full text]
Elucidating Biological Roles of Novel Murine Genes in Hearing Impairment in Africa
Preprints (www.preprints.org) | NOT PEER-REVIEWED | Posted: 19 September 2019 doi:10.20944/preprints201909.0222.v1 Review Elucidating Biological Roles of Novel Murine Genes in Hearing Impairment in Africa Oluwafemi Gabriel Oluwole,1* Abdoulaye Yal 1,2, Edmond Wonkam1, Noluthando Manyisa1, Jack Morrice1, Gaston K. Mazanda1 and Ambroise Wonkam1* 1Division of Human Genetics, Department of Pathology, Faculty of Health Sciences, University of Cape Town, Observatory, Cape Town, South Africa. 2Department of Neurology, Point G Teaching Hospital, University of Sciences, Techniques and Technology, Bamako, Mali. *Correspondence to: [email protected]; [email protected] Abstract: The prevalence of congenital hearing impairment (HI) is highest in Africa. Estimates evaluated genetic causes to account for 31% of HI cases in Africa, but the identification of associated causative genes mutations have been challenging. In this study, we reviewed the potential roles, in humans, of 38 novel genes identified in a murine study. We gathered information from various genomic annotation databases and performed functional enrichment analysis using online resources i.e. genemania and g.proflier. Results revealed that 27/38 genes are express mostly in the brain, suggesting additional cognitive roles. Indeed, HERC1- R3250X had been associated with intellectual disability in a Moroccan family. A homozygous 216-bp deletion in KLC2 was found in two siblings of Egyptian descent with spastic paraplegia. Up to 27/38 murine genes have link to at least a disease, and the commonest mode of inheritance is autosomal recessive (n=8). Network analysis indicates that 20 other genes have intermediate and biological links to the novel genes, suggesting their possible roles in HI.
[Show full text]
Identification of Key Genes and Pathways in Pancreatic Cancer
G C A T T A C G G C A T genes Article Identification of Key Genes and Pathways in Pancreatic Cancer Gene Expression Profile by Integrative Analysis Wenzong Lu * , Ning Li and Fuyuan Liao Department of Biomedical Engineering, College of Electronic and Information Engineering, Xi’an Technological University, Xi’an 710021, China * Correspondence: [email protected]; Tel.: +86-29-86173358 Received: 6 July 2019; Accepted: 7 August 2019; Published: 13 August 2019 Abstract: Background: Pancreatic cancer is one of the malignant tumors that threaten human health. Methods: The gene expression profiles of GSE15471, GSE19650, GSE32676 and GSE71989 were downloaded from the gene expression omnibus database including pancreatic cancer and normal samples. The differentially expressed genes between the two types of samples were identified with the Limma package using R language. The gene ontology functional and pathway enrichment analyses of differentially-expressed genes were performed by the DAVID software followed by the construction of a protein–protein interaction network. Hub gene identification was performed by the plug-in cytoHubba in cytoscape software, and the reliability and survival analysis of hub genes was carried out in The Cancer Genome Atlas gene expression data. Results: The 138 differentially expressed genes were significantly enriched in biological processes including cell migration, cell adhesion and several pathways, mainly associated with extracellular matrix-receptor interaction and focal adhesion pathway in pancreatic cancer. The top hub genes, namely thrombospondin 1, DNA topoisomerase II alpha, syndecan 1, maternal embryonic leucine zipper kinase and proto-oncogene receptor tyrosine kinase Met were identified from the protein–protein interaction network.
[Show full text]
Vectorial Cholesterol Transport by the Protein OSBP Joelle Bigay, Bruno Mesmin, Bruno Antonny
A lipid exchange market : vectorial cholesterol transport by the protein OSBP Joelle Bigay, Bruno Mesmin, Bruno Antonny To cite this version: Joelle Bigay, Bruno Mesmin, Bruno Antonny. A lipid exchange market : vectorial cholesterol transport by the protein OSBP. médecine/sciences, EDP Sciences, 2020, 36 (2), pp.130 - 136. 10.1051/med- sci/2020009. hal-03001136 HAL Id: hal-03001136 https://hal.archives-ouvertes.fr/hal-03001136 Submitted on 12 Nov 2020 HAL is a multi-disciplinary open access L’archive ouverte pluridisciplinaire HAL, est archive for the deposit and dissemination of sci- destinée au dépôt et à la diffusion de documents entific research documents, whether they are pub- scientifiques de niveau recherche, publiés ou non, lished or not. The documents may come from émanant des établissements d’enseignement et de teaching and research institutions in France or recherche français ou étrangers, des laboratoires abroad, or from public or private research centers. publics ou privés. médecine/sciences 2020 ; 36 : 130-6 médecine/sciences Un marché d’échange de lipides Transport vectoriel > Le cholestérol est synthétisé dans le réticu- lum endoplasmique (RE) puis transporté vers du cholestérol par les compartiments cellulaires dont la fonction la protéine OSBP en nécessite un taux élevé. Nous décrivons ici le Joëlle Bigay, Bruno Mesmin, Bruno Antonny mécanisme de transport du cholestérol du RE vers le réseau trans golgien (TGN) par la protéine OSBP (oxysterol binding protein). Celle-ci présente deux activités complémentaires : elle arrime les deux compartiments, RE et TGN, en formant un site de contact où les deux membranes sont à une vingtaine de nanomètres de distance ; puis elle Institut de Pharmacologie Moléculaire et Cellulaire, échange le cholestérol du RE avec un lipide pré- Université Côte d’Azur et CNRS, sent dans le TGN, le phosphatidylinositol 4-phos- UMR 7275, 660 route des lucioles, phate (PI4P).
