Download MIDDLE FLIGHT Vol.6 -2017

Total Page:16

File Type:pdf, Size:1020Kb

Download MIDDLE FLIGHT Vol.6 -2017 ISSN 2319-7684 MIDDLE FLIGHT SSM JOURNAL OF ENGLISH LITERATURE AND CULTURE UGC Approved National Level Peer Reviewed Journal NOVEMBER 2017 VOL. 6 NO. 1 SPECIAL VOLUME: Peripheral Identities in Literature, Film and Performance Middle Flight ISSN 2319-7684 Middle Flight SSM JOURNAL OF ENGLISH LITERATURE AND CULTURE VOL. 6 2017 DEPARTMENT OF ENGLISH S. S. MAHAVIDYALAYA KESHPUR, PASCHIM MEDINIPUR PIN: 721150, WEST BENGAL, INDIA Middle Flight SSM JOURNAL OF ENGLISH LITERATURE AND CULTURE UGC Approved National Level Peer Reviewed Journal Editorial Board: Bill Ashcroft, Australian Professorial Fellow, School of the Arts and Media, UNSW, Sydney Krishna Sen , Professor , University of Calcutta Tirthankar Das Purkayastha, Professor, Vidyasagar University Sankar Prasad Singha, Professor, Vidyasagar University Mahadev Kunderi, Professor, Mysore University Binda Sharma, Associate Professor, C.M.D. College (PG) Satyaki Pal , Associate Professor, R. K. M. Residential College (Autonomous), Narendrapur (PG) Goutam Buddha Sural , Professor, Bankura University Sudhir Nikam, Associate Professor, B. N. N. College (PG) Dinesh Panwar, Assistant Professor, University of Delhi Advisory Board: Jawaharlal Handoo, Professor, Tezpur University & President, Indian Folklore Congress Parbati Charan Chakraborty , Professor, The University of Burdwan B. Parvati, Professor, Andhra University Angshuman Kar, Associate Professor, The University of Burdwan Simi Malhotra, Professor, Jamia Millia Islamia University Shreya Bhattacharji, Associate Professor, Central University of Jharkhand Ujjwal Jana, Assistant Professor, Pondicherry University Subhajit Sengupta, Associate Professor, The University of Burdwan Guest Editor : Jaydeep Sarangi Editors : Debdas Roy Pritha Kundu Associate Editors : Joyjit Ghosh Indranil Acharya Published: November, 2017 ISSN: 2319 – 7684 Published by : Sukumar Sengupta Mahavidyalaya Keshpur, Paschim Medinipur, Pin: 721150 Ph: 03227-250861, Mail: [email protected] / [email protected] © S. S. Mahavidyalaya Rs. 500.00 (INR) Editorial The focus of the present volume of Middle Flight is on cultural production of the peripheral identities in literature, film and performance. The term ‘peripheral’ envisages centre-periphery relation which might give rise to unnecessary militant polarization leading to belying of the complex ground realities if not used with this caveat that it is a ‘way of reading’ – not a ‘way of being’. (Ashcroft) The recent debate around the release of Padmavati , a film directed by Sajay Leela Bhansali in which the alleged inclusion of a dance sequence by Padmavati , an iconic goddess-like figure of the dominant Rajput culture should be an eye opener for those of us who nurture culture- inhibitions and tend to divest art of the freedom to look at history from different perspectives – perspectives that look beyond the ‘enshrined’ and ‘established’ annals of history into hearsay, folk-lore, popular orally transmitted alternative tales, scandals, customs contrary to prevailing convention and the likes. Even if we are bent on flying with the term ‘peripheral’ it is good to maintain that awareness of multiple centres and peripheries help one understand the real nature of cultural eddies. There has been inclination to look at literature and art in terms of relations of inequality because they suggest crucial areas of difference which are often useful and offer a sense of belonging to one’s cozy culture. One writes from the periphery because one’s concerns are different, one’s themes are different and one does not often conform to the ‘placed’ canon. While awareness of differences is not something to be trumpeted about, it