Hydrocarbon Exploration and Production Activities
India 2011-12
DGH
Directorate General of Hydrocarbons Under Ministry of Petroleum & Natural Gas, Govt. of India ea=kh isVªksfy;e ,oa izkÑfrd xSl ubZ fnYyh&110 001 ,l- t;iky jsM~Mh MINISTER S. Jaipal Reddy Petroleum & Natural Gas Government of India New Delhi-110 001
MESSAGE
With the ever increasing gap between the demand and supply in the Hydrocarbon sector, the scenario is a challenge for a country. The growing economy is bound to increase the demand for energy further and a good portion of this demand will have to be met by hydrocarbons. Despite increased exploration and production activities in the country by both national oil companies and private players, India depends on imported crude to meet 75% of its domestic demand.
In line with the Hydrocarbon Vision 2025, the main thrust of the activities for the upstream sector would be to focus on oil security, through intensification of exploration efforts and achievement of 100% coverage of unexplored sedimentary basins, in a time bound manner. The hydrocarbon sector is open and there is free and fair competition, between public sector enterprises, private companies and other international players. All acreages are awarded through International Competitive Bidding with no mandatory state participation.
To bridge the ever increasing supply and demand gap it is imperative to focus our attention also to the economic exploitation and commercialization of the unconventional Resources as well. The Directorate General of Hydrocarbons (DGH) plays a pivotal role in the country’s upstream hydrocarbon sector. Its role in attracting foreign investments in the E&P sector along with the effective monitoring of the activities of exploration and production deserves to be acknowledged and applauded.
This report on the “Hydrocarbon Exploration and Production Activities 2011-12” encapsulates the gist of the activities in this vital sector and highlights the performance of all the players involved in the quest for hydrocarbons in the country. I congratulate the DGH for intricately carrying out its duties and complement its staff for responsibly implementing the mandate given to them by the Government of India.
(S. Jaipal Reddy) jkT; ea=kh isVªksfy;e ,oa izkÑfrd xSl vkj-ih-,u- flag ubZ fnYyh&110001 R.P.N. Singh MINISTER OF STATE FOR Petroleum & Natural Gas Government of India New Delhi-110 001
MESSAGE
Increasing gap between demand and supply of oil & gas provides ample investment opportunities in the Indian hydrocarbon industry but is a growing concern for the Government of India.
The launch of New Exploration Licensing Policy (NELP), with an aim of encouraging private sector participation in the oil and gas sector, was effective in providing healthy professional competitiveness, with an influx of new technology and new ideas. The National Oil Companies along with the Private Companies / Joint Ventures have been successful in discovering hydrocarbons over the last decade. The NELP has so far facilitated Nine International Competitive bidding rounds inviting wider participation form major oil and gas companies. I look forward for aggressive exploitation of reserves, faster field developments from new discoveries and exploration through forthcoming NELP rounds for conventional resources, to meet future challenges of energy demand.
The report entitled “Hydrocarbon Exploration and Production Activities 2011-12” is a well detailed document to keep us abreast of the latest in the upstream hydrocarbon sector, particularly fields and exploratory blocks under Production Sharing Contracts (PSC) and Coal Bed Methane (CBM) fields. It acts as a ready referral for those keen to contribute in India’s endeavours for its energy security. I compliment Directorate General of Hydrocarbons (DGH) on this compilation and appreciate their efforts for the effective implementation of Government policies and efficient management of the country’s vital resources.
(R.P.N. Singh) Hkkjr ljdkj isVªksfy;e ,oa izkd`frd xSl ea=ky; 'kk=h Hkou] ubZ fnYYkh & 110001 miHkksDrk fiu dksM & 110115 Government of India Ministry of Petroleum & Natural Gas G.C. Chaturvedi, IAS Shastri Bhawan, New Delhi-110 001 Secretary Customer Pin Code - 110115
MESSAGE
Efficient, reliable and competitively priced energy supplies are prerequisites for accelerating economic growth. Affordable energy directly contributes to reducing poverty, increasing productivity and improving quality of life. For a developing country like ours, the strategy for energy development is an integral part of the overall economic strategy. Efficient use of resources and long-term sustainability remains core objective of economic planning. Hydrocarbons have been a major chunk of the energy basket globally, India being no exception. High oil and gas prices have prompted increased in level of investments in the exploration and production (E&P) sector, posing new challenges for the sector in the form of increased cost of operations due to high service costs, exposure to logistically difficult terrain and shortage of technical manpower. The Government is committed to mitigating these challenges and has, in fact, launched accelerated domestic exploration through its New Exploration Licensing Policy (NELP) policy initiative. Some of the world class oil discoveries have recently been reported from blocks offered under the NELP regime In years to come it is indicated that the share of gas in the energy basket would increase. Alternate Resources like Coal Bed Methane, Shale gas are also expected to contribute to the supply chain. The role of the Directorate General of Hydrocarbons therefore is extremely vital and productive. As the technical arm of the Ministry, critical inputs from DGH have been much appreciated and helped the Government take timely decisions to accelerate the exploration activities in the country. The team DGH has been consciously and efficiently playing the pivotal role in the hydrocarbon sector fulfilling the mandate given to them through the Cabinet Resolution of 1993. “Hydrocarbon Exploration and Production Activities 2011-12” is a well documented script which is eagerly awaited by all concerned. I am pleased to pen my thoughts for the readers of this useful document and wish DGH all the very best for this an all its future endeavours.
(G C Chaturvedi) Fr o m t h e Di r e c t o r Ge n e r a l ’s De s k
Exploration activity, prior to New Exploration and Licensing Policy (NELP), was dominated by public sector firms such as Oil and Natural Gas Corporation Ltd. (ONGC) and Oil India Ltd. (OIL). The discovery of massive Mumbai High fields in 1974 gave a major boost to the sector as these fields still continue to be the mainstay of India’s indigenous production. Realizing that these fields would gradually deplete over time and no major discoveries were being brought into production, the Government introduced the NELP, with the objective of encouraging private sector participation in the oil and gas sector. Increasing gap between demand and supply of oil & gas provides ample investment opportunities in the Indian hydrocarbon industry.
In line with the Hydrocarbon Vision 2025, in brief, the main thrust of the activities for the upstream sector would be:-
a) Focus on oil security through intensification of, exploration efforts and achievement of 100% coverage of unexplored basins in a time bound manner to enhance domestic availability of oil and gas.
b) Secure acreages in identified countries having high attractiveness for ensuring sustainable long term supplies.
c) open up the hydrocarbon market so that there is free and fair competition, between public sector enterprises, private companies and other international players.
The Directorate General of Hydrocarbons has been instrumental in achieving a lot during the 19 years of its existence in promoting exploration and sound management of the petroleum & natural gas resources as also non-conventional hydrocarbon energy resources, having regard for the environment, safety, technological and economic aspects. The organisation has lived up to its vision statement “To be an upstream advisory & technical regulatory body of international repute, creating value for society through proliferation & dissemination of E&P knowledge optimal hydrocarbon resources management & environment friendly practices.” The team of highly skilled technical staff has not only carried out to the mandate given by the Government of India, but has contributed immensely in attracting foreign investment in the Exploration & Production sector through the attractive fiscal benefits provided through the New Exploration Licensing Policy (NELP) launched in 1999 and the Coal Bed Methane(CBM) policy in 2001. The award of 249 Blocks under the Nine rounds of NELP and the 33 Blocks awarded under Four round of CBM has been upto 31.03.2012 instrumental in not only accelerating the exploration activities, but also in bringing ‘state of the art’ technology and a healthy competitive atmosphere in this sector. It is this platform that DGH could use to bring the number of E&P players up from the two National Oil Companies, viz. Oil India Limited and Oil & Natural Gas Corporation Ltd to 84 E&P players, comprising of 45 operators and 39 non operators, currently working in India.
The Government Policies have yielded desired results which can be seen in the form of 11 discoveries made under NELP in the year 2011-12 and the commercial production of 0.3 MMSCMD of CBM. Today, the country can boast of having E&P operations spread over 19 sedimentary basin out of 26 sedimentary basins of the country both on-land and offshore including deep waters. What is remarkable about the deep water operations in India is the fact that the exploration activities are largely dominated by the Indian companies.
It is still a long way to go. Out of 200 billion barrels of Oil & Oil equivalent gas prognosticated resources only 70 billion barrels have been converted to In Place volumes. A staggering 130 billion barrels are in 'yet to find' category.
In the search to discover these ‘yet to be found’ resources, DGH attempts to up-grade the country’s less explored basinal areas through enrichment of geo-scientific knowledge base using state of the art geo-scientific data acquisition either through speculative route or through its own funding and efforts. This has helped in carving out large acreages for systematic exploration for offer under NELP bidding rounds. It is this endeavour that has brought 2.15 million sq.kms out of the 3.14 million sq kms of basinal area within the ambit of exploration.
