DOCSLIB.ORG

Global Journal of Human Social Science

Total Page：16

File Type：pdf, Size：1020Kb

Download full-text PDF Read full-text
Global Journal of Human Social Science Online ISSN : 2249-460X Print ISSN : 0975-587X DOI : 10.17406/GJHSS UltramontanismandCatholicModernism AHistoricalAnalysisofKalabaghDam TransformationofMuslimCivilization TheSituationofSlavery&SlaveTrade VOLUME20ISSUE2VERSION1.0 Global Journal of Human-Social Science: D History, Anthropology & Archaeology Global Journal of Human-Social Science: D History, Anthropology & Archaeology Volume 2 0Issue 2 (Ver. 1.0) Open Association of Research Society Global Journals Inc. *OREDO-RXUQDORI+XPDQ (A Delaware USA Incorporation with “Good Standing”; Reg. Number: 0423089) Social Sciences. 2020. Sponsors:Open Association of Research Society Open Scientific Standards $OOULJKWVUHVHUYHG 7KLVLVDVSHFLDOLVVXHSXEOLVKHGLQYHUVLRQ Publisher’s Headquarters office RI³*OREDO-RXUQDORI+XPDQ6RFLDO 6FLHQFHV´%\*OREDO-RXUQDOV,QF Global Journals ® Headquarters $OODUWLFOHVDUHRSHQDFFHVVDUWLFOHVGLVWULEXWHG XQGHU³*OREDO-RXUQDORI+XPDQ6RFLDO 945th Concord Streets, 6FLHQFHV´ Framingham Massachusetts Pin: 01701, 5HDGLQJ/LFHQVHZKLFKSHUPLWVUHVWULFWHGXVH United States of America (QWLUHFRQWHQWVDUHFRS\ULJKWE\RI³*OREDO -RXUQDORI+XPDQ6RFLDO6FLHQFHV´XQOHVV USA Toll Free: +001-888-839-7392 RWKHUZLVHQRWHGRQVSHFLILFDUWLFOHV USA Toll Free Fax: +001-888-839-7392 1RSDUWRIWKLVSXEOLFDWLRQPD\EHUHSURGXFHG Offset Typesetting RUWUDQVPLWWHGLQDQ\IRUPRUE\DQ\PHDQV HOHFWURQLFRUPHFKDQLFDOLQFOXGLQJ SKRWRFRS\UHFRUGLQJRUDQ\LQIRUPDWLRQ Glo bal Journals Incorporated VWRUDJHDQGUHWULHYDOV\VWHPZLWKRXWZULWWHQ 2nd, Lansdowne, Lansdowne Rd., Croydon-Surrey, SHUPLVVLRQ Pin: CR9 2ER, United Kingdom 7KHRSLQLRQVDQGVWDWHPHQWVPDGHLQWKLV ERRNDUHWKRVHRIWKHDXWKRUVFRQFHUQHG 8OWUDFXOWXUHKDVQRWYHULILHGDQGQHLWKHU Packaging & Continental Dispatching FRQILUPVQRUGHQLHVDQ\RIWKHIRUHJRLQJDQG QRZDUUDQW\RUILWQHVVLVLPSOLHG Global Journals Pvt Ltd (QJDJHZLWKWKHFRQWHQWVKHUHLQDW\RXURZQ E-3130 Sudama Nagar, Near Gopur Square, ULVN Indore, M.P., Pin:452009, India 7KHXVHRIWKLVMRXUQDODQGWKHWHUPVDQG FRQGLWLRQVIRURXUSURYLGLQJLQIRUPDWLRQLV JRYHUQHGE\RXU'LVFODLPHU7HUPVDQG Find a correspondence nodal officer near you &RQGLWLRQVDQG3ULYDF\3ROLF\JLYHQRQRXU ZHEVLWHKWWSJOREDOMRXUQDOVus WHUPVDQG FRQGLWLRQPHQXLG1463/ To find nodal officer of your country, please email us at [email protected] %\UHIHUULQJXVLQJUHDGLQJDQ\W\SHRI DVVRFLDWLRQUHIHUHQFLQJWKLVMRXUQDOWKLV VLJQLILHVDQG\RXDFNQRZOHGJHWKDW\RXKDYH eContacts UHDGWKHPDQGWKDW\RXDFFHSWDQGZLOOEH ERXQGE\WKHWHUPVWKHUHRI Press Inquiries: [email protected] $OOLQIRUPDWLRQMRXUQDOVWKLVMRXUQDO DFWLYLWLHVXQGHUWDNHQPDWHULDOVVHUYLFHVDQG Investor Inquiries: [email protected] RXUZHEVLWHWHUPVDQGFRQGLWLRQVSULYDF\ Technical Support: [email protected] SROLF\DQGWKLVMRXUQDOLVVXEMHFWWRFKDQJH DQ\WLPHZLWKRXWDQ\SULRUQRWLFH Media & Releases: [email protected] Incorporation No.: 0423089 License No.: 42125/022010/1186 Registration No.: 430374 Import-Export Code: 1109007027 Pricing (E xcluding Air Parcel Charges): Employer Identification Number (EIN): USA Tax ID: 98-0673427 Yearly Subscription (Personal & Institutional) 250 USD (B/W) & 350 USD (Color) Editorial Board Global Journal of Human-Social Science Dr. Heying