is, nevertheless, a potent means to counter subjugation effected by interlocking system of power and a means of rejuvenating the hitherto neglected moribund cultural systems. It helps in the shift of literature and culture from ‘mono-systems’ to ‘poly systems’. (Paranjape) Indeed, literature and culture needs to construct alternatives which involves a bit of resistance, but resistance need not necessarily be ‘reactive’, locked in a ‘prison of protest’ (Ashcroft) , but can be ‘pro-active’ (Paranjape) too. Moreover, there are discourses which neither ‘write back’ nor ‘react’ to the dominant culture. There are societies that simply ‘do their own thing’ although in the process they implicate themselves in a larger world. This is what Bill Ashcroft has termed as engagement of local community with global culture. The emergence and consolidation of Dalit and tribal literature in India is not an isolated phenomenon; it is an offshoot of the reversal of the centre-periphery relationship triggered by post-modernism, post-colonialism and identity-war. (Joseph Mcwan) With modern and postmodern developments in performative and cinematic semiotics, the conflict between the centre and periphery has now been a pregnant area of critical discourse which engages with issues such as postcolonialism, psychoanalysis, partition and Diaspora studies, gender and queer studies, Dalit and tribal studies, engagement with cultural outputs of the slaves, indigenous people, Chicanos and Chicanas, criminals, eunuchs, transvestites and other kinds of interdisciplinary ideas. Peripheral literatures in India have been mirroring social changes, conflicts and cultural shifts of society. They are connecting the vignettes to present a big canvas and are also attempting to broaden the frontiers of literature by introducing some novel images supplanting the stereotypical ones. The focus is indeed shifting from the centre to the periphery. Peripheral literature and culture is engaging readers in many different and new ways. The articles, book reviews , interview and meager translations included here address – as far as feasible within the middling flighty compass of our journal – some of the issues mentioned above. We have arranged the entries in separate sections, thematically conceptualized. The first section focuses on ‘Postcolonial Discourses’, which includes Professor Bill Ashcroft’s seminal discussion of Postcoloniality beyond ‘grand theories’. Appended to the paper are two reviews by Prof. Krishna Sen and Prof. S. P. Singha, in response to Ashcroft’s views. Their astute observations triggered by Ashcroft’s paper have made the section truly discursive. In the second section, we have included papers referring to the ‘mainstream’ literature, or, lesser-known texts, with an eye to locating and critically examining the notions of peripherality within such texts. Prof. Prodosh Bhattacharya’s paper takes the modern reader back to the days of heroic halls and monstrous lairs in the Anglo- Saxon epic, Beowulf. It is also to be noted that Old English literature has now been reduced to an almost peripheral status in the present academia; so Prof. Bhattacharya’s original and engaging approach to the representation of monstrosity in Beowulf offers a refreshing revival of the vigorous Anglo-Saxon spirit. Dr. Siddhartha Biswas has dealt with the question of ‘otherness’ in terms of sexuality and master-servant relationship in Harold Pinter’s play, The Servant. Anindita Bhowmik’s article discusses the representation of the ‘racial other’ in Wilkie Collins’ sensation novels. The creation of ‘textual peripheries’ through a Beckettian game of language has been discussed in Sambuddha Ghosh’s paper, which takes into account Samuel Beckett’s short prose- pieces as interesting resources. By