DOCSLIB.ORG

EXPECT a LOT 2011 Bay - Dosage Profile: 6-8-16-0-0; DI: 2.75; CD: +0.67

Total Page：16

File Type：pdf, Size：1020Kb

Download full-text PDF Read full-text
EXPECT a LOT 2011 Bay - Dosage Profile: 6-8-16-0-0; DI: 2.75; CD: +0.67 EXPECT A LOT 2011 Bay - Dosage Profile: 6-8-16-0-0; DI: 2.75; CD: +0.67 Nearctic RACE AND (STAKES) RECORD Northern Dancer Natalma EXPECT A LOT did not race. Vice Regent *Menetrier Victoria Regina Victoriana IN THE STUD Deputy Minister Bunty Lawless Bunty’s Flight EXPECT A LOT entered stud in 2015. His first foals arrive Broomflight Mint Copy in 2016. Jabneh Shakney Grass Shack Awesome Again (1994) MALE LINE *Nasrullah Red God Spring Run EXPECT A LOT is by AWESOME AGAIN, stakes winner Blushing Groom (FR) Wild Risk Runaway Bride (GB) of $4,374,590, Breeders’ Cup Classic-G1, Whitney H.- Aimee Primal Force G1, etc. Sire of 61 stakes winners, including-- Raise a Native Mr. Prospector GHOSTZAPPER. 9 wins to 5, $3,446,120, horse of the year, Gold Digger Prime Prospect Olden Times champion older horse, Breeders’ Cup Classic-G1-ntr, 1 Square Generation Chavalon 1/4 mi. in 1:59, Metropolitan H.-G1, Vosburgh S.-G1, Expect a Lot Intentionally In Reality Woodward S.-G1, Tom Fool H.-G2, Philip H. Iselin My Dear Girl Relaunch Breeders’ Cup H.-G3, 3rd King’s Bishop S.-G1. Sire. The Axe II Foggy Note GINGER PUNCH. 12 wins in 22 starts, 3 to 5, $3,065,603, Silver Song Cee’s Tizzy Northern Dancer champion older mare, Breeders’ Cup Distaff-G1, Per- Lyphard Goofed sonal Ensign S.-G1, Ruffian H.-G1, Ogden Phipps H.- Tizly Trevieres *Tizna G1, Go for Wand H.-G1 twice, Louisville S.-G2, etc. Noris Tizamazing (2002) NOMINEE. Placed at 2 in N.A.; 6 wins, 3 to 6, 2015 in Trini- Bold Reasoning Seattle Slew dad and Tobago, champion grass horse, NLCB Cham- My Charmer Seattle Song Prince Blessed pagne S.-G1, 2nd Bernard Dulal-Whiteway Independ- Incantation Magic Spell ence Cup-G1, etc.; placed in 1 start at 5 in Barbados. Cee’s Song Northern Dancer Nice Dancer GAME ON DUDE. 16 wins, 3 to 7, $6,498,893, TVG Pacific Nice Princess Lonely Dancer Classic S.-G1, Santa Anita H.-G1 three times, Holly- Pia Star Sleep Lonely wood Gold Cup H.-G1 twice, Goodwood S.-G1, etc. Sulenan AWESOME GEM. 11 wins to 9, $2,881,370, Hollywood Gold Cup H.-G1, Hawthorne Gold Cup H.-G2, San Fer- SO LONESOME. 4 wins to 3, $394,067, Albany S.-R, etc. TIZBUD (c. by Cee's Tizzy). Winner at 3 and 4, $230,- nando Breeders’ Cup S.-G2, Lone Star Park H.-G3, etc. SANGAREE. 4 wins to 5, $337,710, in N.A., Joe Hernan- 266, California Cup Classic H.-LR, 3rd San Fer- WILKO. 2 wins at 2 in England, 2nd Veuve Clicquot Vin- dez S., 2nd Triple Bend H.-G1, etc.; placed at 6 in U.A.E. nando Breeders' Cup S.-G2. Sire. tage S.-G2, etc.; winner at 2, $1,134,639, in N.A., AWESOME BABY. 4 wins in 6 starts to 3, $356,078, Santa C'Mon Tiger (c. by Storm Cat). 3 wins at 3 and 4, Breeders’ Cup Juvenile-G1, etc.; placed in 1 start at 4 in Ynez S.-G2, Santa Ysabel S.-G3, Sunland Park Oaks-L. $136,096, in N.A., 2nd Santana Mile H.-L. Sire. U.A.E., 2nd Emirates Airline Dubai World Cup-G1. Sire. JENNIE R.. 7 wins to 6, $338,034, Indian Maid H.-L, etc. You're Beautiful. Winner at 2, $18,439, in Ireland. (Total: ROUND POND. 7 wins in 13 starts at 3 and 4, $1,998,700, CALLMETHESQUEEZE. 7 wins at 3 and 4, $324,499, $18,439). Dam of Srikinglybeautiful (f. by Smart Breeders’ Cup Distaff-G1, Acorn S.-G1, Fantasy S.