[Show full text]
S41467-021-23799-1.Pdf
ARTICLE https://doi.org/10.1038/s41467-021-23799-1 OPEN Nanoscale architecture of a VAP-A-OSBP tethering complex at membrane contact sites ✉ Eugenio de la Mora1,2,5, Manuela Dezi 1,2,5 , Aurélie Di Cicco1,2, Joëlle Bigay 3, Romain Gautier 3, ✉ John Manzi 1,2, Joël Polidori3, Daniel Castaño-Díez4, Bruno Mesmin 3, Bruno Antonny 3 & ✉ Daniel Lévy 1,2 Membrane contact sites (MCS) are subcellular regions where two organelles appose their 1234567890():,; membranes to exchange small molecules, including lipids. Structural information on how proteins form MCS is scarce. We designed an in vitro MCS with two membranes and a pair of tethering proteins suitable for cryo-tomography analysis. It includes VAP-A, an ER trans- membrane protein interacting with a myriad of cytosolic proteins, and oxysterol-binding protein (OSBP), a lipid transfer protein that transports cholesterol from the ER to the trans Golgi network. We show that VAP-A is a highly ﬂexible protein, allowing formation of MCS of variable intermembrane distance. The tethering part of OSBP contains a central, dimeric, and helical T-shape region. We propose that the molecular ﬂexibility of VAP-A enables the recruitment of partners of different sizes within MCS of adjustable thickness, whereas the T geometry of the OSBP dimer facilitates the movement of the two lipid-transfer domains between membranes. 1 Laboratoire Physico Chimie Curie, Institut Curie, PSL Research University, CNRS UMR168, Paris, France. 2 Sorbonne Université, Paris, France. 3 CNRS UMR 7275, Université Côte d’Azur, Institut de Pharmacologie Moléculaire et Cellulaire, Valbonne, France. 4 BioEM Lab, C-CINA, Biozentrum, University of Basel, ✉ Basel, Switzerland.
[Show full text]
Navigo: Interactive Tool for Visualization and Functional Similarity and Coherence Analysis with Gene Ontology Qing Wei1, Ishita K
Wei et al. BMC Bioinformatics (2017) 18:177 DOI 10.1186/s12859-017-1600-5 SOFTWARE Open Access NaviGO: interactive tool for visualization and functional similarity and coherence analysis with gene ontology Qing Wei1, Ishita K. Khan1, Ziyun Ding2, Satwica Yerneni3 and Daisuke Kihara2,1* Abstract Background: The number of genomics and proteomics experiments is growing rapidly, producing an ever-increasing amount of data that are awaiting functional interpretation. A number of function prediction algorithms were developed and improved to enable fast and automatic function annotation. With the well-defined structure and manual curation, Gene Ontology (GO) is the most frequently used vocabulary for representing gene functions. To understand relationship and similarity between GO annotations of genes, it is important to have a convenient pipeline that quantifies and visualizes the GO function analyses in a systematic fashion. Results: NaviGO is a web-based tool for interactive visualization, retrieval, and computation of functional similarity and associations of GO terms and genes. Similarity of GO terms and gene functions is quantified with six different scores including protein-protein interaction and context based association scores we have developed in our previous works. Interactive navigation of the GO function space provides intuitive and effective real-time visualization of functional groupings of GO terms and genes as well as statistical analysis of enriched functions. Conclusions: We developed NaviGO, which visualizes and analyses functional similarity and associations of GO terms and genes. The NaviGO webserver is freely available at: http://kiharalab.org/web/navigo. Keywords: Gene function, Gene ontology, GO, Ontology, GO directed acyclic graph, Function similarity, Gene function prediction, GO annotation, function enrichment analysis, GO parental terms, GO association score Background their parental relationship make it non-trivial to provide Functional elucidation of genes is one of the central an intuitive summary of GO annotations of genes.