using the Transformation and Materialist paradigms identified by Karen Kline, Abhirup Mascharak has studied two Hindi film adaptions of Joseph Conrad’s Lord Jim– one is Yash Chopra’s Kaala Patthar (1979) and Vishram Sawant’s Risk (2007) the other - concentrating on the extent to which they replicate on screen the isolation and peripherality that is central to Conrad’s oeuvre. The third section is concerned with the emergence of autobiography - narratives of pain, resistance and historical truths hitherto neglected and usually glossed over – as a vehicle to express sub-human living conditions of Dalits. The status of ‘autobiography’ as a peripheral genre has been explored in Dr. D. Murali Manohar’s insightful article. Dr. Murli has chosen three texts such as - Kamala Das’ My Story, Bama’s Karukku and P. Sivakami’s The Grip of Change– to prove how they have posed challenge to the genre called autobiography. In their joint paper Dr. Ujjwal Jana and Vinutha P Kunderi have appositely observed that besides occupying a space through identity based narrative, Dalit autobiography provides an occasion for Dalit writers to gain constitutional rights and understanding of Dalit self. Having discussed Aravind Malagatti’s (an eminent Dalit writer from Kannada) autobiography Government Brahmana, they have opined that Dalit autobiography has contested elitist representation of identity, society and culture. The fourth section includes papers dealing with the representation of resistance, peripherality and marginality in Indian English writings, though some of these papers obviously incorporate issues of colonial/postcolonial history and gender. In her touching paper Shreya Bhattacharji has unearthed how in her debut short-story collection An Unrestored Woman and Other Stories (2016) Shobha Rao has delved deep into the collective subconscious of a deeply wounded subcontinent. Prof. Bhattacharjii observes that Shobha Rao’s “little histories” of the “peripheral people” seek to foreground an intentional/unintentional conspiracy of selective amnesia indulged in by all — perpetrators, victims,
Recommended publications
  • Ultranationalism: a Proposal for a Quiet Withdrawal
    I developed an early suspicion of any form of nationalism courtesy of a geography teacher and an imaginary cricket game. As the only student of Chinese origin in a high school in Bangalore, I was asked by my teacher in a benign voice who I would support if India and China played a match. Aside from the ridiculousness of the question 01/05 (China does not even play cricket), the dubious intent behind it was rather clear, even to a teenager. Still, I dutifully replied, “Sir, I will support India,” for which I received a gratified smile and a pat on the head. I was offended less by the crude attempt by someone in power to force a kid to prove his patriotism, than by the outright silliness of the game. If all it took to Lawrence Liang establish the euphoric security of nationalism was that simple answer, I figured there must be something drastically wrong with the question. I Ultranationalism: was left, however, with an uneasy feeling (one that has persisted through the years), not A Proposal for a because I had given a false answer but because I had been forced to answer a false question. The Quiet answer made pragmatic sense in a schoolboy way (you don’t want to piss off someone who is going to be marking your papers), and I hadn’t Withdrawal read King Lear yet to know that the only appropriate response to the question should have been silence. If Cordelia refuses to participate in Lear’s competition of affective intimacy, it is not just the truth, but also the distasteful aesthetics of her sister’s excessive declarations of love, that motivates her withdrawal into silence.