-G2, Hollywood Wildcat S.-L, Judy’s Red Shoes S., etc. Strike, to 5, 2015, $121,705, 3rd Blue Sparkler S.). Azeri Breeders’ Cup S.-G3, Honeybee S.-L, etc. Balboa Betty. Winner, $38,120. Producer. Granddam of OXBOW. 3 wins at 2 and 3, $1,243,500, Preakness S.-G1, FEMALE LINE BETTYS BAMBINO (g. by Unusual Heat, to 5, 2015, LeComte S.-G3, 2nd Belmont S.-G1, Rebel S.-G2. 1st dam $318,036, Daytona S.-G3, Sensational Star S.-R). PAYNTER. 4 wins at 3 and 4, $1,101,924, Haskell Invitation- TIZAMAZING, by Cee's Tizzy. Unraced. Sister to TIZNOW, Tizsweet. Placed at 2, $5,640. Dam of Tizsweetdreams al S.-G1, 2nd Belmont S.-G1, Awesome Again S.-G1, BUDROYALE, TIZDUBAI, TIZBUD. Dam of-- (f. by Our Emblem, 2 wins, $88,182, 3rd CERF H.-LR). San Diego H.-G2, The Cliff’s Edge Derby Trial S.-G3. OXBOW (c. by Awesome Again). 3 wins at 2 and 3, Tizso. Unplaced in 2 starts. Dam of PAYNTER (c. by TOCCET. 7 wins to 3, $931,387, Champagne S.-G1, Hol- $1,243,500, Preakness S.-G1, LeComte S.-G3, Awesome Again, 4 wins, $1,101,924, Haskell Invi- lywood Futurity-G1, etc. Leading sire twice in Oklahoma. 2nd Belmont S.-G1, Rebel S.-G2. tational S.-G1, 2nd Belmont S.-G1, etc.), TIZ SPUN SUGAR. 6 wins to 4, $929,171, Apple Blossom H.- AWESOME PATRIOT (c. by Awesome Again). 3 wins, WEST (c. by Gone West, 3 wins, $263,761, Cine- G1, Go for Wand H.-G1, Black-Eyed Susan S.-G2, etc. $114,600, Alydar S., 3rd Hollywood Prevue S.-G3. ma H.-G3, etc.), TIZAKITTY (f. by Distinctive Cat, 4 AWESOME ACTION. 12 wins, 2 to 9, $822,524, Labeeb Cut in Stone (f. by Speightstown). Winner at 3, 2015, wins, $158,644, Kalookan Queen H.-L), Tizalove- S.-L, Ontario Jockey Club S.-LR twice, etc. $25,640. lylady (f. by Western Fame, $55,740, 3rd XTRA 690 HOTSTUFANTHENSOME. 13 wins to 9, $756,743, Cliff Broodmare Sire AM California Cup Juvenile Fillies S.-LR). Grand- Hanger S.-G3, Mac Diarmida H.-G3-ncr, etc. Set ncr. CEE’S TIZZY, 1987. Sire of 174 dams of 617 foals, 367 dam of TIZ GIANNI (g. by Giacomo, 6 wins to 7, PERSONAL LEGEND. 6 wins, 3 to 5, $744,805, Turnback rnrs (59%), 233 wnrs (38%), 61 2yo wnrs (10%), 2015, $253,691, Cotton Fitzsimmons Mile H., etc.). the Alarm H.-G3, Stage Door Betty H.-L, etc. 0.97 AEI, 1.38 CI, 18 stakes winners. 3rd dam GOLDEN MYSTERY. 9 wins, 3 to 7, $540,223, Hurricane 2nd dam LONELY DANCER, by Nice Dancer. Winner at 3, $3,873. Sister Bertie S.-G3, Mongo Queen S., etc. CEE'S SONG, by Seattle Song. Winner, $82,225. Dam of-- to MR. KAPACITY. Dam of 11 other winners, incl.-- TESSA BLUE. 4 wins, $533,100, Indiana Oaks-G3, Inside TIZNOW (c. by Cee's Tizzy). 8 wins to 4, $6,427,830, CEETOIT. 17 wins, $139,508, Black Mountain H., etc. Information Breeders’ Cup S.-L, 2nd Rampart H.-G2, etc. horse of the year, champion 3-year-old colt, champi- LEERY BABA. 3 wins, $84,539, Marshua S., etc. Dam SUGAR SHAKE. 6 wins to 4, $500,636, Santa Maria H.- on older horse, Breeders' Cup Classic-G1 twice, of Strategic Defense ($50,769). Granddam of G1, El Encino S.-G2, Turnback the Alarm H.-G3, etc. Santa Anita H.-G1, Super Derby-G1-ntr, 1 1/4 mi. in BRIDGE GAME ($234,555, Modesty H.-G3, etc.). RACING BRAN. 12 wins, 3 to 7, $463,797, Essex H.-L, etc. 1:59 4/5, Goodwood Breeders' Cup H.-G2, San Fer- Dance Alone. 3 wins at 4 in Ireland. Dam of CELIBATE, DAAHER. 4 wins, $461,384, Hill ‘n’ Dale Cigar Mile H.-G1, nando Breeders' Cup S.-G2, Affirmed H.-G3, 2nd BALLA SOLA (9 wins, Red Mills Trial Hurdle, etc.). Jerome H.