Jenny Zhan Dr. Adrian Armstrong B.A., M.A., Ph.D. Sociology, University of Kansas, USA BSc Geography, LSE, 1970 Ph.D. Geography Department of Sociology Georgia State University, (Geomorphology) Kings College London 1980 Ordained United States Priest, Church of England 1988 Taunton, Somerset, United Kingdom Dr. Prasad V Bidarkota Dr. Gisela Steins Ph.D., Department of Economics Florida International Ph.D. Psychology, University of Bielefeld, Germany University United States Professor, General and Social Psychology, University of Duisburg-Essen, Germany Dr. Alis Puteh Dr. Stephen E. Haggerty Ph.D. (Edu.Policy) UUM Sintok, Kedah, Malaysia M.Ed Ph.D. Geology & Geophysics, University of London (Curr. & Inst.) University of Houston, United States Associate Professor University of Massachusetts, United States Dr. Bruce Cronin Dr. Helmut Digel B.A., M.A., Ph.D. in Political Science, Columbia Ph.D. University of Tbingen, Germany Honorary President University Professor, City College of New York, of German Athletic Federation (DLV), Germany United States Dr. Hamada Hassanein Dr. Tanyawat Khampa Ph.D, MA in Linguistics, BA & Education in English, Ph.d in Candidate (Social Development), MA. in Social Department of English, Faculty of Education, Mansoura Development, BS. in Sociology and Anthropology, University, Mansoura, Egypt Naresuan University, Thailand Dr. Asuncin Lpez-Varela Dr. Gomez-Piqueras, Pedro BA, MA (Hons), Ph.D. (Hons) Facultad de Filolog?a. Ph.D in Sport Sciences, University Castilla La Mancha, Universidad Complutense Madrid 29040 Madrid Spain Spain Dr. Faisal G. Khamis Dr. Mohammed Nasser Al-Suqri Ph.D in Statistics, Faculty of Economics & Ph.D., M.S., B.A in Library and Information Management, Administrative Sciences / AL-Zaytoonah University of Sultan Qaboos University, Oman Jordan, Jordan Dr. Giaime Berti Dr. Vesna Stankovic Pejnovic Ph.D. School of Economics and Management University Ph. D. Philosophy Zagreb, Croatia Rusveltova, Skopje of Florence, Italy Macedonia Dr. Valerie Zawilski Dr. Raymond K. H. Chan Associate Professor, Ph.D., University of Toronto MA - Ph.D., Sociology, University of Essex, UK Associate Ontario Institute for Studies in Education, Canada Professor City University of Hong Kong, China Dr. Edward C. Hoang Dr. Tao Yang Ph.D., Department of Economics, University of Ohio State University M.S. Kansas State University B.E. Colorado United States Zhejiang University, China Dr. Intakhab Alam Khan Mr. Rahul Bhanubhai Chauhan Ph.D. in Doctorate of Philosophy in Education, King B.com., M.com., MBA, PhD (Pursuing), Assistant Professor, Abdul Aziz University, Saudi Arabia Parul Institute of Business Administration, Parul University, Baroda, India Dr. Kaneko Mamoru Dr. Rita Mano Ph.D., Tokyo Institute of Technology Structural Ph.D. Rand Corporation and University of California, Los Engineering Faculty of Political Science and Economics, Angeles, USA Dep. of Human Services, University of Haifa Waseda University, Tokyo, Japan Israel Dr. Joaquin Linne Dr. Cosimo Magazzino Ph. D in Social Sciences, University of Buenos Aires, Aggregate Professor, Roma Tre University Rome, 00145, Argentina Italy Dr. Hugo Nami Dr. S.R. Adlin Asha Johnson Ph.D.in Anthropological