DGH is also responsible for exploration and development of other non conventional hydrocarbon energy resources like Gas Hydrates, Shale Oil and Shale Gas etc. With the global resources for the unconventional gas excluding gas hydrates touching the 32,560 TCF mark, these resources cannot be ignored.
“Hydrocarbon Exploration and Production Activities 2011-12” not only highlights the conventional hydrocarbon activities but gives a snap shot of what is happening in the unconventional hydrocarbon scene as well. I am confident that this annual fact-book would not only update the reader on the current E&P scenario in India but would be useful reference for all the stakeholders.
(R. N. Choubey) Director General DGH
SECTIONS PAGE NO. 1. PRELUDE 3 - DGH and its activities 4 - Contribution to Government Exchequer 7 - Sedimentary Basins of India 8
2. SYNOPSIS OF ACTIVITIES TILL 2011-12 11 - Award of acreages - Pre-NELP to NELP-IX 13 - Producing fields of Pvt./JV under PSC 32 - Geoscientific studies by DGH 33
3. ACTIVITIES DURING THE YEAR 2011-12 37 - E&P Highlights 39 - NELP-IX blocks awarded (till 31.03.12) 40 - Oil & Gas Production 41 - Hydrocarbon Discoveries 44
4. UNCONVENTIONAL HYDROCARBONS & OTHER ACTIVITIES 63 - Gas Hydrates 65 - Shale Oil & Gas 69 - Underground Coal Gasification 71 - Oil Shale 71 - Coal Bed Methane 72 - Recovery Enhancement Techniques implemented by NOC’s 74 - New Technology used / adopted 77 - Environmental Issues & CSR 81
5. SUPPLEMENTARY INFORMATION 85 - PEL & PML Details of the country 86 - Inplace reserves accretion, Oil/Gas Discoveries & Production trends 117 - Details of Oil & Gas discoveries in Pre-NELP & NELP 119 - Extracts from XIITH Five Year Plan 120 - Extracts from BP Statistical Review 2012 124 - Glossary of common Oil field Terms 128 - List of some companies in Indian E&P sector 139 DGH
2 INDIA - Hydrocarbon Exploration and Production Activities - 2011-12 DGH
PRELUDE
- DGH and its activities
- Contribution to Government Exchequer
- Sedimentary Basins of India PRELUDE
INDIA - Hydrocarbon Exploration and Production Activities - 2011-12 3 DGH
DGH - At a Glance
OBJECTIVE To promote sound management of the Indian petroleum and natural gas resources having a balanced regard to the environment, safety, technological and economic aspects of the petroleum activity.
ROLE AND FUNCTIONS
z Formed in 1993 by Govt. resolution.
z A nodal agency under Ministry of Petroleum & Natural Gas for implementation of NELP and CBM policy.
z An agency to advise Ministry of Petroleum & Natural Gas on Exploration strategies & Production Policies.
z To provide technical advice to the Ministry of Petroleum and Natural Gas on issues relevant to the exploration and optimal exploitation of hydrocarbons in the country.
z To review the exploration programmes of companies operating under Petroleum Exploration Licences granted under the Oilfields (Regulation and Development) Act, 1948 and the Petroleum and Natural Gas Rules, 1959 with a view to advising Government on the adequacy of these programmes.
z To evaluate the hydrocarbon reserves discovered and estimated by the operating companies. PRELUDE z To advise the Government on the offering of acreages for exploration to companies as well as matters relating to relinquishment of acreage by companies.
z To review the development plans for commercial discoveries of hydrocarbon reserves proposed by the operating companies and advise Government on the adequacy of such plans and the exploitation rates proposed and matters relating thereto.
z To review and audit concurrently the management of petroleum reservoirs by operating companies and advise on any mid course correction required to ensure sound reservoir management practices in line with the optimal exploitation of reserves and the conservation of petroleum resources.
z To regulate the preservation, unkeep and storage of data and samples pertaining to petroleum exploration, drilling, production of reservoirs etc. and to cause the preparation of data packages for acreage on offer to companies.
z All other matters incidental thereto and such other functions as may be assigned by Government from time to time.
z Assist Govt. in Contract management functions.
z Exploration & Development of unconventional hydrocarbon resources like Gas Hydrate, Shale gas/oil and oil shale.
4 INDIA - Hydrocarbon Exploration and Production Activities - 2011-12 DGH
ADVISORY & ADMINISTRATIVE COUNCIL OF DGH
In view of the need to establish an agency that could effectively supervise the activities of all E&P companies from the private & joint sectors in the national interest, Directorate General of Hydrocarbons was set up through GOI resolution No. O-20013/2/92/ONG-III, on 8th of April, 1993 under the administrative control of the Ministry of Petroleum and Natural Gas. The objective of DGH is to promote sound management of the Indian Petroleum and Natural Gas resources having a balanced regard for the environment, safety, technological and economic aspects of the petroleum activity.
The Directorate General has an Advisory Council, which has been appointed by Government on 31.05.1993 comprising a Chairman and members, who are eminent persons in the field of hydrocarbon exploration and production. The Advisory Council is serviced by the Directorate which will be headed by a Director General who is also the Member Secretary to the Council. In the year 2011-12, the composition of Advisory Council was :
S. No. Name Designation
1. Shri. P. Shankar Chairman PRELUDE
2. Dr. B. B. Bhattacharya Member
3. Dr. I. B. Singh Member
4. Dr. E. Desa Member
5. Director General, Directorate General of Hydrocarbons Member-Secretary
In order to guide and take care of all administrative aspects of the functioning of DGH, an Administrative Council has been set up by GOI through Office Memorandum No. O-32012/1/ 95-ONG-III dated 2.2.2001. The Administrative Council, in particular, takes decisions on various matters concerning establishment, budget and also undertakes periodical review of the functioning of DGH and submits the reports to Ministry. It is headed by Secretary (P&NG) and had the following composition in 2011-12 :
S. No. Name Designation 1. Secretary, MOPNG Chairman
2. Additional Secretary, MOPNG Member
3. AS&FA, MOPNG Member
4. JS(E), MOPNG Member
5. Secretary, OIDB Member
6. DG, Directorate General of Hydrocarbons Member-Convener
INDIA - Hydrocarbon Exploration and Production Activities - 2011-12 5 DGH
AWARD OF BLOCKS / FIELDS FOR EXPLORATION / / PRODUCTION OF OIL& GAS India has an estimated sedimentary area of 3.14 million sq km. comprising 26 sedimentary basins, out of which, 1.35 million sq km. area is in deepwater and 1.79 million sq km. area is in onland and shallow offshore. At present 0.93 million sq km. area is held under Petroleum Exploration Licenses in 19 basins by national oil companies viz. Oil and Natural Gas Corporation Limited (ONGC), OIL India Limited (OIL) and Private/Joint Venture companies. Before implementing the New Exploration Licensing Policy (NELP) in 1999, 11% of Indian sedimentary basins were under exploration, which has now increased significantly. There have been five different regimes in the matter of mining lease/ licenses for exploration/ production of oil and gas, namely: A) Petroleum Exploration License (PEL) and Petroleum Mining Lease (PML) granted to National Oil Companies [Oil and Natural Gas Corporation Ltd.(ONGC) and Oil India Ltd. (OIL)], on Nomination basis. B) Mining Licences granted under small / medium size discovered field PSCs, D) Petroleum Exploration License and Petroleum Mining Lease granted under Pre-NELP PSCs, and E) PEL and PML granted under the New Exploration Licensing Policy (NELP).
Pre- Nomination Independence Pre-NELP Era NELP Era Era Era
Imperial Monopoly State Monopoly De-regulation Begins E&P Business Liberalized Business restricted to Business restricted to Public •DGH established (1993) •NELP implemented PRELUDE British Companies Sector Upstream Oil • Some producing and •Nine NELP bid rounds Companies – ONGC (1956) exploratory blocks offered completed and OIL (1959) to national & international • 249 exploratory blocks Pvt. JVs awardedtoPvt.JVandPSUawarded to Pvt. JV and PSU after competitive bidding
z Under the first regime, exploration blocks were offered to national oil companies on nomination basis. These companies are required to pay full statutory levies viz. royalty to the state government/ central government for onland/offshore areas and cess to the central government. z Some of the small and marginal fields discovered by ONGC and OIL were offered to other parties for rapid development under three rounds of bidding during the year 1991 to 1993. In the PSCs relating to those fields, the rates of royalty and cess were frozen with a view to providing fiscal stability i.e. a stable tax regime to the contractors. z Prior to 1997, in the pre-NELP exploration blocks, the two national oil companies as licensees, were required to bear all the liability of statutory levies, but the exploration blocks were offered to various companies in order to attract private investments in exploration and production of oil. The private companies were selected through a bidding process during six round of bidding between 1993 to 1995. z The system of offering exploration blocks to various parties was modified in 1997 with the introduction of the NELP, under which the national oil companies and private players are treated at par and are required to compete with each other for acquiring exploration acreages under uniform contractual and fiscal framework. As regards PSCs entered into under NELP, the policy was announced by the government in 1997 and it became effective in 1999. Under NELP, the net revenue remaining after deduction of royalty and costs (i.e. pre-tax profit) is to be shared between the contractor and the government of India on the basis of an investment multiple system. The contractor is allowed full cost recovery on all costs incurred in an exploration block.