-G2, 3rd Prince of Wales S.-LR, etc. Sire. Pacific Classic S.-G1, etc. Among the leading sires. 4th dam AWESOME VISION. 8 wins, 3 to 5, $439,286, Move It Now BUDROYALE (g. by Cee's Tizzy). 17 wins, 2 to 7, $2,- SLEEP LONELY, by Pia Star. 2 wins at 3, $8,140. Half-sister S.-R, Saratoga Sunrise S.-R, Compelling Word S.-R, etc. 840,810, Goodwood Breeders' Cup H.-G2, San to SWINGING LIZZIE, Corsicana. Dam of-- DUBAI ESCAPADE. Winner at 3 in U.A.E.; 5 wins at 4, Antonio H.-G2, San Bernardino H.-G2, Mervyn Le- MR. KAPACITY. 22 wins, $193,950, Sir Barton S., etc. $410,800, in N.A., Ballerina Breeders’ Cup S.-G1, etc. Roy H.-G2, Longacres Mile H.-G3, etc. QUANTRA. 5 wins to 3, $80,485, Maple Leaf S.-R, etc. TEMPORARY SAINT. 8 wins, 2 to 5, $405,101, Excelsior TIZDUBAI (f. by Cee's Tizzy). 2 wins at 2, $116,400, in Granddam of Tara of Helium ($186,285, dam of H.-G3, 2nd Stymie H.-L, etc. N.A., Sorrento S.-G2. Producer. Don Sings Ramona), Blanca Delia ($98,110). 2016 FEE: $1,000 – LIVE FOAL Property of Eureka Thoroughbred Farm EUREKA THOROUGHBRED FARM Inquiries to Bill Tracy 6476 U.S. Highway 290 E. • Fredericksburg, Texas 78624 Phone: (830) 688-1709 • Email: [email protected] • Website: www.eurekathoroughbreds.com Accredited Texas Stallion • Nominated to the Texas Stallion Stakes Series 46 AMERICAN RACEHORSE • 2016 STALLION REGISTER Progeny earnings weekly www.americanracehorse.com throughout updated 2016 at EXPECT A LOT AWESOME AGAIN – TIZAMAZING, BY CEE’S TIZZY A son of a Breeders’ Cup Classic winner from one of the most productive female families of all time! EXPECT A LOT is a son of Breeders’ Cup Classic (G1) winner AWESOME AGAIN (sire of GHOSTZAPPER, GAME ON DUDE and PAYNTER) and a full brother to Preakness Stakes (G1) winner and Belmont Stakes (G1) runner-up OXBOW.
Load more

Recommended publications
  • 138904 02 Classic.Pdf
    breeders’ cup CLASSIC BREEDERs’ Cup CLASSIC (GR. I) 30th Running Santa Anita Park $5,000,000 Guaranteed FOR THREE-YEAR-OLDS & UPWARD ONE MILE AND ONE-QUARTER Northern Hemisphere Three-Year-Olds, 122 lbs.; Older, 126 lbs.; Southern Hemisphere Three-Year-Olds, 117 lbs.; Older, 126 lbs. All Fillies and Mares allowed 3 lbs. Guaranteed $5 million purse including travel awards, of which 55% of all monies to the owner of the winner, 18% to second, 10% to third, 6% to fourth and 3% to fifth; plus travel awards to starters not based in California. The maximum number of starters for the Breeders’ Cup Classic will be limited to fourteen (14). If more than fourteen (14) horses pre-enter, selection will be determined by a combination of Breeders’ Cup Challenge winners, Graded Stakes Dirt points and the Breeders’ Cup Racing Secretaries and Directors panel. Please refer to the 2013 Breeders’ Cup World Championships Horsemen’s Information Guide (available upon request) for more information. Nominated Horses Breeders’ Cup Racing Office Pre-Entry Fee: 1% of purse Santa Anita Park Entry Fee: 1% of purse 285 W. Huntington Dr. Arcadia, CA 91007 Phone: (859) 514-9422 To Be Run Saturday, November 2, 2013 Fax: (859) 514-9432 Pre-Entries Close Monday, October 21, 2013 E-mail: [email protected] Pre-entries for the Breeders' Cup Classic (G1) Horse Owner Trainer Declaration of War Mrs. John Magnier, Michael Tabor, Derrick Smith & Joseph Allen Aidan P. O'Brien B.c.4 War Front - Tempo West by Rahy - Bred in Kentucky by Joseph Allen Flat Out Preston Stables, LLC William I.