Sciences, Universidad of Ph.D, M. Phil., M. A., B. A in English Literature, Bharathiar Buenos Aires, Argentina, University of Buenos Aires, University, Coimbatore, India Argentina Dr. Luisa dall’Acqua Dr. Thierry Feuillet Ph.D. in Sociology (Decisional Risk sector), Master MU2, Ph.D in Geomorphology, Master’s Degree in College Teacher, in Philosophy (Italy), Edu-Research Geomorphology, University of Nantes, France Group, Zrich/Lugano Contents of the Issue i. Copyright Notice ii. Editorial Board Members iii. Chief Author and Dean iv. Contents of the Issue 1. Ultramontanism and Catholic Modernism: An Analysis of Political- Ecclesiastic Controversy in Germany of the 19th Century. 1-16 2. Transformation of Muslim Civilization from Devoted Believer to Despotic: A Study of Islamic History after Prophet Muhammed’s Death. 17-20 3. Some Water Mass Activities within the Gulf of Gurnea: The Situation of Slavery and Slave Trade and Sea Piracy from the Nineteenth to the Twenty First Centuries (Part One). 21-32 4. Water Crisis in Pakistan: A Historical Analysis of Kalabagh Dam. 33-39 v. Fe llows vi. Auxiliary Memberships vii. Preferred Author Guidelines viii. Index Global Journal of HUMAN-SOCIAL SCIENCE: D History, Archaeology & Anthropology Volume 20 Issue 2 Version 1.0 Year 2020 Type: Double Blind Peer Reviewed International Research Journal Publisher: Global Journals Online ISSN: 2249-460x & Print ISSN: 0975-587X Ultramontanism and Catholic Modernism: An Analysis of Political- Ecclesiastic Controversy in Germany of the 19th Century By Robson Rodrigues Gomes Filho & Felipe Monteiro Pereira De Araújo Universidade Estadual de Goi ás Abstract- The purpose of this paper is to analyze the roots of Catholic modernism in Germany from previous intellectual and theological movements, such as Catholic Enlightenment. Therfore, this paper analyzes the internal and external conflicts of the Catholic Church in Germany during the process of consolidation of modernity, in the 19th century, until culminating in the modernist movement and its consequences in the beginning of the 20th century. Keywords: modernism, catholic church, ultramontanism. GJHSS-D Classification: FOR Code: 220208p UltramontanismandCatholicModernismAnAnalysisofPoliticalEcclesiasticControversyinGermanyofthe19thCentury Strictly as per the compliance and regulations of: © 2020. Robson Rodrigues Gomes Filho & Felipe Monteiro Pereira De Araújo. This is a research/review paper, distributed under the terms of the Creative Commons Attribution-Noncommercial 3.0 Unported License http://creativecommons.org/licenses/by- nc/3.0/), permitting all non-commercial use, distribution, and reproduction in any medium, provided the original work is properly cited. Ultramontanism and Catholic Modernism: An Analysis of Political-Ecclesiastic Controversy in Germany of the 19th Century α σ Robson Rodrigues Gomes Filho & Felipe Monteiro Pereira De Araújo Abstract - The purpose of this paper is to analyze the roots of consolidation of modernity, in the 19th century, until Catholic modernism in Germany from previous intellectual and culminating in the modernist movement and its theological movements, such as Catholic Enlightenment. consequences in the beginning of the 20th century.