6 INDIA - Hydrocarbon Exploration and Production Activities - 2011-12 DGH
CONTRIBUTION TO GOVERNMENT EXCHEQUER
The following are earnings of Government of India from Profit Petroleum and Royalty.
Profit Petroleum During the Financial Year 2011-12, Profit Petroleum of US $ 1507.13 Million was contributed to Government Exchequer. The cumulative Profit Petroleum earned as on 31st. March 2012 is US $ 8687.64 Million.
9000 8688 Annual Cumulative
8000
7181 7000 6380
6000 5209
5000 llion)
3983 4000 US $ (in Mi 2986 3000 2206
2000 PRELUDE 1507 1289 1226 1171 917 997 1000 749 781 801 428 540 230 321 99 99 131 198 0 2000-01 2001-02 2002-03 2003-04 2004-05 2005-06 2006-07 2007-08 2008-09 2009-10 2010-11 2011-12
Royalty During the Financial Year 2011-12, Royalty paid to Central Exchequer was Rs. 4,725.39 crores. The cumulative Royalty contributed is Rs. 26,875.69 crores.
28000 26876
26000 Annual Cumulative 24000 22151 22000
20000
18000 17176
16000
rores) 13242
C 14000
12000 9952 INR (In 10000
8000 6425 6000 4975 4725 3934 3289 3527 4000 3136 3290 2303 2744 1001 1349 1771 2000 210 409 679 74 532 441 545 1 1 29 30 44 136 199 270 322 348 422 0 1994-95 1995-96 1996-97 1997-98 1998-99 1999-00 2000-01 2001-02 2002-03 2003-04 2004-05 2005-06 2006-07 2007-08 2008-09 2009-10 2010-11 2011-12
* Note: The royalty data of ONGC (nominated blocks) have been incorporated w.e.f. 2006-07.
INDIA - Hydrocarbon Exploration and Production Activities - 2011-12 7 DGH
SEDIMENTARY BASINS
z The sedimentary basins of India, onland and offshore up to the 200m isobath, have an areal extent of about 1.79 million sq. km. So far, 26 basins have been recognized and they have been divided into four categories based on their degree of prospectivity as presently known. In the deep waters beyond the 200m isobath, the sedimentary area has been estimated to be about 1.35 million sq. km. The total thus works out to 3.14 million sq. km.
z Since the launch of NELP, there have been significant forward steps in exploring the hydrocarbon potential of the sedimentary basins of India. Credit for this achievement goes in large measure to surveys carried out by DGH in unexplored/ poorly explored areas of the country including Deepwaters off west coast, east coast and in Andaman sea and accreages awarded for exploration under NELPs. Concerted efforts are continously being done to reduce the unexplored area further. PRELUDE
8 INDIA - Hydrocarbon Exploration and Production Activities - 2011-12 DGH
HISTORICAL CATEGORIZATION OF SEDIMENTARY BASINS Basinal Area (Sq. Km.)
Category* Basin Onland Offshore Total
UP TO 200M ISOBATH I Cambay 51,000 2,500 53,500 Assam Shelf 56,000 - - - - 56,000 Mumbai offshore - - - - 116,000 116,000 Krishna Godavari 28,000 24,000 52,000 Cauvery 25,000 30,000 55,000 Assam-Arakan Fold Belt 60,000 - - - - 60,000 Rajasthan 126,000 - - - - 126,000
SUB. TOTAL 346,000 172,500 518,500
II Kutch 35,000 13,000 48,000 Mahanadi-NEC 55,000 14,000 69,000 Andaman-Nicobar 6,000 41,000 47,000
SUB. TOTAL 96,000 68,000 164,000
III Himalayan Foreland 30,000 - - - - 30,000 Ganga 186,000 - - - - 186,000 Vindhyan 162,000 - - - - 162,000 Saurashtra 52,000 28,000 80,000 Kerala-Konkan-Lakshadweep - - - - 94,000 94,000 Bengal 57,000 32,000 89,000 PRELUDE
SUB. TOTAL 487,000 154,000 641,000
IV Karewa 3,700 - - - - 3,700 Spiti-Zanskar 22,000 - - - - 22,000 Satpura-South Rewa-Damodar 46,000 - - - - 46,000 Narmada 17,000 - - - - 17,000 Decan Syneclise 273,000 - - - - 273,000 Bhima-Kaladgi 8,500 - - - - 8,500 Cuddapah 39,000 - - - - 39,000 Pranhita-Godavari 15,000 - - - - 15,000 Bastar 5,000 - - - - 5,000 Chhattisgarh 32,000 - - - - 32,000
SUB. TOTAL 461,200 - - - - 461,200
TOTAL 1,390,200 394,500 1,784,700
DEEP WATERS Kori-Comorin 850 E ------1,350,000 Narcodam } GRAND TOTAL ------3,134,700
* `Categorization based on the prospectivity of the basin as presently known. The four recognized categories are basins which have : I Established commercial production II Known accumulation of hydrocarbons but no commercial production as yet III Indicated hydrocarbon shows that are considered geologically prospective IV Uncertain potential which may be prospective by analogy with similar basins in the world. This categorization will necessarily change with the results of further exploration.
INDIA - Hydrocarbon Exploration and Production Activities - 2011-12 9 DGH
SEDIMENTARY BASINAL AREAS
Moderate to 1995 - 96 Moderate to 1998 - 99 Well Explored Well Explored 0.498 0.498 Unexplored Unexplored 1.557 15% 15% 1.276 Poorly Poorly Explored Explored 41% 0.529 50% 0.529 17% 17%
18% 27%
Exploration Initiated Exploration Initiated 0.556 0.837
2004 - 05 2011 - 12 Moderate to Moderate to Well Explored Unexplored Well Explored Unexplored 0.598 0.698 0.687 0.374 12% 19% 22% 22% PRELUDE
22% 44% 37% 22% Poorly Poorly Explored Explored 0.695 0.689 Exploration Initiated Exploration Initiated 1.155 1.384
Total Sedimentary Area : 3.14 Million Sq. Km.