    [Show full text]
  • Bengali Movie Sudhu Tomari Jonno Mp3 Download
    Bengali Movie Sudhu Tomari Jonno Mp3 Download Bengali Movie Sudhu Tomari Jonno Mp3 Download 1 / 2 Sudhu Tomari Jonno Full Movie Free Mp3 . Free Herogiri 2015 Bengali Full ... Movie Mp3 Song Download Shudhu Tomari Jonyo Video Download Shudhu .... "Jeno Tomari Kache" Bengali Movie Song Free Download. Songsz Download. by Songsz Download. 1. Pins ... "Sudhu Tomari Jonno" Movie's Songs Name: 1.. Download Shudhu Tomari Jonyo by Arijit Singh, Shreya Ghoshal. Play Shudhu Tomari Jonyo song online ad free in HD quality for free or download mp3 and listen offline on Wynk Music. ... Hits - Bengali. Most Streamed Bengali Songs 2019.. Shudhu Tomari Jonyo Mp3 Song Shudhu Tomari Jonyo Movie Bengali Mp3 Song Free Download Shudhu Tomari Jonyo Bengali Movie Mp3 Song Download .... Get the complete list of Shudhu Tomari Jonyo mp3 songs free online. Find the best place to Shudhu Tomari Jonyo movie songs download list. ... Shudhu Tomari Jonyo & Play Free Online Music on Hungama - Stream full Bengali Movie songs .... Shudhu Tomari Jonyo Songs Download- Listen Bengali Shudhu Tomari Jonyo MP3 songs online free. Play Shudhu Tomari Jonyo Bengali movie songs MP3 by .... Shudhu Tomari Jonyo MP3 Song by Shreya Ghoshal from the Bengali movie Shudhu Tomari Jonyo. Download Shudhu Tomari Jonyo song on Gaana.com and .... Directed by Birsa Dasgupta. With Dev, Srabanti Chatterjee, Soham Chakraborty, Mimi Chakraborty. Newlyweds who hate each other come to terms with each .... Download Egiye De Female Ringtone (Sudhu Tomari Jonno) submitted by ... it is a most beautiful ringtone from the Bengali movie sudhu tomari jonno. ... The ringtones on this website are in .mp3 format and is compatible with ...
    [Show full text]
  • Indo-Russia-A-Connect-Over-Millennia.Pdf
    Autobiography of India Indo Russia Connect Autobiography of India INDIA CONNECTS INDO - RUSSIA A Connect Over Millennia D.K.HARI D.K.HEMA HARI BHARATH GYAN SERIES Bridging Worlds Thru Knowledge Experience The Knowledge Of India Indo – Russia A Connect Over Millennia 2 / 165 Autobiography of India Indo Russia Connect Dedication This book is a part of our series, Autobiography of India, dedicated to our twin nephews, Aditya and Varun, who along with millions of other children world over, represent for us, the future of India and the world. It is our way of transmitting to them what we have learnt from our ancestors, about our ancestors and their way of sustaining themselves and the ecosystem around them for their sustained prosperity. Also, with their names, Aditya, the name for the divine Sun and Varun, the name of the divinity for Rain, they are for us, constant reminders of how blessed this land Bharatavarsha is, to receive bountiful rain and shine consistently. Rain and Shine are what our ancestors had leveraged ingeniously which made them last across generations, as a long-lasting, prosperous civilization and a role model for millennia. Aditya and Varun seem to be telling us all, Of what use is it to complain and whine? If you do not leverage your rain and shine! It is time we also start harnessing the Rain and Shine wisely and with responsibility, for the future of this civilization as well as mankind. We get a Rainbow, Indradhanush, only when there is Rain and Shine together! It is called Indra’s Dhanush, bow, as the spectrum of colours they produce, arc the sky like a bow.
    [Show full text]
  • 110025 SYLLABUS of BA ELECTIVE ALLIED SEMESTER MODE Wef
    DEPARTMENT OF ENGLISH JAMIA MILLIA ISLAMIA NEW DELHI – 110025 SYLLABUS OF B.A. ELECTIVE ALLIED SEMESTER MODE w.e.f. 2019 Semester I Paper I: Poetry CBC Paper I: Fiction I: Short Stories Semester II Paper II: Poetry II CBC Paper II: Detective Fiction Semester III Paper III: Drama I CBC Paper III: Skills for Communication Semester IV Paper IV: Drama II CBC Paper IV: Short Stories from India Semester V Paper V: Essays CBC Paper V: Premchand’s Short Stories Semester VI Paper VI: Fiction II: Novels CBC Paper VI: English for Academics & Professional Purposes *Each paper of four credits shall have 4 lectures per week over a period of one semester for teaching- learning process. ** Evaluation will be based on end semester examination and internal assessment. For end semester examination, each paper will carry 75 marks and will be of three hours’ duration. Internal Assessment will be based on two mid-semester tests/ assignments for 25 marks. B.A. PROGRAMME/ELECTIVE ALLIED SEMESTER I: Paper I: Poetry – I The paper will introduce students to English poetry from the 16th century to the early 20th century. The paper will also attempt to highlight the various social, religious and cultural events that are representative of the times. Unit I William Shakespeare: “Shall I compare thee to a summer’s day” (Sonnet 14) John Milton: “On His Blindness” Unit II William Wordsworth: “She Dwelt among the Untrodden Ways” Alfred Lord Tennyson: “Break, Break, Break” Unit III Robert Browning: “My Last Duchess” Unit IV W.B. Yeats: “The Lake Isle of Innisfree” Robert Frost: “The Road not Taken” Recommended Readings: Abrams, M.H.