Load more

Recommended publications
  • Travel Light Or You May Have to Cough up a Bomb for Every Extra Kg in Your
    millenniumpost.in RNI NO.: DELENG/2005/15351 REGD. NO.: DL(S)-01/3420/2018-20 millenniumPUBLISHED FROM DELHI & KOLKATA VOL.13, ISSUE 174 | Sunday, 24 June, 2018 | New Delhi | Pages 16 | Rs 3.00 post NO HALF TRUTHS CITY PAGE 3 NATION PAGE 4 FILM PAGE 16 PROTEST AGAINST TREE FELLING ‘CHILDREN OF WORLD MUST BE ‘GLAD I TOOK IN SAROJINI NAGAR TODAY TAUGHT ABOUT NON-VIOLENCE’ RISKS’ India summons Pak’s BELGIUM, MEXICO deputy HC over denial of access to pilgrims MPOST BUREAU VIRTUALLY THROUGH NEW DELHI: India on Sat- urday summoned Pakistan’s Deputy High Commissioner Red Devils thrash Tunisia 5-2; Mexico pip South Korea here and lodged a strong pro- test over the denial of access to its envoy in Islamabad and con- MOSCOW: Two goals each cal chance of making it on sular officials to visit Gurdwara for Romelu Lukaku and Eden through three points. Panja Sahib and meet visiting Hazard and one for Michy Belgium was much the Indian pilgrims. Batshuayi swept Belgium to better team from the off, It was conveyed to the Pak- a 5-2 victory over Tunisia looking dangerous on almost istan side that preventing the support to secessionist move- on Saturday that put them every attack, but they were Indian High Commission offi- ments in India and incite the in command of World Cup seriously aided and abetted cials from discharging their Indian pilgrims, and Pakistan Group G and underlined by some ragged defending consular responsibilities vio- authorities asked to ensure that their status as one of the tour- and non-existing marking lated the Vienna Convention no such activity is carried out nament favourites.
    [Show full text]
  • Hindu-Muslim Relationship in Bollywood in Post 26/11: a Content Analysis of Movies (2008-2018) Maziar Mozaffari Falarti,1 Hamideh Molaei,2 Asra Karim3
    Hindu-Muslim Relationship in Bollywood in post 26/11: A Content Analysis of Movies (2008-2018) Maziar Mozaffari Falarti,1 Hamideh Molaei,2 Asra Karim3 1. Assistant Professor of South, East Asia and Oceania Studies, University of Tehran, Tehran, Iran (Corresponding author) ([email protected]) 2. Assistant Professor of South, East Asia and Oceania Studies, University of Tehran, Tehran, Iran ([email protected]) 3. M. A. in Indian Studies, University of Tehran, Tehran, Iran ([email protected]) (Received: Jan. 2, 2019 Revised: Feb. 28, 2019 Accepted: Ma r. 28, 2019) Abstract This study investigates the representations of Hindu-Muslim relationship in Bollywood movies from 2008 to 2018. It is assumed that after 2008 Mumbai terrorist attacks, which are known as 26/11, conflicts between Hindus and Muslims have escalated. Since Indian people are extreme fans of movies, especially Bollywood movies, in this regard, it is expected that media could play a significant role in increasing or alleviating the conflicts by influencing people’s attitudes and opinions. This research seeks to examine the extent and modality of the representation of Hindu-Muslim relationships in Bollywood after the 2008 Mumbai attacks. The study was conducted through a content analysis of 11 Bollywood movies, which were selected from 70 Muslim-characters-based movies. Favorable, unfavorable, neutral and unclear were the four factors through which the movies’ contents were analyzed. The overall analysis of these factors indicate that 66.17% of the scenes were favorable, 14.70% were unfavorable, 2.94% were neutral, and 16.17% presented unclear images of Hindu-Muslim relationship in Bollywood movies.
    [Show full text]
  • A STAR That Shines, Quite and Bright
    The Dirty Picture was the first movie that he released Pan India, and the movie eventually was a block buster paving the way for a line of super hits A star THat SHINES, to follow, like Lage Raho Munna Bhai, Rang de Basanti, Don, Taare Zameen QUITE AND BRIGHT Par, Jodhaa Akbar , Ghajini, My Name is Khan, No One Killed Jessica, Agneepath, Ashiqui-2, Student of the Year, Ek Villain , Bahubali, Raaes, Raazi and many more. Recently, Anil Anil Thadani, founder of AA films, the disliked them. Thadani’s AA Films had also teamed largest single owner film distribution He started his journey by distributing up with Dhanush’s Wunderbar Films company in India which has released films made under Yash Raj Films and Lyca Productions to release films across a range of languages banner, the first film he distributed Superstar Rajinikanth’s Kaala in North such as Hindi, English, Telugu, was “Yeh Dillagi” and soon after India. Marathi and Tamil. He was born and he distributed “Dilwale Dulhania After his marriage to Bollywood diva brought up in suburbs of Mumbai. He Le Jayenge” which rewrote history RaveenaTandon – ever since he has loves spending quality time with his as one of the biggest blockbuster been a doting father to four lovely kids wife, parents and kids. of Bollywood. Over the years since and of course the most caring and A completely filmy guy, who now 1993 he has won credibility and has loving husband. A disciplined family really enjoys watching every single single handedly made AA films, one man that Anil is – even with his busy movie but there was a time when of the largest and most trusted house professional commitments, he had movies used to disturb him and he of distribution and exhibition.