AREA (Million Sq.Km.) LEVEL OF EXPLORATION 1995-96 1998-99 2004-05 2011-12
UNEXPLORED 1.557 1.276 0.698 0.374
EXPLORATION INITIATED 0.556 0.837 1.155 1.384
POORLY EXPLORED 0.529 0.529 0.689 0.695
MODERATE TO WELL EXPLORED 0.498 0.498 0.598 0.687
10 INDIA - Hydrocarbon Exploration and Production Activities - 2011-12 SYNOPSIS OF ACTIVITIES TILL 2011-12 1111 DGH DGH INDIAINDIA - -ActivitiesActivities Hydrocarbon Exploration and Production Hydrocarbon Exploration and Production - - 2011-12 2011-12 SYNOPSIS OF ACTIVITIES TILL 2011-12 SYNOPSIS OF ACTIVITIES - Award of acreages - Pre-NELP to NELP-IX - Award of acreages Pvt./JV under PSC - Producing fields of by DGH - Geoscientific studies DGH
12 INDIA - Hydrocarbon Exploration and Production Activities - 2011-12 SYNOPSIS OF ACTIVITIES TILL 2011-12 13 DGH significantly boosted through this policy of Government through boosted significantly INDIA -Activities Hydrocarbon Exploration and Production - 2011-12
7 blocks in east coast deep water, 16 blocks in shallow water of east and west coasts and 1 onland. 17 and 1 onland. coasts and west of east water 16 blocks in shallow deep water, coast in east 7 blocks under operation. presently are blocks 7 exploration / surrendered. been relinquished have blocks been relinquished have and 7 onland. 18 blocks coasts, and west of both east 8 in the shallow water coast, under operation. presently are blocks 5 exploration / surrendered. has been and 8 onland. 9 blocks coasts, and west of both east of India, 6 in the shallow water coast east under operation. are 14 blocks and presently relinquished the for awarded were and Andamans. Blocks in Andaman offshore coast east coast, of the west water under operation. are blocks 17 and presently been relinquished 3 blocks has time. first In the first round of NELP (NELP-I), 24 blocks were awarded for hydrocarbon exploration, which include exploration, hydrocarbon for awarded were 24 blocks of NELP (NELP-I), round In the first the west off including 8 in the deep waters exploration for awarded were 23 blocks Under NELP-II, and the west off including 9 in the deep waters exploration for awarded were 23 blocks Under NELP-III, in onland and 10 in the deep are of which 10 blocks awarded, were of 20 blocks a total Under NELP-IV, Under NELP-V, a total of 20 blocks were awarded, of which 6 blocks in the deepwater, 2 in the shallow in the deepwater, of which 6 blocks awarded, were of 20 blocks a total Under NELP-V, in 6 blocks in deepwater, fall of which 21 blocks awarded were blocks of 52 a total Under NELP-VI, comprise blocks The offered 44 blocks. for received bids were blocks, offered out of 57 Under NELP-VII, water and 12 in onland. 6 blocks has been relinquished and presently 14 blocks are under operation. are 14 blocks and presently been relinquished and 12 in onland. 6 blocks has water under operation. presently are in onland. All 52 blocks fall blocks and 25 shallow water round. in this NELP awarded were 41 blocks and 29 onland blocks. 9 shallow offshore 19 deepwater,
¾ ¾ ¾ ¾ AWARD OF ACREAGES - NELP ACREAGES OF AWARD New Exploration Licensing Policy (NELP) was formulated by the Government of India, with Directorate General with Directorate of India, the Government by formulated was (NELP) Licensing Policy Exploration New Public and both field to playing a level provide to during 1997-98 a nodal agency, (DGH) as of Hydrocarbons commitment of India’s Government of hydrocarbons. and production in exploration companies sector Private the immediate in mind keeping been conceptualized which has in NELP, is reflected process the liberalization to NELP and production, in oil exploration investment attract more To production. domestic increasing for need private and Oil Companies National between spirit of competition a healthy towards steadily steered has and foreign in India. The sector oil the upstream of in the growth This has been a landmark event companies. of in the discovery Oil of National Companies the efforts supplement to invited are companies Indian private has been of E&P sector The development hydrocarbons. New Exploration Licensing Policy (NELP): Licensing Policy Exploration New companies the participating to offered are acreages 1999, in February operational which became Under NELP, of this open and transparent and conditions The terms bidding. of open global competitive the process through 1999 in the year was of blocks offer of amongst round the most in the world. The first attractive policy rank of of offer Nine rounds completed so far of India has 2010 . The Government in ninth round and the latest been awarded have and 249 blocks been offered have blocks in 360 exploration under NELP where acreages under NELP is approximately accretion reserve in place Gas (O+OEG) till 31.03.2012. Oil and Oil-Equivalent 735.7 million metric tonnes. of India, which brought major liberalization in the sector and opened up E&P for private and foreign investment, and foreign private up E&P for and opened in the sector major liberalization of India, which brought (FDI) is allowed. Investment Direct 100% Foreign where ¾ ¾ ¾ SYNOPSIS OF ACTIVITIES TILL 2011-12 14 DGH ¾ ¾ St a NI yrcro xlrto n rdcinAtvte 2011-12 - Hydrocarbon Exploration andProduction Activities - INDIA tus ofBlock EPI 4-21 4 - 53 - - 14* 249 - 6 32 12 41 111 3 9 52 20 18 13 58 23 2 20 17 23 25 12 23 11 80 24 7 10 - 8 6 2 7 8 360 1 11 - 34 6 21 TOTAL 6 8 70 NELP-IX 57 16 10 NELP-VIII 55 9 NELP-VII 20 8 NELP-VI 7 24 NELP-V 27 NELP-IV 25 NELP-III 48 Awarded NELP-II NELP-I Offered Round 8 typeSblocks. 14blocks were awarded inthisNELPround till31.03.2012. was 88,807 sq.km.Theoffered blocks comprise 8deepwater, 7shallowoffshore and19onlandincluding type Sblocks. 