    [Show full text]
  • Global Journal of Human Social Science Schemata) and Text Structure Will Be Systematically A) Critical Discourse Analysis (CDA) Analyzed
    OnlineISSN:2249-460X PrintISSN:0975-587X DOI:10.17406/GJHSS AStudyonJhenidahDistrict ThePoliticsofAnti-GraftWars AnalysisofMauritianExpatriates Socio-Economic&PsychologicalStatus VOLUME20ISSUE5VERSION1.0 Global Journal of Human-Social Science: C Sociology & Culture Global Journal of Human-Social Science: C Sociology & Culture Volume 2 0Issue 5 (Ver. 1.0) Open Association of Research Society Global Journals Inc. *OREDO-RXUQDORI+XPDQ (A Delaware USA Incorporation with “Good Standing”; Reg. Number: 0423089) Social Sciences. 2020. Sponsors:Open Association of Research Society Open Scientific Standards $OOULJKWVUHVHUYHG 7KLVLVDVSHFLDOLVVXHSXEOLVKHGLQYHUVLRQ Publisher’s Headquarters office RI³*OREDO-RXUQDORI+XPDQ6RFLDO 6FLHQFHV´%\*OREDO-RXUQDOV,QF Global Journals ® Headquarters $OODUWLFOHVDUHRSHQDFFHVVDUWLFOHVGLVWULEXWHG XQGHU³*OREDO-RXUQDORI+XPDQ6RFLDO 945th Concord Streets, 6FLHQFHV´ Framingham Massachusetts Pin: 01701, 5HDGLQJ/LFHQVHZKLFKSHUPLWVUHVWULFWHGXVH United States of America (QWLUHFRQWHQWVDUHFRS\ULJKWE\RI³*OREDO -RXUQDORI+XPDQ6RFLDO6FLHQFHV´XQOHVV USA Toll Free: +001-888-839-7392 RWKHUZLVHQRWHGRQVSHFLILFDUWLFOHV USA Toll Free Fax: +001-888-839-7392 1RSDUWRIWKLVSXEOLFDWLRQPD\EHUHSURGXFHG Offset Typesetting RUWUDQVPLWWHGLQDQ\IRUPRUE\DQ\PHDQV HOHFWURQLFRUPHFKDQLFDOLQFOXGLQJ SKRWRFRS\UHFRUGLQJRUDQ\LQIRUPDWLRQ G lobal Journals Incorporated VWRUDJHDQGUHWULHYDOV\VWHPZLWKRXWZULWWHQ 2nd, Lansdowne, Lansdowne Rd., Croydon-Surrey, SHUPLVVLRQ Pin: CR9 2ER, United Kingdom 7KHRSLQLRQVDQGVWDWHPHQWVPDGHLQWKLV ERRNDUHWKRVHRIWKHDXWKRUVFRQFHUQHG 8OWUDFXOWXUHKDVQRWYHULILHGDQGQHLWKHU
    [Show full text]
  • Yash Chopra the Legend
    YASH CHOPRA THE LEGEND Visionary. Director. Producer. Legendary Dream Merchant of Indian Cinema. And a trailblazer who paved the way for the Indian entertainment industry. 1932 - 2012 Genre defining director, star-maker and a studio mogul, Yash Chopra has been instrumental in shaping the symbolism of mainstream Hindi cinema across the globe. Popularly known as the ‘King of Romance’ for his string of hit romantic films spanning over a five-decade career, he redefined drama and romance onscreen. Born on 27 September 1932, Yash Chopra's journey began from the lush green fields of Punjab, which kept reappearing in his films in all their splendour. © Yash Raj Films Pvt. Ltd. 1 www.yashrajfilms.com Yash Chopra started out as an assistant to his brother, B. R. Chopra, and went on to direct 5 very successful films for his brother’s banner - B. R. Films, each of which proved to be a significant milestone in his development as a world class director of blockbusters. These were