    [Show full text]
  • 2020 Kentucky Moon (2020)
    TesioPower Rancho San Antonio 2020 Kentucky Moon (2020) Turn-To ROYAL CHARGER 9 Hail To Reason Source Sucree 1-w Nothirdchance Blue Swords 7 Roberto (1969) Galla Colors 4-n NASHUA NASRULLAH 9 Bramalea Segula 3-m Rarelea Bull Lea 9 Dynaformer (1985) Bleebok 12-c Ribot Tenerani 6 His Majesty Romanella 4-l Flower Bowl Alibhai 6 Andover Way (1978) Flower Bed 4 OLYMPIA Heliopolis 8 On The Trail Miss Dolphin 4-p Golden Trail Hasty Road 3 Blueformer (1999) Sunny Vale 4 Icecapade NEARCTIC 14 Clever Trick Shenanigans 8 Kankakee Miss Better Bee A1 Phone Trick (1982) Golden Beach 9 Finnegan ROYAL CHARGER 9 Over The Phone Last Wave 9-f Prattle Mr Busher 1-x Tangled Up In Blue (1989) Tsumani 8-h NORTHERN DANCER NEARCTIC 14 Dancing Count Natalma 2 Snow Court King's Bench 1-l Count On Kathy (1978) Snow Cloud 3 Wise Exchange Promised Land 14 War Exchange Coastal Trade 8-c Jungle War Battle Joined 4 Sicotico (2005) Jota Jota 19-c NEARCO Pharos 13 NEARCTIC Nogara 4 Lady Angela Hyperion 6 NORTHERN DANCER (1961) Sister Sarah 14 NATIVE DANCER Polynesian 14 Natalma Geisha 5-f Almahmoud Mahmoud 9 Lombardi (1978) Arbitrator 2-d Vandale Plassy 13 Herbager Vanille 3-c Flagette Escamillo 14-a Julia B (1970) Fidgette 16-c NASRULLAH NEARCO 4 Zonah Mumtaz Begum 9 Gambetta My Babu 1 Lump Of Joy (1987) Rough Shod 5-h NASRULLAH NEARCO 4 Never Bend Mumtaz Begum 9 Lalun Djeddah 13 Thorn (1968) Be Faithful 19 Rosemont The Porter 14 Rosayya Garden Rose 4 Omayya Sir Gallahad III 16 Thortania (1975) Ommiad 1-n The Yuvaraj Fairway 13 Tatan Epona 19 Valkyrie Donatello II 14-c
    [Show full text]
  • 750 Game on Dude 2007 Page 1
    #750 Game on Dude 2007 Page 1 Vice Regent Deputy Minister Mint Copy Awesome Again Blushing Groom (FR) Game on Dude Primal Force Prime Prospect Dark Bay or Brown Gelding Devil's Bag Foaled April 26, 2007 Devil His Due Worldly Pleasure Plenty O'Toole (2000) Fast Play Fast Pleasure Sis Pleasure Fager By AWESOME AGAIN (1994), Black type winner, $4,374,590. Sire of 12 crops. 850 foals, 592 starters, 50 black type winners, 423 winners, $65,944,993, including Ghostzapper (Horse of the Year, Champion, $3,446,120), Ginger Punch (Champion, $3,065,603), Game on Dude ($5,002,158, Santa Anita H. [G1], etc.), Awesome Gem ($2,881,370, Hollywood Gold Cup H. [G1], etc.), Wilko ($2,435,136, Breeders' Cup Juvenile [G1], etc.), Round Pond ($1,998,700, Breeders' Cup Distaff [G1], etc.), Oxbow ($1,243,500, Preakness S. [G1], etc.), Paynter ($1,029,424, Haskell Invitational S. [G1], etc.). 1ST DAM WORLDLY PLEASURE, by Devil His Due. 8 wins at 3 and 4, $178,359 in NA. Placed at 5, $4,736 in US. Won Politely S.-R (LRL, $36,000). 3rd Summer King S. (DEL, $5,797). (Total: $183,095) Dam of 1 foal to race, 1 winner-- GAME ON DUDE (g, by Awesome Again). Black type winner, see records. 2ND DAM FAST PLEASURE, by Fast Play. 10 wins, 3 to 6, $85,002 in NA. Dam of 6 foals to race, 4 winners-- WORLDLY PLEASURE (f, by Devil His Due). Black type winner, see above. Out to Please (g, by Outflanker). 9 wins, 3 to 6, $117,060 in US.