32blocks were awarded inthisNELPround. million sq.km.Theoffered blocks comprise 24deepwater, 28shallow offshore and18 onlandincluding under NELP, were onoffer for exploration ofhydrocarbon. Total area ofthese blocks was about0.163 Under NELP-IX, atotal of34blocks,were anoffer for exploration ofHydrocarbon. Total area offered Under NELP-VIII, atotal of70 blocks, whichare thehighest numberofexploration blocks ever offered s underNELP NELP-IX NELP-VIII NELP-VII NELP-VI 1993-2003 NELP-V NELP-IV SigningYear NELP-III 1993 NELP-II LaunchYear NELP-I PRE-NELP Round ae Water Water epSalwOln Total Onland Shallow Deep Chr onology ofNELPBidR 2010 2002 2007 2009 2006 2000 1999 2003 2005 ounds March 2012 Dec, 2008 Sep, 2005 Feb, 2003 Feb, 2004 Mar, 2007 Jun, 2010 Apr, 2000 Jul, 2001 eiqihdOperational Relinquished * Awarded till31.03.2012 196 14 41 14 14 32 52 17 5 7 SYNOPSIS OF ACTIVITIES TILL 2011-12 15 N60 07 05 14 14 52 AA-ONN-2004/5 41 14 32 Under 210 DGH N61 Operation AA-ONN-2004/2 Pt-A & AA-ONN-2004/1 14 D40 D19 D24 D34 N42 3 13 4 1 N49 24 23 23 2052 14 20 17 28 MZ-ONN-2004/1 41 14 32 PSC 277 AA-ONN-2004/4 MZ-ONN-2004/2 D33 (AS ON 01-04-2012)(AS ON 2 Signed N59 N41 D39 1 D-19 11 N32 N48
AA-ONN-2004/3
N40 12 N47 N39 D9 26 D7 D11 D8 Rounds NELP-VII NELP-I NELP-II NELP-III NELP-V NELP-VI NELP-IV PRE-NELP NELP-IX TOTAL NELP-VIII NEC-DWN-2004/2 NEC-DWN-2004/1 S28 N26 5 7 S27 2 S27 6 N25 3 5 MN-DWN-2004/5 D31 N16 S26 D32 6 N15 MN-DWN-2004/3 D38 D7 PA-ONN-2004/1 N14 MN-DWN-2004/1 N50 2004/4
MN-DWN- N24 D30 D6 KG-DWN-2004/6 N31 2004/2
D29 MN-DWN-
10 N23 D28 KG-DWN-2004/3
2004/7 D5 KG-DWN-
D-18 CY-PR-DWN-2004/2 2004/5 D-17 KG-DWN- N62 D6 D7 D24 D4 2004/2 KG-DWN- S8 S9 N13 S7 2004/4 2004/4 D3 KG-DWN- 2004/2 CY-DWN- N12 CY-DWN- D-16 2004/1 KG-OSN-2004/1 D2 KG-DWN- N38 11 10 N37 2004/1 2004/3 D37 D1 DWN- CY-DWN- 2004/1 CY-DWN- CY-PR- N27
KG-ONN-2004/1
N36 N11 S25 D21 D22 N17 D20 D23 N9 S24 N46 9 S23 S21 N69 SR-ONN-2004/1 S22 25 24 N10 9 S20 28 27 N56 N70 N55 KG-ONN-2004/2 N8 D19 29 PR-OSN-2004/1 S19 N22 INDIA -Activities Hydrocarbon Exploration and Production - 2011-12 CY-ONN-2004/2 CY-ONN-2004/1 N21 D18 S17 N20 10 N43 D17 N63 VN-ONN-2004/2 N34 N35 D16 DS-ONN-2004/1 D27 N7 28 BY NOC’S & Pvt/JV COMPANIES & Pvt/JV NOC’S BY N68 D26 15 N6 VN-ONN-2004/1 D-14 23 N51 N67 24 CB-ONN-2004/2 D15 N45 N5 25 CB-ONN-2004/3 N30 27 D-13 N54 13 D-15 D36 20 14 21 6 26 22 19 S8 S9 N53 N19 D35 19 N29 S9 18-A MB-OSN- 2004/1 17 2004/1 N66 N44 18 RJ-ONN-2004/1 17 18-B 15 N57 KK-DWN- 2004/2 18 N52 S5 S6 S2 11 MB-OSN- D12 D11 D-9 17 16 CB-OSN-2004/1 D14 CB-ONN-2004/4 D1 S5 12 S1 D-7 N65 D-8 N64 D-6 RJ-ONN-2004/2 15 14 16 N58 N18 S3 RJ-ONN-2004/3 16 20
4 N28 N33 N2 3 S2 N1 2004/1 GS-OSN- 2 D25 1 21 S1 GS-DWN-2000/2 PRE-NELP & NELP EXPLORATION BLOCKS UNDER OPERATION UNDER BLOCKS EXPLORATION & NELP PRE-NELP LEGEND GS-DWN-2000/1 NELP-IX NELP-VIII NELP-VII NELP-V NELP-VI NELP-III NELP-IV V TH ROUND V ROUND TH VI VII TH ROUND VIII TH ROUND JV ROUND NELP-I NELP-II IV TH ROUND TH IV Relinquished Area SYNOPSIS OF ACTIVITIES TILL 2011-12 16 2C BO/ 6 CB-OS/1 CB 12 SHALLOW WATER 11 10 AAPO-4114 AAP-ON-94/1 AA 9 KG-N421 GK-ON/4 GK 8 7 6 5 2K GO/ 5RIL(40)& TOIL(60) 25 KG-ON/1 24 23 KG 22 BC-N722 CB-ON/7 CB 4 3 5A AO/ 6OKLAND(100) 26 AA-ON/3 2 16 AA GK-OSJ/3 15 RELINQUISHED BLOCKS(13BLOCKS) GK 14 13 7G RO-414RIL(100) HEPI(75)&GAIL(25) 4 9 5 SR-OS-94/1 CY-OS/2 GS BB-OS/5 27 CY 26 MB 25 OKLAND(100) 20 ESSAR(75)&POGC(25) GK-ON-90/2 15 20 GK RJ-ON-90/5 19 18 RJ 17 L BASIN SL. JR-N9/ 17 RJ-ON-90/1 RJ 2 NO. 21 GG-N9/ 24 GN-ON-90/3 PG 1 ONLAND CURRENT ACTIVE BLOCKS(14BLOCKS) NOTE :*SUBJUDICE DGH NI yrcro xlrto n rdcinAtvte 2011-12 - Hydrocarbon Exploration andProduction Activities - INDIA Y-Cauvery KrishnaGodavari - HimalayanForeland - GangaValley - GujaratSaurashtra - GujaratKutch CY - Rajasthan KG - Cambay HF - Pranhita Godavari GV - AndamanNicobar GS - AssamArakan GK - RJ - CB PG AN AA AO-7 3CRL(65)& ACL(35) 13 AA-ON-07* AOJ211 AA-ONJ/2 RO-0112 CR-ON-90/1 GO-012 HARDY 27 KG-OS-90/1 BO/ 19 18 23 CB-ON/3 CB-ON/1 CB-ON/2 JO-042 EOL 28 RJ-ON-90/4 JO/ 16 RJ-ON/6 KO/ RIL(40),TOIL(50)&OKLAND(10) 3 GK-OS/5 GO/ 10 KG-OS/6 LC REF. NO BLOCK AEONMAP NAME BO/ 7 CB-OS/2 KOJ11 GK-OSJ/1 EXPLORATION BLOCKS AWARDED UNDERPRE-NELP ONGC(55.26) ONGC(100) HOEC(40.32), FEL(100) EOL 100% RIL(40), GSPC(80) HOEC( 50) FEL(10) RIL(60) ESSAR (79)&PETROMSA(21) CAIRN(50) &VIDIOCON(50) CEIL (35) OE(9,O(6,O(5&I(0 - PONEI(29),EOL(16),IOC(35)&OIL(20) CAIRN(40), RIL(50),TULLOW(25) &ONGC(25) OSRIMDT FAW DATE OF CONSORTIUM HOEC(75) (PARTICIPATING INTEREST) ,ONGC(25)& OIL(15) IL5) OL1)1-719 3055 1533 5857 7390 16-07-1998 TIOL(50)& OOHL(10) II(5 NC(5 00-9857 318 4026.2 1351.84 5378 30-06-1998 ,ISIL(65) &NOCL(25) , CEHL(35)&ONGC , GGR(20) & MIL(25) &GSPCL(50) ONGC(50)&TPL(10) , I(61)IC4.6 30-06-1998 OIL(16.12)&IOC(43.56) HOEC (38.07)& TPL(6.7) (30) OA RA:102 2398 40965.09 129359.88 170325 TOTAL AREA: CONTRACT 90-9913 65319 1615 1934 19-02-1999 20-0095 9150 9150 12-04-2000 00-9815 7 775 775 1550 30-06-1998 60-9850309 119.05 390.95 510 16-07-1998 50-9511108 15-05-1995 20-0011 4 866 844 1710 12-04-2000 90-9322075 21850 7350 29200 29-03-1993 60-015725 06-09-2001 71-0319 1 1277 318 1595 07-11-2003 91-9639 44846 2444 3290 19-11-1996 91-9651 5010 5010 19-11-1996 SIGNING Z-Mizoram Purnea - Palar - DeccanSyneclise - Vindhyan - Bengal MZ - SouthRewa PA KeralaKonkan - PR - Mahanadi-NEC DS - Mumbai VN - WB - SR KK MN MB ------RAAE AREA AREA AREA ARDED 60 16600 16600 63 16030 16030 12 11820 11820 003000 3000 703720 3720 502570 2570 005000 5000 104180 4180 059095 9095 758775 8775 251275 1275 3531 205 3110 3315 7 6 305 565 870 2 1.67.64 517.36 525 ( in ( EIQ PRESENT RELINQ. 