    [Show full text]
  • Raazi V10 22-7-17 Clean
    DHARMA PRODUCTIONS JUNGLEE PICTURES DIRECTED BY MEGHNA GULZAR SCREENPLAY BHAVANI IYER & MEGHNA GULZAR DIALOGUE MEGHNA GULZAR BASED ON THE NOVEL “CALLING SEHMAT” BY HARINDER S SIKKA © Meghna Gulzar 2017 FADE IN: 1 INT. PAK ARMY HQ - SITUATION ROOM - EVENING Title Card: February 1971. Pakistan. A series of pictures, black-and-white, low exposure but clearly outlining two figures and faces that are in deep conversation are seen on an old fashioned projector screen. Uniformed top brass from all the defense services (Army, Navy and Air Force) and Pakistan’s Intelligence sit around a table, being briefed by BRIGADIER SYED (57), tall hard-eyed with a striking military bearing in his uniform. The meeting is already in session. Syed clicks a button to zoom in on one of the men in the projected photograph. SYED Bangaal mein aazaadi ki tehreek zor pakad rahi hai. Vahaan Awami League ki khufiya Military Council ke rehnuma ye shakhs hain – Colonel Usmani. Lt. GENERAL AMIR BEIG (68), grey-haired with cold eyes looks at the image. BEIG Election bhi jeet chuke hain. Inki neeyat kya hai? The other senior leaders at the table murmur similarly. SYED Mujibur Rahman ne apne saath kuchh aise log jama kar liye hain, jo ab apne-aap ko Mukti fauj kehlate hain... (looks around) Mukti - aazaadi.. Sniggers around the room. Syed clicks for the picture to zoom in to the other face, only partially seen. SYED (CONT’D) Aur ye shakhs hai Khalid Mir... Iski padtaal rakhna bahaut zaroori hai. Ye Hindustan ke Intelligence ke bade afsar hain... Murmurs around the room.
    [Show full text]
  • Film Tourism in India – a Beginning Towards Unlocking Its Potential
    Film tourism in India – a beginning towards unlocking its potential FICCI Shoot at Site 2019 13 March 2019 Film tourism is a growing phenomenon worldwide, fueled by both the growth of the entertainment industry and the increase in international travel. Film tourism sector has seen tremendous growth in the past few years. It represents a gateway to new and more intense ways of experiencing destinations. At the same time, it creates the potential for new communities by way of an exchange of insights, knowledge and experience among the tourists themselves. Films play a significant role in the promotion of tourism in various countries and different states of India. A film tourist is attracted by the first-hand experience of the location captured on the silver screen. Not only is film tourism an excellent vehicle for destination marketing, it also presents new product development opportunities, such as location tours, film museums, exhibitions and the theme of existing tourist attractions with a film connection. This report focusses on the concept of film tourism and the various initiatives taken by both the state and central government of India for boosting film induced tourism through their respective film production policies. Dilip Chenoy Secretary General - Federation of Indian Chamber of Commerce and Industry Foreword The significance of cinema in today’s times has gone beyond its intended purpose of mass entertainment. Cinema is a portal for people to escape from reality and into their world of fantasy. Cinema is a source of inspiration for some, a source of entertainment for some and a source of education for some.