    [Show full text]
  • PPCO Twist System
    RICHARD’S KID dkb/br, 2005 height 15.3 Dosage (7-8-19-4-0); DI: 1.81; CD: 0.47 See gray pages—Polynesian RACE AND (BLACK TYPE) RECORD Mr. Prospector, 1970 Raise a Native, by Native Dancer Age Starts 1st 2nd 3rd Earned 14s, BTW, $112,171 Kingmambo, 1990 1,178 f, 182 BTW, 3.91 AEI Gold Digger, by Nashua 2 3 0 0 0 $3,530 13s, BTW, $734,804 3 7 3 1 3 $65,000 894 f, 85 BTW, 2.42 AEI Miesque, 1984 Nureyev, by Northern Dancer 4 11 3(2) 1(1) 2(1) $732,840 Lemon Drop Kid, b, 1996 16s, BTW, $2,096,517 Pasadoble, by Prove Out 5 6 3(3) 0 2(2) $915,000 24s, BTW, $3,245,370 14 f, 10 r, 6 w, 5 BTW 6 2 0 0 0 $0 1,237 f, 87 BTW, 1.71 AEI Seattle Slew, 1974 Bold Reasoning, by Boldnesian 8.05 AWD 7 in NA, UAE 10 2(2) 1(1) 2(2) $584,990 17s, BTW, $1,208,726 Charming Lassie, 1987 1,050 f, 111 BTW, 3.69 AEI My Charmer, by Poker 8 8 1(1) 0 3(3) $180,899 1s, wnr, $16,500 Totals 47 12(8) 3(2) 12(8) $2,482,259 9 f, 7 r, 6 w, 4 BTW Lassie Dear, 1974 Buckpasser, by Tom Fool 26s, BTW, $80,549 Won At 3 13 f, 12 r, 12 w, 4 BTW Gay Missile, by Sir Gaylord An allowance race at Lrl ($30,000, abt 8.5f in 1:45.02, Ack Ack, 1966 Battle Joined, by Armageddon dftg.
    [Show full text]
  • WHAT NOW Dkb/Br, 2007 Height 15.3 Dosage (7-2-10-0-1); DI: 2.33; CD: 0.70 See Gray Pages—Polynesian RACE RECORD Mr
    WHAT NOW dkb/br, 2007 height 15.3 Dosage (7-2-10-0-1); DI: 2.33; CD: 0.70 See gray pages—Polynesian RACE RECORD Mr. Prospector, 1970 Raise a Native, by Native Dancer Age Starts 1st 2nd 3rd Earned 14s, BTW, $112,171 Forty Niner, 1985 1,178 f, 182 BTW, 3.91 AEI Gold Digger, by Nashua 2 0 0 0 0 — 19s, BTW, $2,726,000 3 3 0 0 0 $6,360 920 f, 56 BTW, 1.97 AEI File, 1976 Tom Rolfe, by Ribot 22s, BTW, $73,774 4 12 3 3 1 $65,230 Distorted Humor, ch, 1993 23s, BTW, $769,964 10 f, 10 r, 7 w, 1 BTW Continue, by Double Jay 5 10 1 1 1 $24,620 1,729 f, 158 BTW, 1.92 AEI Totals 25 4 4 2 $96,210 Danzig, 1977 Northern Dancer, by Nearctic 7.17 AWD 3s, wnr, $32,400 Won At 4 Danzig's Beauty, 1987 1,075 f, 198 BTW, 3.93 AEI Pas de Nom, by Admiral's Voyage 8s, BTW, $205,806 A race at Prx ($29,832, 8f in 1:41.98, dftg. Joe the 14 f, 8 r, 6 w, 2 BTW Sweetest Chant, 1978 Mr. Leader, by Hail to Reason Dude, Audeamus, Bellhouse, Spanish Kitten, Jons 40s, BTW, $414,410 Master Dancer, Bona Fide, Notadream). 11 f, 10 r, 9 w, 1 BTW Gay Sonnet, by Sailor A race at Prx ($23,810, 8f in 1:39.12, dftg. Tiger Grr, Relaunch, 1976 In Reality, by Intentionally Spangled Star, Full Liquidity, Gentleman Jim, Five 18s, BTW, $278,100 Guns West, In Full Contention).