DHOOL KA PHOOL (1959), DHARMPUTRA (1961), WAQT (1965) - India’s first true multi-starrer generational family drama, ITTEFAQ (1969) & AADMI AUR INSAAN (1969). He has wielded the baton additionally for 4 films made by other film companies - JOSHILA (1973), DEEWAAR (1975), TRISHUL (1978) & PARAMPARA (1993). But his greatest repertoire of work were the 50 plus films made under the banner that he launched - the banner that stands for the best of Hindi cinema - YRF. Out of these films, he directed 13 himself and these films have defined much of the language of Hindi films as we know them today.
    [Show full text]
  • The NEHU Journal Vol
    The NEHU Journal Vol. XVI, No.2, July - December 2018 N E H U ISSN. 0972 - 8406 The NEHU Journal Vol. XVI, No. 2, July - December 2018 Editor: Prof. S.R. Joshi, Department of Biotechnology & Bioinformatics NEHU, Shillong Editorial Committee Members Prof. A.S. Dixit, Department of Zoology, NEHU, Shillong Prof. S. Mitra, Department of Chemistry, NEHU, Shillong Prof. I. Syiem, Department of Education, NEHU, Shillong Dr. R. M. Shangpliang, Department of Sociology, NEHU, Shillong Dr. Sudipta Ghosh, Department of Anthropology, NEHU, Shillong Dr. K. Upadhyay, Department of BSSS, NEHU, Shillong Dr. B. Dutta, Department of History, NEHU, Shillong i Contents Editorial ..................................................................................................... iv Self-Sacrifice: A Philosophical Analysis from the Perspective of Gender Danica A. E. Lyngdoh ............................................................................................1 Sanskritization, Genderization and Process of Making of A Woman Bhaskar Kumar Kakati .........................................................................................15 Higher Education and Socio-Cultural and Political Sustainability Ashok Dansana and Digambar Naik ....................................................................28 Public Distribution Among Tribal Households in Karnataka and Telangana Jayan T. ................................................................................................................41 Agricultural Productivity and its Determinants in Arunachal Pradesh:
    [Show full text]
  • DIRLIST6 01050000 01300000.Pdf
    Signatory ID Name CIN Company Name 01050011 KALRA SUNITA U74899DL1967PTC004762 R K INTERNATIOONAL PRIVATE 01050016 GUPTA VIVEK U51109OR2006PTC009068 MAHAKASH RENEWABLES (INDIA) 01050022 BHANDARI PARAMBIR SINGH U51909DL1999PTC100363 AKILA OVERSEAS PRIVATE LIMITED 01050036 BHUPENDRA GUPTA U70100MH1995PTC086049 SUNDER BUILDERS AND 01050064 KIRITKUMAR MERCHANT SHISHIR U51900MH2000PTC127408 HANS D TO R SOLUTIONS PRIVATE 01050071 AGARWAL BINDU U45201WB1997PTC084989 PRINCE SAGAR KUTIR PRIVATE 01050072 BIJOY HARIPRIYA JAIN