    [Show full text]
  • THE BUCHAREST UNIVERSITY of ECONOMIC STUDIES The
    THE BUCHAREST UNIVERSITY OF ECONOMIC STUDIES The Faculty of International Business and Economics The Department of Modern Languages and Business Communication of ASE Iuliu Hațieganu University of Medicine and Pharmacy Cluj- Napoca 7th International Conference: Synergies in Communication Bucharest, Romania, 22 - 23 November 2018 BEHIND THE SCREENS: A STUDY OF THE FILMS OF THREE INDIAN WOMEN DIRECTORS Minouti NAIK1 Abstract Indian films, even after 76 years of independence and 105 years of Indian Cinema, are a predominantly male domain. The percentage of women film makers, in the industry, is a mere 9.1%. Despite this, the films directed by women have compelled audiences to take notice, because of the wide spectrum of issues they have touched upon. Three women directors, whose movies have left an indelible mark on the audiences, include Tanuja Chandra, Meghna Gulzar and Gauri Shinde. This paper analyses the work of these three women directors, for the uniqueness of their themes and the characters they have sketched, and attempts to find out, what has led to their films being etched deeply, into the consciousness of their audience. This will be analysed against the backdrop of the realities of the society from which these films emerge, and as a reflection of the gender dynamics existing in Indian society. Keywords: Indian cinema, women, themes, characters, uniqueness 1. Introduction Men have sight, women insight. - Victor Hugo Victor Hugo‟s observation, penned down in his memoirs, might be an apt point to begin with, when one reflects upon films made by Indian women filmmakers. Despite films forming a very important facet of the Indian society and the fact that India completed 105 years of cinema, this year, the number of women making films in India is very small.
    [Show full text]
  • Bibelspråk Og Nasjonalspråk
    Bibelspråk og nasjonalspråk Bibelspråk og nasjonalspråk Redigert av Helge Omdal Emneord: Skriftserien nr. 140e 1. Bibelspråk 2. Nasjonalspråk 124 s. 3. Skriftspråk Pris: 140,- NOK 4. Skriftspråksetablering ISSN: 1504-9299 (elektronisk) ISBN: 978-82-7117-624-2 (elektronisk) Høgskolen i Agder, 2007 Serviceboks 422, N-4604 Kristiansand S. Design: Høgskolen i Agder Innhold: Forord .................................................................................................................. 7 Barbara Franz: Bibelen på tysk før og etter Martin Luther ................................. 11 Arne Torp: Et norsk bibelspråk på 1500-tallet? Et kontrafaktisk tankeeksperiment med to praktiske demonstrasjoner .............................. 27 Anne Karin Ro: Fra martyr til feminist: Viktige perioder i engelsk bibeloversettelse ca. 600–ca. 2000 ........................................................... 47 Jarle Bondevik: Framvoksteren av det nynorske bibelspråket og seinare utviklingstendensar ................................................................. 75 Tor Vegge: Retorikk og stil i det greske nytestamentet og i nyare norske bibelomsetjingar ................................................................ 89 Helge Omdal: En «flytende» språktilstand. Om framveksten av moderne norsk – uten feste i bibelspråket ................................................ 103 Forord Bibelspråket har spilt en avgjørende rolle for etableringa av eget nasjonalspråk i mange land. Etter reformasjonen oppstod et behov for å formidle Bibelens ord på folkets eget
    [Show full text]
  • Declaration by the Candidate
    DECLARATION BY THE CANDIDATE I hereby declare that the dissertation entitled “Objectification and commodification of women in the visual media: A critical study” submitted at National Law University, Delhi is the outcome of my own work carried out under the supervision of Dr. Sushila, Assistant Professor (Law), National Law University, Delhi. I further declare that to the best of my knowledge, the dissertation does not contain any part of my work, which has been submitted for the award of any degree either in this University or in any other institution without proper citation. Vighnesh Balaji 27/ LLM /18 Place: New Delhi National Law University, Delhi Date: 23.05.19 I CERTIFICATE OF SUPERVISOR This is to certify that the work reported in the LL.M. dissertation titled “Objectification and Commodification of Women in the Visual Media: A Critical Study” submitted by Vighnesh Balaji at National Law University, Delhi is a bona fide record of his original work carried out under my supervision. Dr. Sushila Assistant Professor (Law) Place: New Delhi National Law University, Delhi Date: 23.05.19 II ACKNOWLEDGMENT First, and foremost I would like to thank my wonderful supervisor Dr. Sushila who has always believed in me and has provided me insightful suggestions and has been a constant pillar of support throughout the dissertation period. My father, for always trying to balance me, My sisters, for holding my back, my friends, to whom I owe the world, NLU-Delhi for teaching me much more than the prescribed syllabus. Last but never the least; I thank Lord Shiva with all my heart for my unconditional mother, Suseela Ravichandran who has always firmly believed that the odds have to favour me.