967 3111.2 7996.73 sq.km) (As on01.04.2012) 5725 0 0 0 0 0 0 0 0 0 0 0 0 0 0 SYNOPSIS OF ACTIVITIES TILL 2011-12 17 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 DGH 0 7645 (As on 01.04.2012) (NELP-I) sq.km ) RELINQ. PRESENT ( in ARDED AREA AREA AREA SIGNING 12-04-2000 8980 4490 4490 12-04-2000 10810 4110 6700 12-04-2000 5740 5740 12-04-2000 10005 5017 4988 12-04-2000 1465 1465 12-04-200012-04-2000 19450 15910 19450 15910 12-04-200012-04-2000 2785 4940 2785 4940 12-04-2000 4790 4790 12-04-2000 2460 2460 12-04-2000 4020 4020 12-04-2000 9605 2410 7195 12-04-2000 5270 5270 12-04-2000 5740 5740 12-04-2000 18870 18870 12-04-2000 5040 5040 12-04-2000 5215 5215 12-04-2000 10425 10425 CONTRACT TOTAL AREA : AREA TOTAL 230147 182373 47774 INDIA -Activities Hydrocarbon Exploration and Production - 2011-12 ,CEIL(10),PIBBV(15) &,CEIL(10),PIBBV(15) 12-04-2000 & OIL(15) 9757 2462 7295 & PIB-BV(40) & BPEAL & BPEAL (30) , BPEAL (30) & NIKO(10) 12-04-2000 7645 , BPEAL(30) & NIKO(10) 12-04-2000 14535 5074 9461 (PARTICIPATING INTEREST) (PARTICIPATING CONSORTIUM OF DATE AW RIL(70) ONGC(65) HOEIBV(10) RIL(60) ONGC(85) RIL(70) CEEPC(15) ONGC(60) RIL(60) ONGC(55), BG(30) & OIL(15) 12-04-2000 9940 9940 RIL(100) NAME ON MAP BLOCK NO REF. KG-DWN-98/2 D2 KG-DWN-98/3 D3 KG-DWN-98/5 D5 MN-DWN-98/3 D7 KK-OSN-97/3 N-7 ONGC(100) MB-OSN-97/3 N-4 RIL(100) KG-OSN-97/4 N-10 KG-OSN-97/1 N-13 ONGC(100) MB-OSN-97/4 N-5 ONGC(70) & IOC(30) KG-OSN-97/2 N-12 RIL(100) KG-OSN-97/3 N-11 RIL(100) EXPLORATION BLOCKS AWARDED UNDER FIRST ROUND OF NELP NELP ROUND OF UNDER FIRST AWARDED BLOCKS EXPLORATION NO. SL. BASIN 1 KG KG-DWN-98/1 D1 CURRENT ACTIVE BLOCKS (7 BLOCKS) ACTIVE BLOCKS CURRENT WATER DEEP 2 3 4 5 MN MN-DWN-98/2 D6 20 21 22 SR23 GK SR-OSN-97/1 N-2 GK-OSN-97/1 N-1 RIL(100) RIL(100) 6 17 KK18 KK-OSN-97/219 N-6 MB RIL(100) MB-OSN-97/2 N-3 RIL(100) 24 GV GV-ONN-97/1 N-17 ONGC(40),IOC(30),CEIL(15) & 12-04-2000 36750 36750 7 MN NEC-OSN-97/2 N-15 SHALLOW WATER 9 MN MN-OSN-97/3 N-14 & GAIL(15) ONGC(85) 8 MN NEC-OSN-97/1 N-16 GAZPROM(100) RELINQUISHED BLOCKS (17 BLOCKS) 16 CY CY-OSN-97/2 N-8 OIL(100) 10 KG KG-DWN-98/4 D4 14 15 CY CY-OSN-97/1 N-9 & HOEC(80) Mosbacher(20) 11 13 12 SYNOPSIS OF ACTIVITIES TILL 2011-12 18 AA-N-001N32 AS-ONN-2000/1 AA 3 ONLAND 3R JON20/ 2 OIL60% SUNTERA40% N28 ONGC 85%,IOC15% RJ-ONN-2000/1 N27 GV-ONN-2000/1 RJ 23 GV N25 22 WB-OSN-2000/1 ONGC100% 21 WB N23 20 MN-OSN-2000/1 19 MN ONGC 18 17 D10 MB-DWN-2000/1 16 D8 MB 15 ONGC 100% GS-DWN-2000/1 14 N21 GS 13 CY-OSN-2000/1 12 CY 11 10 D12 9 KK-DWN-2000/1 8 KK 7 N29 6 CB-ONN-2000/1 RELINQUISHED BLOCKS(18BLOCKS) CB 5 4 NM-S-002N24 MN-OSN-2000/2 MN 2 S SON20/ 1 N18 GS-OSN-2000/1 GS 1 SHALLOW WATER CURRENT ACTIVE BLOCKS(5BLOCKS) L BASIN NO. SL. DGH EXPLORATION BLOCKS AWARDED UNDERSECONDROUNDOFNELP NI yrcro xlrto n rdcinAtvte 2011-12 - Hydrocarbon Exploration andProduction Activities - INDIA NON20/ 3 NC2% AL2% O 0,1-720 9070 0 7900 7900 17-07-2001 ONGC20%,GAILIOC N31 MN-ONN-2000/1 BON20/ 1 NC7% O 5,GP 0 70-011441440 18414 18414 17-07-2001 ONGC75%,IOC15%,GSPC 10% N19 MB-OSN-2000/1 ONGC100% N22 CY-OSN-2000/2 KON20/ 2 ONGC100% N20 KK-OSN-2000/1 BDN20/ 1 ONGC D11 MB-DWN-2000/2 KDN20/ 1 D15 KK-DWN-2000/4 D14 KK-DWN-2000/3 D13 KK-DWN-2000/2 N30 CB-ONN-2000/2 BON20/ N26 WB-ONN-2000/1 D9 GS-DWN-2000/2 LC REF. NO NAME BLOCK ON MAP IOC 20%,OIL20% RIL 90% ONGC 85%,IOC15% OIL 10%,GSPC10% ONGC 85%,GAIL15% ONGC 85%,IOC15% OIL 25%SUNTERA15% ONGC 100% RIL 100% ONGC 85%,GAIL15% RIL 100% NIKO 100% GSPC 60% ONGC 40% OSRIMDT FAW DATE OF (PARTICIPATING INTEREST) CONSORTIUM ONGC 100% RIL 90% 85%, IOC15% 0,GI1%IC1% 70-011161160 19106 19106 17-07-2001 50%, GAIL15%IOC15%, ,HARDY 10% ,HEPI 10% ,GAIL40% , GAIL20%, OA RA:278 5787 16154.25 251728.75 267883 TOTAL AREA: CONTRACT 70-0123 550 2535 2535 17-07-2001 0 5920 5920 17-07-2001 70-0133 500 3530 3530 17-07-2001 70-012502500 23500 23500 17-07-2001 70-0163 700 6730 6730 17-07-2001 70-011971970 13937 13937 17-07-2001 70-0155 5754 0 5754 17-07-2001 70-011151150 16125 16125 17-07-2001 70-0149347 24.25 394.75 419 17-07-2001 70-012192190 26149 26149 17-07-2001 70-0184 915890 2951 8841 17-07-2001 70-011891890 14889 14889 17-07-2001 70-011551550 12505 12505 17-07-2001 70-011851850 14825 14825 17-07-2001 70-011291290 11239 11239 17-07-2001 0 0 20998 18113 20998 17-07-2001 18113 17-07-2001 70-0160 700 6700 6700 17-07-2001 70-0112 9 425 999 1424 17-07-2001 70-0183 294061 4269 8330 17-07-2001 SIGNING RAAE AREA AREA AREA ARDED ( in in ( EIQ PRESENT RELINQ. sq.km)
(NELP-II) (As on01.04.2012) SYNOPSIS OF ACTIVITIES TILL 2011-12 19 DGH (As on 01.04.2012) (NELP-III) sq.km ) RELINQ. PRESENT ( in ARDED AREA AREA AREA SIGNING 04-02-2003 5340 1335 4005 04-02-2003 110 0 110 04-02-2003 31515 8000 23515 04-02-2003 8255 2100 6155 04-02-2003 8600 0 8600 04-02-2003 12425 12425 0 04-02-2003 3010 1514 1496 04-02-2003 27315 684704-02-2003 20468 10590 0 10590 04-02-2003 645 0 645 04-02-2003 14325 0 14325 04-02-2003 3175 1661.1304-02-2003 1513.88 14120 14120 0 04-02-2003 21775 21775 0 04-02-2003 6920 6920 0 04-02-2003 9468 9468 0 04-02-2003 8595 8595 0 04-02-2003 1100 1100 0 04-02-2003 210 210 0 CONTRACT TOTAL AREA : AREA TOTAL 204588 103914.13 100673.88 & IOC(20) & OIL(15%) ,CEIL(15) & CED(15) 04-02-2003 215 189 26 ,GGR(10) & JOGPL(10) 04-02-2003 1850 1320 530 INDIA -Activities Hydrocarbon Exploration and Production - 2011-12 BPEAL(30) & HEPI(10) 04-02-2003 11605 2910 8695 & BPEAL(30) & BPEAL(30) & BPEAL(30) & BPEAL(30) & BPEAL(30) & BPEAL (30) RIL(70) RIL(70) RIL(70) (PARTICIPATING INTEREST) (PARTICIPATING RIL(70) RIL(70) RIL(60), GSPC(80) CONSORTIUM OF DATE AW RIL(70) ONGC(100) ONGC(85) ONGC(80) ONGC(100) ONGC(70) ONGC(100) D18 ONGC(100) D19 ONGC(80) & OIL(20) ON MAP CY-PR-DWN-2001/3 D21 CY-PR-DWN-2001/4 D22 NAME KK-DWN-2001/1 D16 BLOCK NO REF. AA-ONN-2001/3 N41 AA-ONN-2001/2 N40 AA-ONN-2001/4 N42 KK-OSN-2001/2KK-OSN-2001/3 N34 ONGC(100) N35 ONGC(100) KG-OSN-2001/2 N37 RIL(100) EXPLORATION BLOCKS AWARDED UNDER THIRD ROUND OF NELP ROUND OF NELP THIRD UNDER AWARDED BLOCKS EXPLORATION 6 PR PR-DWN-2001/1 D23 8 KG KG-OSN-2001/3 N38 34 CY5 CY-DWN-2001/2 D20 7SHALLOW WATER KG KG-DWN-2001/1 D24 1 KK KK-DWN-2001/2 D17 DEEP WATER DEEP NO. (14 BLOCKS) ACTIVE BLOCKS CURRENT 2 9 AA AA-ONN-2001/1 N39 