[Show full text]
Namyoung Jung
EPIGENETIC BASIS OF STEM CELL IDENTITY IN NORMAL AND MALIGNANT HEMATOPOIETIC DEVELOPMENT by Namyoung Jung A dissertation submitted to Johns Hopkins University in conformity with the requirements for the degree of Doctor of Philosophy Baltimore, Maryland July, 2015 © 2015 Namyoung Jung All Rights Reserved Abstract Acute myeloid leukemia (AML) is a heterogeneous hematologic malignancy characterized by subpopulations of leukemia-initiating or leukemia stem cells (LSC) that give rise to clonally related non-stem leukemic blasts. The LSC model proposes that since LSC and their blast progeny are clonally related, their functional properties must be due to epigenetic differences. In addition, the cell of origin of LSC among normal hematopoietic stem and progenitor cells (HSPCs) has yet to be clearly demonstrated. In order to investigate the role of epigenetics in LSC function and hematopoietic development, we profiled DNA methylation and gene expression of CD34+CD38-, CD34+CD38+ and CD34- cells from 15 AML patients, along with 6 well-defined HSPC populations from 5 normal bone marrows using Illumina Infinium HumanMethylation450 BeadChip and Affymetrix Human Genome U133 Plus 2.0 Array. To define LSC and blast functionally, we performed engraftment assays on the three subpopulations from 15 AML patients and defined 20 LSCs and 24 blast samples. We identified the key functional LSC epigenetic signature able to distinguish LSC from blasts that consisted of 84 differential methylations regions (DMRs) in 70 genes that correlated with differential gene expression. HOXA cluster genes were enriched within the LSC epigenetic signature. We found that most of these DMRs involve epigenetic alteration independent of underlying mutations, although several are downstream targets of genetic mutation in epigenome modifying enzymes and upstream regulators.
[Show full text]
ER–Lysosome Contacts Enable Cholesterol Sensing by Mtorc1 and Drive Aberrant Growth Signalling in Niemann–Pick Type C
ARTICLES https://doi.org/10.1038/s41556-019-0391-5 ER–lysosome contacts enable cholesterol sensing by mTORC1 and drive aberrant growth signalling in Niemann–Pick type C Chun-Yan Lim1,2, Oliver B. Davis1,2, Hijai R. Shin1,2, Justin Zhang1,2, Charles A. Berdan1,3, Xuntian Jiang4, Jessica L. Counihan1,3, Daniel S. Ory4, Daniel K. Nomura 1,3 and Roberto Zoncu 1,2* Cholesterol activates the master growth regulator, mTORC1 kinase, by promoting its recruitment to the surface of lysosomes by the Rag guanosine triphosphatases (GTPases). The mechanisms that regulate lysosomal cholesterol content to enable mTORC1 signalling are unknown. Here, we show that oxysterol binding protein (OSBP) and its anchors at the endoplasmic retic- ulum (ER), VAPA and VAPB, deliver cholesterol across ER–lysosome contacts to activate mTORC1. In cells lacking OSBP, but not other VAP-interacting cholesterol carriers, the recruitment of mTORC1 by the Rag GTPases is inhibited owing to impaired transport of cholesterol to lysosomes. By contrast, OSBP-mediated cholesterol trafficking drives constitutive mTORC1 activa- tion in a disease model caused by the loss of the lysosomal cholesterol transporter, Niemann–Pick C1 (NPC1). Chemical and genetic inactivation of OSBP suppresses aberrant mTORC1 signalling and restores autophagic function in cellular models of Niemann–Pick type C (NPC). Thus, ER–lysosome contacts are signalling hubs that enable cholesterol sensing by mTORC1, and targeting the sterol-transfer activity of these signalling hubs could be beneficial in patients with NPC. he exchange of contents and signals between organelles is key of cholesterol within the lysosome, compromising its functional- to the execution of cellular programs for growth and homeo- ity and triggering NPC—a fatal metabolic and neurodegenerative stasis, and failure of this communication can cause disease.
[Show full text]
Oral Administration of Lactobacillus Plantarum 299V
Genes Nutr (2015) 10:10 DOI 10.1007/s12263-015-0461-7 RESEARCH PAPER Oral administration of Lactobacillus plantarum 299v modulates gene expression in the ileum of pigs: prediction of crosstalk between intestinal immune cells and sub-mucosal adipocytes 1 1,4 1,5 1 Marcel Hulst • Gabriele Gross • Yaping Liu • Arjan Hoekman • 2 1,3 1,3 Theo Niewold • Jan van der Meulen • Mari Smits Received: 19 November 2014 / Accepted: 28 March 2015 / Published online: 11 April 2015 Ó The Author(s) 2015. This article is published with open access at Springerlink.com Abstract To study host–probiotic interactions in parts of ileum. A higher expression level of several B cell-speciﬁc the intestine only accessible in humans by surgery (je- transcription factors/regulators was observed, suggesting junum, ileum and colon), pigs were used as model for that an inﬂux of B cells from the periphery to the ileum humans. Groups of eight 6-week-old pigs were repeatedly and/or the proliferation of progenitor B cells to IgA-com- orally administered with 5 9 1012 CFU Lactobacillus mitted plasma cells in the Peyer’s patches of the ileum was plantarum 299v (L. plantarum 299v) or PBS, starting with stimulated. Genes coding for enzymes that metabolize a single dose followed by three consecutive daily dosings leukotriene B4, 1,25-dihydroxyvitamin D3 and steroids 10 days later. Gene expression was assessed with pooled were regulated in the ileum. Bioinformatics analysis pre- RNA samples isolated from jejunum, ileum and colon dicted that these metabolites may play a role in the scrapings of the eight pigs per group using Affymetrix crosstalk between intestinal immune cells and sub-mucosal porcine microarrays.
[Show full text]