    [Show full text]
  • The Past; Preparing for the Future
    Vol. 5 No. 08 New York August 2020 Sanya Madalsa Malhotra Sharma breakout Angel face with talent a spunky spirit Janhvi Priyanka Kapoor Abhishek chopra Jonas Navigating troubled Desi girl turns Bollywood Bachchan global icon Learning thefrom past Volume 5 - August 2020 Inside Copyright 2020 Bollywood Insider 50 Dhaval Roy Deepali Singh 56 18 www.instagram.com/BollywoodInsiderNY/ Scoops 12 SRK’s plastic act 40 leaves fans curious “I had a deeper connection with Kangana’s grading Exclusives Sushant” system returns to bite 50 Sanjana Sanghi 64 her Learning from past; preparing for future 06 Abhishek Bachchan “I feel like a newcomer” 56 Sushmita Sen From desi girl to a truly global icon 12 Priyanka Chopra Jonas Perspective Angel face with spunky spirit happy 18 Madalsa Sharma 32 Patriotic Films independence day “I couldn’t talk in front of Vidya Balan” 26 Sanya Malhotra 62 Actors on OTT 15TH AUGUST The privileged one 41 44 Janhvi Kapoor PREVIOUS ISSUES FOR ADVERTISEMENT July June May (516) 680-8037 [email protected] CLICK For FREE Subscription Bollywood Insider August 2020 LOWER YOUR PROPERTY TAXES Our fee 40 35%; others charge 50% NO REDUCTION NO FEE A. SINGH, Hicksville sign up for 2021 Serving Homeowners in Nassau County Varinder K Bhalla PropertyTax Former Commissioner, Nassau County ReductionGuru Assessment Review Commission CALL or whatsApp [email protected] 3 Patriotic Fervor Of Bollywood Stars iti Sunshine Bhalla, a young TV host in Williams during 2008 to 2011. In 2012, Shah New York, anchored India Independence Rukh Khan, Anushka Sharma and Sanjay Dutt R Day celebrations which were televised appeared on her show and shared their patriotic in India and 23 countries in Europe.
    [Show full text]
  • Films 2018.Xlsx
    List of feature films certified in 2018 Certified Type Of Film Certificate No. Title Language Certificate No. Certificate Date Duration/Le (Video/Digita Producer Name Production House Type ngth l/Celluloid) ARABIC ARABIC WITH 1 LITTLE GANDHI VFL/1/68/2018-MUM 13 June 2018 91.38 Video HOUSE OF FILM - U ENGLISH SUBTITLE Assamese SVF 1 AMAZON ADVENTURE Assamese DIL/2/5/2018-KOL 02 January 2018 140 Digital Ravi Sharma ENTERTAINMENT UA PVT. LTD. TRILOKINATH India Stories Media XHOIXOBOTE 2 Assamese DIL/2/20/2018-MUM 18 January 2018 93.04 Digital CHANDRABHAN & Entertainment Pvt UA DHEMALITE. MALHOTRA Ltd AM TELEVISION 3 LILAR PORA LEILALOI Assamese DIL/2/1/2018-GUW 30 January 2018 97.09 Digital Sanjive Narain UA PVT LTD. A.R. 4 NIJANOR GAAN Assamese DIL/1/1/2018-GUW 12 March 2018 155.1 Digital Haider Alam Azad U INTERNATIONAL Ravindra Singh ANHAD STUDIO 5 RAKTABEEZ Assamese DIL/2/3/2018-GUW 08 May 2018 127.23 Digital UA Rajawat PVT.LTD. ASSAMESE WITH Gopendra Mohan SHIVAM 6 KAANEEN DIL/1/3/2018-GUW 09 May 2018 135 Digital U ENGLISH SUBTITLES Das CREATION Ankita Das 7 TANDAB OF PANDAB Assamese DIL/1/4/2018-GUW 15 May 2018 150.41 Digital Arian Entertainment U Choudhury 8 KRODH Assamese DIL/3/1/2018-GUW 25 May 2018 100.36 Digital Manoj Baishya - A Ajay Vishnu Children's Film 9 HAPPY MOTHER'S DAY Assamese DIL/1/5/2018-GUW 08 June 2018 108.08 Digital U Chavan Society, India Ajay Vishnu Children's Film 10 GILLI GILLI ATTA Assamese DIL/1/6/2018-GUW 08 June 2018 85.17 Digital U Chavan Society, India SEEMA- THE UNTOLD ASSAMESE WITH AM TELEVISION 11 DIL/1/17/2018-GUW 25 June 2018 94.1 Digital Sanjive Narain U STORY ENGLISH SUBTITLES PVT LTD.