ONLAND SL. BASIN 10 11 12 13 CB CB-ONN-2001/1 N45 14 HF HF-ONN-2001/1 N43 15 KK KK-DWN-2001/3 RELINQUISHED BLOCKS (9 BLOCKS) 16 17 18 CY19 KG CY-DWN-2001/1 20 KG-OSN-2001/1 N36 RIL(100) 23 PG PG-ONN-2001/1 N46 ONGC(100) 21 GS22 GS-OSN-2001/1 RJ RJ-ONN-2001/1 N33 ONGC(100) N44 ONGC(30), OIL(40)&SUNTERA(30) 04-02-2003 3425 3425 0 SYNOPSIS OF ACTIVITIES TILL 2011-12 20 KK-W-022D26 KK-DWN-2002/2 KK 1 DEEP WATER CURRENT (17BLOCKS) ACTIVE BLOCKS NM-W-021D29 6 D28 MN-DWN-2002/1 5 MN KG-DWN-2002/1 4 KG 3 2 NA-W-021D33 AN-DWN-2002/1 AN 8 7 NO. 0R JON20/ 5 OIL(60) &ONGC(40) N51 RJ-ONN-2002/1 CEIL(50) &CESL(50) RJ N50 GS-DWN-2002/1 20 GS GV-ONN-2002/1 19 GV 18 N55 RELINQUISHED BLOCKS(3BLOCKS) CY-ONN-2002/1 17 CY 16 N52 15 CB-ONN-2002/1 14 CB 13 N47 12 AA-ONN-2002/1 11 AA 10 ONLAND 9 L BASIN SL. DGH EXPLORATION BLOCKS AWARDED UNDERFOURTHROUND OFNELP NI yrcro xlrto n rdcinAtvte 2011-12 - Hydrocarbon Exploration andProduction Activities - INDIA YON20/ N56 CY-ONN-2002/2 N54 N53 CB-ONN-2002/3 CB-ONN-2002/2 E-W-021D31 D30 NEC-DWN-2002/1 MN-DWN-2002/2 D27 KK-DWN-2002/3 AON20/ N49 AA-ONN-2002/4 E-W-022D32 NEC-DWN-2002/2 NAME AON20/ N48 AA-ONN-2002/3 D34 AN-DWN-2002/2 LC REF. NO BLOCK ON MAP 2 ONGC(100) D25 ONGC(80) RIL(60) ONGC(75) ONGC(80) BPCL-10 ONGC(36) ONGC(70) ONGC(100) (PARTICIPATING INTEREST) ONGC(100) OIL(30) ONGC(100) ONGC(60) JOGPL(30) GGR (10) GSPC(55) JOGPL(30) ONGC(70) ONGC(90) JOGPL(20) OSRIMDT FAW DATE OF CONSORTIUM BEL(0&HRY1)0-220 56 3119174 6391 25565 06-02-2004 ,BPEAL (30)&HARDY(10) &ONGC(70) EL2) PL1)&0-220 8 4. 39.8 245.2 285 06-02-2004 , JEPL(20),PPCL(15)& &HPCL(20) &BGEPIL(25) &HPCL(20) N(4,OL2)&0-220 9029 7483 2497 7950 2650 9980 06-02-2004 10600 , ENI(34),OIL(20)& 06-02-2004 , OIL(20)&BPCL(10) &BPRL(40) &OIL(10) & CEBGI(30) GI(0 SC2)0-220 8 7 505 175 680 93.40 06-02-2004 31.60 GAIL(50)&GSPC(20) 125 06-02-2004 , GSPC(60)&GGR(10) &GAIL(80) OA RA:121 02.0112487.00 80323.00 192810 TOTAL AREA: CONTRACT 60-041501500 15550 15550 06-02-2004 60-042010140 140 280 06-02-2004 60-042402400 21450 21450 06-02-2004 60-0428050 17107 5703 22810 06-02-2004 60-0429052 15682 5228 20910 06-02-2004 60-0490 900 9900 9900 06-02-2004 60-0414537 11586 3879 15465 06-02-2004 60-0419025.08238.80 2751.20 10990 06-02-2004 60-04145012495 0 12495 06-02-2004 60-0416 6 1095 365 1460 06-02-2004 60-04159 36 99 135 06-02-2004 60-0413024 8542 2848 11390 06-02-2004 60-0418 2 1260 420 1680 06-02-2004 60-0416 1060 0 1060 06-02-2004 SIGNING RAAE AREA AREA AREA ARDED ( in ( in EIQ PRESENT RELINQ. sq.km)
(NELP-IV) (As on01.04.2012) SYNOPSIS OF ACTIVITIES TILL 2011-12 21 0 0 0 0 0 0 DGH 0 13110 0 3288 0 9970 0 81 0 1335 0 17050 0 635 0 957 (As on 01.04.2012) (NELP-V) sq.km ) RELINQ. PRESENT ( in ARDED AREA AREA AREA SIGNING 23-09-2005 81 23-09-2005 9970 23-09-2005 2394 598.5 1795.5 23-09-2005 358523-09-2005 912 2673 635 23-09-2005 3155 789.25 2365.75 23-09-2005 957 23-09-2005 12285 12285 23-09-2005 18245 18245 23-09-2005 5970 5970 23-09-2005 275 275 CONTRACT TOTAL AREA : AREA TOTAL 115180 56253.59 58926.41 , GAIL(20), JSPL(20) & 23-09-2005 448 276 172 , JSPL(35), , ONGC(51) & CE4L(25) 23-09-2005 1697 435 1262 INDIA -Activities Hydrocarbon Exploration and Production - 2011-12 , ONGC(45) & GAIL(15%) 23-09-2005 13110 NIKO(15) & BPEAL(30) 23-09-2005 17050 , BIL(40) & XOH(50) 23-09-2005 13195 8962.84 4232.16 ,ONGC(36) & CE2L(30) 23-09-2005 1335 , BPEAL(30) & HEPI(10) 23-09-2005 3288 (PARTICIPATING INTEREST) (PARTICIPATING CONSORTIUM OF DATE AW RIL(60) RIL(55) ONGC(100) ENI (40) ONGC(100) FEL(10) RIL (100) GSPC(50) GGR(10) GGR(100) JOGP(10) GSPC(20) & GAIL(35) ONGC(100) ENI(34) CEIL(24) NR(V)L(100) RIL(100) Brownstone (15) D35 RIL(100) ON MAP NAME BLOCK NO REF. AN-DWN-2003/2 D40 KK-DWN-2003/2 D36 RJ-ONN-2003/2 N65 CB-ONN-2003/2 N67 AA-ONN-2003/3 N61 OIL(85) & HPCL(15) EXPLORATION BLOCKS AWARDED UNDER FIFTH ROUND OF NELP OF NELP FIFTH ROUND UNDER AWARDED BLOCKS EXPLORATION 1 KG KG-DWN-2003/1 D37 NO. ACTIVE BLOCKS (14 BLOCKS) CURRENT WATER DEEP 23 MN MN-DWN-2003/1 AN D38 AN-DWN-2003/1 D39 SL. BASIN 4 5 CB CB-OSN-2003/1 N57 SHALLOW WATER 10 CB CB-ONN-2003/1 N66 12 DS DS-ONN-2003/1 N68 6 AA AA-ONN-2003/1 N59 ONLAND 7 VN VN-ONN-2003/1 N63 89 RJ RJ-ONN-2003/111 N64 13 KG14 KG-ONN-2003/1 CY CY-ONN-2003/1 N69 N70 17 GS18 GS-OSN-2003/1 AA19 AA-ONN-2003/2 N5820 ONGC(51) & CE7L(49) N60 GV NTPC(40), CRL(15) & GPI(30), GV-ONN-2003/1 23-09-2005 N62 CE1L(25) & ONGC(51) CEIL(24), 295 23-09-2005 295 7210 7210 15 KK KK-DWN-2003/1 RELINQUISHED BLOCKS (6 BLOCKS) 16 SYNOPSIS OF ACTIVITIES TILL 2011-12 22 52 1C YON20/ 30 CY-ONN-2004/1 CY 51 50 9K GON20/ 28 KG-ONN-2004/1 KG 49 8D SON20/ 27 DS-ONN-2004/1 DS 48 47 46 45 44 3C BON20/ 22 CB-ONN-2004/1 CB 43 42 41 0R JON20/ 19 RJ-ONN-2004/1 RJ 40 25 39 7S RON20/ 16 SR-ONN-2004/1 SR 37 3 MB-OSN-2004/1 MB 24 8V NON20/ 17 VN-ONN-2004/1 VN 38 6G VON20/ 15 GV-ONN-2004/1 GV 36 2 CB-OSN-2004/1 CB 23 5P AON20/ 14 PA-ONN-2004/1 PA 35 1 GS-OSN-2004/1 GS 22 SHALLOW WATER 34 33 21 9M ZON20/ 8 MZ-ONN-2004/2 MZ 29 19 32 20 O AEONMAP NAME NO. GK-W-041D10 KG-DWN-2004/1 KG 9 8 8M ZON20/ 7 6 MZ-ONN-2004/1 MZ KG-OSN-2004/1 28 ONLAND KG 27 18 17 16 14 12 11 0A AON20/ 9 AA-ONN-2004/1 31 AA 5 30 PR-OSN-2004/1 PR 26 YC-W-041D4 7 D1 6 CY-DWN-2004/1 5 KK-DWN-2004/1 4 CY 3 KK 2 1 DEEP WATER BASIN SL. 5M NDN20/ D17 MN-DWN-2004/1 MN 15 13 10 DGH NI yrcro xlrto n rdcinAtvte 2011-12 - Hydrocarbon Exploration andProduction Activities - INDIA EXPLORATION BLOCKS AWARDED UNDERSIXTHROUNDOFNELP YON20/ 31 CY-ONN-2004/2 GON20/ 29 KG-ONN-2004/2 BON20/ 26 CB-ONN-2004/5 BON20/ 25 24 CB-ONN-2004/4 CB-ONN-2004/3 BON20/ 23 CB-ONN-2004/2 JON20/ 21 RJ-ONN-2004/3 JON20/ 20 RJ-ONN-2004/2 NON20/ 18 VN-ONN-2004/2 BON20/ 4 MB-OSN-2004/2 AON20/ 13 12 AA-ONN-2004/5 AA-ONN-2004/4 D23 NEC-DWN-2004/2 NDN20/ D21 MN-DWN-2004/5 AON20/ 11 AA-ONN-2004/3 D22 NEC-DWN-2004/1 GDN20/ D11 KG-DWN-2004/2 NDN20/ D20 D19 MN-DWN-2004/4 D18 MN-DWN-2004/3 MN-DWN-2004/2 D15 D14 KG-DWN-2004/6 D13 KG-DWN-2004/5 KG-DWN-2004/4 AON20/ 10 AA-ONN-2004/2 YP-W-042D9 CY-PR-DWN-2004/2 D7 D8 CY-PR-DWN-2004/1 D6 CY-DWN-2004/4 D5 CY-DWN-2004/3 CY-DWN-2004/2 LC REF. NO BLOCK GDN20/ D16 KG-DWN-2004/7 D12 KG-DWN-2004/3 ONGC (80) ONGC (80) GSPC (40) OIL(90) GEOGLOBAL RESOURCES(BARBADOS) (100) NAFTOGAZ (10)& WELSPUN(35) ADANI ENTEREPRISES(35) ONGC(50) ONGC(40) ONGC(50) ONGC(50) OIL(60) SILVERWAVE(MAYANMAR) (10)&BPCL (10) HALLWORTHY(PAN OIL (75) GSPC(20) PETROGAS (20) ONGC (100) PRIZE PETROLEUM(10) GSPC(20) ONGC (100) JAIPRAKASH ASSOCIATESLTD.