U70109MH2008PTC180213 SAAT RASTA PROPERTIES PRIVATE 01050072 BIJOY HARIPRIYA JAIN U01403MH2008PTC182992 GREEN VALLEY AGRICULTURE 01050082 JAI KARUNADEVI PRITHVIRAJ U36993KA1999PTC025485 RODEO DRIVE LUXURY PRODUCTS 01050126 DEEPCHAND JAIN PRITHVIRAJ U36993KA1999PTC025485 RODEO DRIVE LUXURY PRODUCTS 01050174 JOGINDER SANDHU SINGH U67120CH2004PTC027291 JAGUAR CONSULTANTS PRIVATE 01050220 NARAYANAMURTHY U15421TN2006PLC060417 BHIMAAS SUGARS AND CHEMICALS 01050224 JITENDRA MEHTA U51109TN2007PTC062423 MOOLRAJ VYAPAR PRIVATE 01050251 PRAKASH SRIVASTAVA U72300DL2007PTC160451 PRODIGII ECALL PRIVATE LIMITED 01050251 PRAKASH SRIVASTAVA U63040DL2008PTC180031 REACHING WILD LIFE TOURISM 01050257 LALITKUMAR MERCHANT URMIL U51900MH2000PTC127408 HANS D TO R SOLUTIONS PRIVATE 01050273 KUSUM MISHRA U29248UP1999PTC024344 MAXWELL GEARS PRIVATE LIMITED 01050286 DUGGAL PRINCE U70109DL2006PTC153384 M R BUILDWELL PRIVATE LIMITED 01050290 JAI MISHRA SHANKAR U29248UP1999PTC024344 MAXWELL GEARS PRIVATE LIMITED 01050309 JAIN MUKESH U00000DL1992PTC050812
    [Show full text]
  • Title: Shri Pawan Kumar Bansal Presented a Statement of the Estimated Receipt and Expenditure of the Government of India for the Year 2013-14 in Respect of Railways
    > Title: Shri Pawan Kumar Bansal presented a statement of the estimated receipt and expenditure of the Government of India for the year 2013-14 in respect of Railways. THE MINISTER OF RAILWAYS (SHRI PAWAN KUMAR BANSAL): . Madam Speaker, I rise to present before this august House the Revised Estimates for 2012-13 and a statement of estimated receipts and expenditure for 2013-14. ...(Interruptions) अय महोदया : या कर रह े ह, अब आप शोर य मचा रह े ह ...(Interruptions) SHRI PAWAN KUMAR BANSAL: I do so with mixed feelings crossing my mind. While I have a feeling of a colossus today, it is only ephemeral and is instantaneously overtaken by a sense of humility. Democracy gives wings to the wingless, cautioning us all the while, that howsoever high or wide our flight may be, we must remain connected to the ground. For giving me this opportunity, I am grateful to the Hon'ble Prime Minister Dr. Manmohan Singh and the UPA Chairperson, Smt. Sonia Gandhi and pay my homage to the sacred memory of Sh. Rajiv Gandhi who introduced me to the portals of the highest Temple of Indian democracy. Madam Speaker, as I proceed, my thought goes to a particularly severe cold spell during the recent winter, when it was snowing heavily in Kashmir valley, and suspension of road and air services had brought life to a grinding halt. Photographs appearing in Newspapers showing a train covered with snow emerging from a similar white background, carrying passengers travelling over the recently commissioned Qazigund - Baramulla section instilled in me a sense of immense pride.