    [Show full text]
  • Sharing the Responsibility
    Summer 2015 Sharing The Responsibility thoroughbredaftercare.org “ It is our responsibility as owners, tracks, breeders, trainers, jockeys, bloodstock agents, and anyone who has a stake in the game to take responsibility for the aftercare of these great animals that are the keystone of our sport. ” Jack Wolf TAA Immediate Past President Thoroughbred Aftercare Alliance c/o The Jockey Club 821 Corporate Drive Lexington, Kentucky 40503 U.S.A Tel: 859-224-2756 Fax: 859-296-3045 [email protected] www.thoroughbredaftercare.org It is only right that we should stand “ up for those horses that have stood up for us. ” Brereton C. Jones Airdrie Stud Contents Company Profile 04 Message from the President 05 About Us 06 Funding 08 Accreditation 10 Media Articles 12 2015 Event Listing 28 Contact Information 29 Company Profile Executive Committee Jimmy Bell President Mike Meuser Vice President & Secretary Madeline Auerbach Vice President Sharyn Neble Treasurer Matt Iuliano Member Stacie Clark Rogers Operations Consultant Board of Directors Craig Bernick President & COO, Glen Hill Farm Erin Crady Executive Director, Thoroughbred Charities of America Robert Elliston COO, Breeders Cup Ltd. Anna Ford Program Director, New Vocations Racehorse Adoption Program Georganne Hale Director of Racing, Maryland Jockey Club Reiley McDonald Principal, Eaton Sales LLC Stacie Roberts Executive Director, The Jockey Club of Canada Bryan Sullivan Board Member, Thoroughbred Owners and Breeders Association Bill Thomason President & CEO, Keeneland Association, Inc. Rick Violette President, New York Thoroughbred Horsemen’s Association Jack Wolf Principal, Starlight Racing Mike Ziegler Executive Director of Racing, Churchill Downs Inc. Advisory Board Michael Amo Jill Baffert Jeffrey Bloom Donna Barton Brothers Boyd Browning Bo Derek David Foley Craig Fravel Jim Gagliano Allen Gutterman Phil Hanrahan Steve Haskin Charlie Hayward Stacey Krembil Mike Levy Lucinda Mandella Dan Metzger Terry Meyocks Anita Motion Martha Jane Mulholland Dr.
    [Show full text]
  • Santa Anita Derby
    $$750,0001,0000,000 SANTA ANITA HANDICAP SANTA ANITA DERBY GAME ON DUDE Dear Member of the Media: Now in its 78th year of Thoroughbred racing, Santa Anita is proud to have hosted many of the sport’s greatest moments. Although the names of its historic human and horse heroes may have changed in the SANTA ANITA HANDICAP past seven decades of racing, Santa Anita’s prominence in the sport $1,000,000 Guaranteed (Grade I) remains constant. Saturday, March 7, 2015 • Seventy-Eighth Running This year, Santa Anita will present the 78th edition of one of rac- Gross Purse: $1,000,000 Winner’s Share: $600,000 Other Awards: $200,000 second; $120,000 third; $50,000 fourth; $20,000 fifth ing’s premier races — the $1,000,000 Santa Anita Handicap on Saturday, Distance: One and one-quarter miles on the main track March 7. Nominations: Close February 21, 2015 at $100 each The historic Big ‘Cap was the nation’s first continually run $100,000 Supplementary nominations of $25,000 by 12 noon, Feb. 28, 2015 Track and American stakes race and has arguably had more impact on the progress of Dirt Record: 1:57 4/5, Spectacular Bid, 4 (Bill Shoemaker, 126, February 3, Thoroughbred racing than any other single event in the sport. The 1980, Charles H. Strub Stakes) importance of this race and many of its highlights are detailed by the Stakes Record: 1:58 3/5, Affirmed, 4 (Laffit Pincay Jr., 128, March 4, 1979) Gates Open: 10:00 a.m. esteemed sports journalist John Hall beginning on page 2.