    [Show full text]
  • Nepotism in Film Industry: an Unending Debate
    ISSN 2455-4782 NEPOTISM IN FILM INDUSTRY: AN UNENDING DEBATE Authored by: Dr. Deepti Kohli * * Associate Professor, Vivekananda Institute of Professional Studies, Delhi ______________________________________________________________________________ ABSTRACT Nepotism is not a new issue in the society. It revives itself with the growth of film industry. It can be seen in politics as well. In the film industry it can be seen at the level of production, distribution, marketing etc. The disadvantage of it is that, it eliminates the talent and hard work from the work culture. It removes incentives for creativity. It has been seen as a boon for the star kids and bane for the struggling artists. Recently the death of the 34 year old actor has ignited the debate of nepotism through the social media activists. The paper attempts to study as to how far film industry has been the victim of nepotism and the loss suffered due to it. The paper also analyses the possible legal solutions to the problem of nepotism. Key words- Nepotism, film industry, star kids, film collection, production house, directors 14 | P a g e JOURNAL ON CONTEMPORARY ISSUES OF LAW [JCIL] VOLUME 6 ISSUE 6 ISSN 2455-4782 INTRODUCTION When professional decisions are hampered on the basis of personal relationships, nepotism can be said to have begun. The strong argument in its support is that when families run businesses, as a tradition, they want to carry it from generations to generations, and keep the profit in home which can be inherited by the family members alone. The term nepotism has been derived from Italian word nepotismo, which is based on Latin root nepos, which means nephew.1 There are various areas where nepotism exists, however, in this paper the nepotism is discussed in the light of film industry, commonly known as ‘Bollywood’.
    [Show full text]
  • Charlize Theron Says Golden Globes Ignoring Female Directors Is ‘Really Ridiculous’
    YOUR PAGE, YOUR STAGE! Community invites you to send your contributions with contact details and complete description of the images to [email protected]. Select images will appear in both the print edition as well as Community Instagram page @communitygt. — PHOTO ESSAY, Page 10 Friday, December 13, 2019 Rabia II 16, 1441 AH Doha today 190 - 260 COVER The snub STORY Charlize Theron says Golden Globes ignoring female directors is ‘really ridiculous’. P2-3 CUISINE SHOWBIZ A mainstream fast food Class war at Golden Globes, so choice in the Middle East. far the rich are winning. Page 6 Page 15 2 GULF TIMES Friday, December 13, 2019 COMMUNITY COVER STORY “It’s incredibly frustrating” PRAYER TIME Fajr 4.46am Shorooq (sunrise) 6.10am — Charlize Theron, ex-Oscar winner, on Zuhr (noon) 11.28am Asr (afternoon) 2.26pm Maghreb (sunset) 4.45pm lack of nomination for female directors Isha (night) 6.15pm USEFUL NUMBERS Emergency 999 Worldwide Emergency Number 112 Kahramaa – Electricity and Water 991 Local Directory 180 International Calls Enquires 150 Hamad International Airport 40106666 Labor Department 44508111, 44406537 Mowasalat Taxi 44588888 Qatar Airways 44496000 Hamad Medical Corporation 44392222, 44393333 Qatar General Electricity and Water Corporation 44845555, 44845464 Primary Health Care Corporation 44593333 44593363 Qatar Assistive Technology Centre 44594050 Qatar News Agency 44450205 44450333 Q-Post – General Postal Corporation 44464444 Humanitarian Services Offi ce (Single window facility for the repatriation of bodies) Ministry of Interior 40253371, 40253372, 40253369 Ministry of Health 40253370, 40253364 Hamad Medical Corporation 40253368, 40253365 Qatar Airways 40253374 ote Unquo Qu te “When it is obvious that the goals cannot be reached, don’t adjust the goals, adjust the action steps.” — Confucius It’s really hard, and I think it’s unfair, and it’s why we can’t stop this fight.
    [Show full text]