    [Show full text]
  • How Will We Get a Book in Every Child's Hand? Together
    How will we get a book in every child’s hand? Together. Annual Report 2016-2017 1 Together, we can. It would be no exaggeration to describe the year gone by as an exceptional one – not only for the expansion of our work, but also for the ways in which this expansion has taken place. We are still relatively small, but collaboration and partnerships have enabled an impact far beyond our expectations. And certainly, farther than what we could have achieved on our own. Together, we’ve managed to create more books, both, in print, as well as digital-first titles. Together, we’ve put our minds to transforming scientific and mathematical concepts into nonfiction stories. Together, we’ve translated stories for different tribes, different regions, and different countries – starting at 21 languages, our family of translators now work in 84 languages. Together, we are creating even more joyful stories as a result of content generation campaigns like Retell, Remix, Rejoice! and Spotathon. In our quest to find new ways to spread the joy of reading among children who have little or no access to supplementary reading books, we have been delighted to discover that digital distribution via our content platform, StoryWeaver, has transformed the landscape. Many organisations have begun to distribute books in their networks, by downloading them from StoryWeaver and either using them digitally or even printing them themselves. Our committed community of donors make a huge impact on thousands of children through our crowdfunding platform, Donate-a-Book, while the equally enthusiastic tribe of Pratham Books Champions, our volunteer storytellers, take the magic of storytelling to more and more kids each year.
    [Show full text]
  • Reconsidering Solidarity with Leela Gandhi and Judith Butler
    Europe’s Crisis: Reconsidering Solidarity with Leela Gandhi and Judith Butler Giovanna Covi for William V. Spanos, who has shown the way The idea called Europe is important. It deserves loving and nourishing care to grow well and to return its promise. It is a visionary idea shared by winners and losers of World War II, by survivors of the Nazi-Fascist regimes and the Shoah, by large and small countries. It is still little more than just an idea: so far, it has only yielded the suspension of inner wars among the states that became members of the European Union. It is only a germ. Yet, its achievement is outstanding: in the face of the incessant proliferation of wars around the globe, it has secured lasting peace to an increasing number of nations since the 1950s. The idea called Europe is also vague. It has pursued its aim of ending the frequent and bloody wars between neighbours mainly through economic ties, as the Treaty of Maastricht’s failure to promote shared policies underscores. For over half a century, its common policies have been manifestly insufficient and inadequate. It is indeed still only a germ. And its limitations are tremendous: in the face of the rising threats to its own idea of peaceful cohabitation, of the internal rise of violent and hateful forces of sovereignty, of policies of domination, discrimination and exclusion, it is incapable of keeping Europe’s own promise. Such limitations are tangible in the debate about Grexit and the decision regarding Brexit, as well as in the political turn towards totalitarianisms in multiple states.
    [Show full text]
  • The Intangible Cultural Heritage of Gokarneshwor
    THE INTANGIBLE CULTURAL HERITAGE OF GOKARNESHWOR A Thesis Submitted To Central Department of Nepalese History, Culture and Archaeology (NeHCA), Tribhuwan University In the partial fulfillment of the requirements for the Degree of Master in Art (MA) Submitted By: Nittam Subedi TU Registration No: 7-2-357-17-2009 Kirtipur, Kathmandu 2016 i ACKNOWLEDGEMENTS The thesis on “The Intangible Cultural Heritage of Gokarneshwor” is written for the partial fulfillment of the requirements for the degree of Master in Nepalese History Culture and Archaeology under the Department of Culture, Tribhuvan University. I hereby like to thank to my respected teachers and all those individual as well as institution for their help and support in whatever capacity possible. First of all, I would like to pay my special thanks to Professor Ms. Sabitree Mainali- the Head of Department of NeHCA, Central Department of Tribhuvan University for providing Professor Mr. Madan Rimal, as my thesis guide, who have help me to complete my thesis on time without any hassles. Meantime, I am also grateful to Professor Dr. Ms. Beena Ghimire (Poudel) for her infinite support to complete my thesis. I am also thankful to all my teachers and administration who help me to gather important information related to my thesis topic. I would like to express my indebtedness to my father Mr. Dhurba Bdr. Subedi who have introduce me the respectable person at Gokarneshwor. Also, I express my due respect to Mr. Keshab Bhatta- priest of Gokarneshwor temple; Mr. Nabaraj Poudel- member of Kal Mochan Guthi; Narayan Kaji Shrestha and Sanu Kaji Shrestha-members of Kanti Bhairav Guthi.
    [Show full text]