    [Show full text]
  • Graydar Oxbow
    GRAYDAR OXBOW We have enjoyed tremendous success in standing/managing stallions over the last 20 years. KRIS S. SAINT BALLADO UNBRIDLED’S SONG 2 Dear Breeder, Taylor Made is a family owned and operated farm built on honesty, long-lasting relationships and horsemanship. Taylor Made Stallions’ mode of operation has always been – and remains – to focus on standing quality stallions that provide breeders great opportunities, whether they are breeding to race or sell. 2013 was a bounce-back year for commercial breeders, including a GSVRIVXYVRMRK/IIRIPERH7ITXIQFIVWEPIXLEXWE[KEMRWEGVSWWXLIFSEVHLMKLPMKLXIHF]WIZIR½KYVI]IEVPMRKWERHFSEWXMRK the third highest average of all time. The recent market results have proven that the well-conformed individual has re-emerged as the most important component SJEFY]IV´WWIPIGXMSRGVMXIVME,IVIEX8E]PSV1EHI[IQEOIWYVIIEGLSJSYVWXEPPMSRWVI¾IGXXLEXGSQTSRIRX3YVXIEQLEW been highly selective in providing the breeder a top group of well-conformed stallions whose progeny will be well received at the track and in the sales ring. Last year also marked a bittersweet landmark for one of the great sires of our time. While reaching 17 Grade 1 winners over his historic career in 2013, Unbridled’s Song passed away at the age of 20. Every person at Taylor Made has been touched by this amazing animal over the years. He leaves a lasting legacy that will never be forgotten across the industry he served so well. And yet there is much to look forward to in 2014. The legacy continues with our newest stallion, Graydar, the Grade 1-winning son of Unbridled’s Song. One of the most stunning physicals to come to the breeding shed in years, Graydar had a brilliant VEGIGEVIIVMRGPYHMRKEGSQQERHMRKZMGXSV]MRXLI(SRR,ERHMGET + EX+YPJWXVIEQ4EVO;IEVIGSR½HIRXLI[MPPFI a favorite among breeders as Taylor Made Stallions adds another chapter to its storied tradition.
    [Show full text]
  • 3Rd Running of Awesome Again Stakes Breeders' Cup
    î 3rd Running Of î Awesome Again Stakes Breeders' Cup "Win and You're In" Challenge Race $300,000 Guaranteed (Grade I) FOR THREE-YEAR-OLDS AND UPWARD By subscription of $50 each if made on or before Saturday, August 23 or $300 each if made on or before Thursday, September 18, 2014 or by supplementary nomination of $6,000 at time of entry. All horses shall pay $4,500 additional to start, with $300,000 guaranteed. The winner to receive $180,000 PLUS $100,000 in Breeders' Cup entry fees, $60,000 to second, $36,000 to third, $18,000 to fourth and $6,000 to fifth. Three-Year-Olds: 121 lbs. Older: 124 lbs. Non-winners of a Grade I at One Mile or Over Since March 27, allowed 3 lbs. Non-winners of a Grade I at One Mile of Over OR Two Grade II races at One Mile or Over since September 27, 2013, 5 lbs. Highweights preferred, followed by Graded Stake Winners within 18 months of race, followed by Graded Stakes placed horses within 18 months of race, followed by highest earners within 12 months of race. *The Awesome Again Stakes has been selected as one of the Breeders' Cup "Win and You're In" Challenge Races. The nominated winner of the Awesome Again Stakes will be entitled to automatic entry into the 2014 running of the Breeders' Cup Classic division. The nominated winner will be entitled to have pre-entry and entry fees waived for the Championship race, and will be entitled to receive a travel stipend if traveling from a base located outside the state of California.
    [Show full text]
  • 2020 Sunset Thomas (2020)
    TesioPower Rancho San Antonio 2020 Sunset Thomas (2020) Nearctic NEARCO 4 NORTHERN DANCER Lady Angela 14-c Natalma NATIVE DANCER 5 Vice Regent (1967) ALMAHMOUD 2 Menetrier Fair Copy 6-e Victoria Regina La Melodie 15 Victoriana Windfields 11 Deputy Minister (1979) Iribelle 10 Bunty Lawless Ladder 10 Bunty's Flight Mintwina 23-b Broomflight Deil 1-l Mint Copy (1970) Air Post 19-b Jabneh BIMELECH 1 Shakney Bellesoeur 2-n Grass Shack POLYNESIAN 14 Awesome Again (1994) Good Example 10-a NASRULLAH NEARCO 4 Red God Mumtaz Begum 9 Spring Run MENOW 8 Blushing Groom (1974) Boola Brook 8 Wild Risk Rialto 12 Runaway Bride Wild Violet 3 Aimee Tudor Minstrel 9 Primal Force (1987) Emali 22-d Raise A Native NATIVE DANCER 5 MR PROSPECTOR Raise You 8 Gold Digger Nashua 3 Prime Prospect (1978) Sequence 13-c Olden Times Relic 8 Square Generation Djenne 20-a Chavalon Count Turf 22 Trap Game (2014) Blue Eyes 1-c Intentionally Intent 8 In Reality My Recipe 5-j My Dear Girl Rough 'n Tumble 1 Relaunch (1976) Iltis 21-a The Axe II MAHMOUD 9 Foggy Note Blackball 1 Silver Song Royal Note 12 Cee's Tizzy (1987) Beadah 3 NORTHERN DANCER Nearctic 14 Lyphard Natalma 2 Goofed Court Martial 1 Tizly (1981) Barra II 17 Trevieres Worden II 13 Tizna Vamarie 4 Noris Licencioso 12-a Tizamazing (2002) Nizarda 9-g Bold Reasoning Boldnesian 4 SEATTLE SLEW Reason To Earn 1-k My Charmer Poker 1 Seattle Song (1981) Fair Charmer 13-c Prince Blessed PRINCEQUILLO 1 Incantation Dog Blessed 21-a Magic Spell Flushing II 14-f Cee's Song (1986) Subterranean 4 NORTHERN DANCER Nearctic 14 Nice
    [Show full text]
  • Top Beyer Speed Figures • 1993-2018
    TOP BEYER SPEED FIGURES • 1993-2018 2-year-olds, 1993 2-year-olds, 1996 Beyer Beyer No. Horse Track Dist Date No. Horse Track Dist Date 106 VALIANT NATURE HOL 8.5 12/19/1993 108 THISNEARLYWASMINE SA 6 10/23/1996 105 BROCCO HOL 8.5 12/19/1993 107 KELLY KIP SAR 6 07/26/1996 105 POLAR EXPEDITION AP 6 08/14/1993 106 IN EXCESSIVE BULL SA 6 10/23/1996 103 HOLY BULL BEL 7 09/18/1993 104 HOLZMEISTER HAW 8.5 11/17/1996 102 DEHERE BEL 7 09/18/1993 104 KELLY KIP BEL 5 06/21/1996 101 HOLY BULL MTH 5.5 08/14/1993 103 IN C C’S HONOR LRL 6 12/21/1996 100 FLYING SENSATION HOL 8.5 12/19/1993 102 DIXIE FLAG (F) AQU 6 11/24/1996 100 SARDULA (F) DMR 7 09/04/1993 101 CAPTAIN BODGIT LRL 9 11/02/1996 99 BLUMIN AFFAIR HOL 8.5 12/19/1993 101 GOLD CASE FG 6 12/30/1996 99 INDIVIDUAL STYLE HOL 7 11/26/1993 101 IN EXCESSIVE BULL HOL 7 11/10/1996 99 YOU AND I AQU 7 10/20/1993 101 IN EXCESSIVE BULL SA 6 10/05/1996 Champion 2-year-old male Dehere had one of the highest Beyer Speed 101 MUD ROUTE HOL 6.5 12/15/1996 Figures of the season, but Valiant Nature earned the highest when beating 101 ORDWAY BEL 8.5 10/05/1996 Breeders’ Cup Juvenile winner Brocco in the Hollywood Futurity.
    [Show full text]
  • Drosselmeyer First in Classic No One Saw This Coming
    SUNDAY, NOVEMBER 6, 2011 732-747-8060 $ TDN Home Page Click Here OH MY! DROSSELMEYER FIRST IN CLASSIC STARS GATHER AT FASIG-TIPTON Twelve months ago, there were tears in Mike Smith=s With the racing world still fired up over a fantastic two eyes after his desperate charge days of the Breeders= Cup World Championships, Fasig- aboard Zenyatta (Ire) (Street Cry Tipton aims to continue the momentum with its {Ire}) fell short in the GI Breeders= November Sale beginning this afternoon at 4 p.m. As Cup Classic. The Hall of Fame usual, the event can claim perhaps the world=s highest reinsman was breathless last night concentration of top-quality horseflesh over the span of just three or four hours. No fewer than 23 individual lots after his relentless ride got at the sale either produced a 2011 Breeders= Cup starter, Drosselmeyer (Distorted Humor) up were siblings of, or raced under the Twin Spires on Friday in time to deny the valiant Game On or Saturday themselves. "I'm fired up--I'm very excited,@ Dude (Awesome Again) in the Horsephotos Fasig-Tipton President Boyd Browning Jr. said when $5-million finale. AThe key to this asked about the 2011 book. AA consignor and I were horse is to keep him moving,@ said talking the other day, and they talked about how busy it Smith, who hadn=t been in Drosselmeyer=s irons since [has] been over the last 10 days. And I said, 'Hey, if you the pair won the 2010 GI Belmont S. AIf you put on the and are aren't fired up over [that], we need to go find brakes, it messes him up.
    [Show full text]