(90) ONGC (100) FOCUS(10) ONGC (100) ONGC (100) ESSAR ENERGY(90)&OIL(10) NAFTOGAZ(10) &WPPL(35) ADANI ENTERPRISES(35),AISPL(20), SANTOS RIL (70) ESSAR ENERGY(90) SANTOS (PARTICIPATING INTEREST) ONGC(70) OIL(75) ONGC (55) GAIL(10), OIL(10)&BPCL(10%) RIL (70) RIL (70) RIL (70) ONGC(50) RIL(70) OIL(85) CEIL(10) OIL (90) ONGC(70) ONGC(45) ONGC(70) ONGC(70) ONGC(70) ONGC(70) ONGC(70) NAFTOGAZ(10) PETROGAS(20) ONGC(60) ONGC(60) RIL (70) RIL (70) ONGC(70) OSRIMDT FAW DATE OF CONSORTIUM &BPEAL(30) , GEOGLOBAL(25)&HPCL(15) , SUNTERA(10)&SHIV &BPEAL(30) &BPEAL(30) & GEOGLOBAL(10) &GEOGLOBAL(25) & SHIV-VANI (15) & BPEAL(30) & BPEAL(30) & BPEAL(30) & BPEAL(30) & SUNTERRA(10) , CAIRNINDIA(25),ONGC(35)& , GSPC(10),HPCL(10),GAIL(10)&BPCL(10) (100) (100) , GSPC(10),HPCL(10),GAIL(10)&OIL(10) , GAIL(20),HPCL(20), , IOC(20),GAIL(20),HPCL(20)& , GSPC(40)&HERAMEC(10) , GSPC(35)&ENSEARCH(25) , GSPC(40)&SUNTERA RES.L , GSPC(40)&HERAMEC(10) , GSPC(10),HPCL(10)&GAIL(10) , GSPC(10),HPCL(10), , GSPC(10),HPCL(10)&GAIL(10) , CIL(40)& TAT , GSPC(10),HPCL(10)&GAIL(10) , GSPC(10),HPCL(10)&GAIL(10) , GSPC(10),HPCL(10)&GAIL(10) , GSPC(10),HPCL(10)&GAIL(10) , GSPC(10),HPCL(10)&GAIL(10) , GSPC(10),HPCL(10)&GAIL(10) , GAIL(40)&PETROGAS(2 &NEWBURY (90%) & BPCL(20) & & BPCL(20) & & BGEPI(45) ,GAIL(20),IOC(20),GSPC(20) &HPCL(20) ,RNRL(10),GEOPETROL(10)& REL(70) AMA)(10), NITINFIRE(10), & ESSAROIL(10) A(15) & , ADANI PORT(20), , ADANI -VANI(15) 0) TAT TD. (10) A(30) OA RA:368 6.8306227.72 161.28 306389 TOTAL AREA: CONTRACT ( in (in CONTRACT 20-071140 02-03-2007 20-071 02-03-2007 20-071 02-03-2007 20-071 02-03-2007 20-07375 02-03-2007 20-07214 02-03-2007 20-07549 02-03-2007 20-072649 02-03-2007 20-077 67.28 75 02-03-2007 20-0770 113 02-03-2007 02-03-2007 20-07423 02-03-2007 20-0732 02-03-2007 20-072196 02-03-2007 20-071330 02-03-2007 20-074613 02-03-2007 20-074466 02-03-2007 20-071520 02-03-2007 20-075801 02-03-2007 20-07127013277 0 13277 02-03-2007 20-078354 02-03-2007 2616 02-03-2007 20-072537 02-03-2007 6589 02-03-2007 20-0746 95 02-03-2007 02-03-2007 20-078706 02-03-2007 20-07144010454 0 10454 02-03-2007 20-071252 02-03-2007 20-077790 02-03-2007 20-07191011951 0 11951 02-03-2007 20-0715 01131 20 1151 02-03-2007 02-03-2007 11922 0 11922 02-03-2007 20-07136011316 0 8822 11316 02-03-2007 02-03-2007 20-07144 02-03-2007 20-07218 02-03-2007 20-07132010302 12324 0 0 10302 12324 02-03-2007 02-03-2007 20-07141013451 12025 12017 0 12059 0 9994 0 0 13451 12025 02-03-2007 12017 02-03-2007 12059 02-03-2007 02-03-2007 02-03-2007 02-03-2007 10907 0 9885 11851 10907 02-03-2007 0 02-03-2007 11851 02-03-2007 20-076205 02-03-2007 20-073619 02-03-2007 741 02-03-2007 SIGNING RAAE AREA AREA AREA ARDED 3213 9417 83011813 0 11904 1813 0 1904 86011856 0 1856
EIQ PRESENT RELINQ. (NELP-VI) sq.km) 8511 38 6108 36 2649 0 375 0 214 0 2196 0 1330 0 4613 0 1140 0 4466 0 1520 0 113 0 0 5801 0 423 0 8354 0 2616 0 0 2537 0 6589 0 8706 0 1252 0 7790 0 8822 0 9994 0 9885 0 6205 0 3619 0 0 0 218 0 3213 0 741 0 9417 0 (As on01.04.2012) 7.72 70 32 46 95 SYNOPSIS OF ACTIVITIES TILL 2011-12 81 48 31 83 23 AREA ARDED DGH (SQ. KM.) (As on 01.04.2012) (NELP-VII)
TOTAL AREA : 16,725 AREA TOTAL TOTAL AREA : 69,218 AREA TOTAL 22-12-2008 11,837 22-12-2008 223.87 22-12-2008 3940 22-12-2008 19,234 22-12-2008 1517 22-12-2008 1217 22-12-2008 1881 22-12-2008 2810 22-12-2008 2402 22-12-2008 2820 CONTRACT 22-12-200822-12-200822-12-2008 1096 22-12-2008 2552 3792 4001 22-12-2008 22-12-2008 22-12-2008 22-12-2008 22-12-2008 102 22-12-2008 2811 22-12-2008 199 22-12-2008 133 22-12-2008 170 22-12-2008 270 22-12-2008 946 SIGNING 22-12-2008 1191 DATE OFDATE AW TOTAL AREA :AREA TOTAL 27,011.87 (100) ,DEEP INDUS(70) 22-12-2008 789 (30) & RIL (70) (30) & RIL 22-12-2008 1,949 GRAND TOTAL : 112954.87 SQ.KM : 112954.87 GRAND TOTAL (26) & GVK (74) (26) & GVK (74) (26) & GVK (74) 22-12-2008 (26) & GVK (74) 22-12-2008 (26) & GVK (74) 22-12-2008 3,660 22-12-2008 3,097 22-12-2008 3,408 3,169 3,324 (26) & GVK (74) (26) & GVK (74) 22-12-2008 22-12-2008 3,138 14,675 , QQVS (40), & ONGC (40) , OIL (30) & ACL (10)ACL (30) & , OIL 22-12-2008 363 & TATA PETRO (20)TATA & 22-12-2008 2227 & GSPC (49) & GSPC (49) & GSPC (30) & GSPC (20) & OIL (25) , GSPC (20) & HMEL (20) 22-12-2008 2810 & HMEL (20) GSPC (30) & & NEIL (50) , HOEC (20) (90) & GSPC (10) CONSORTIUM INTEREST) BILLITON BHP BILLITON BHP BILLITON BHP BILLITON BHP BILLITON BHP ONGC (60) ONGC (100) IOCL (100) PETROLEUM (100) MERCATOR ONGC (51) RESOUR. (100) OMKAR NATUAL RESOUR. (100) OMKAR NATUAL ONGC (100) ONGC (100) ONGC (100) ONGC (75) ONGC (80) DEEP ENERGY(10) (10) ELECTRONICS FINANCE (10) & SAVLA KANVEL HOEC (25), BPRL (25), JSPL (25)ONGC & IMC (25) OIL (60) 22-12-2008 (20) ENERGY & MITTAL HPCL GSPC (60) 1424 IOCL (100) VASUNDHARA RESOUR (100) VASUNDHARA MERCATOR PETROLEUM (100) MERCATOR ONGC (51) QUEST (20)
BHP BILLITON BHP BILLITON BHP ONGC (70), IOCL (20) & GSPC (10) EXPLORATION BP 22-12-2008ONGC (90) & OIL (10) 1,727 ONGC (80) & GSPC (20) ADAANI WELSPUN EEPL (50) ONGC (70) ONGC (80) ONGC (60) SREI (20), VIPL2 (10) & PRIM (10) PETRO. (20)TATA ONGC (80) & 22-12-2008 1807 ONGC (80) ONGC GAIL (40), BENGAL ENERGY (30) D-13 D-14 D-16 D-17 D-19 D-15 REF. NO REF. ON MAP (PARTICIPATING INDIA -Activities Hydrocarbon Exploration and Production - 2011-12 MB-DWN-2005/2 D-6 PA-ONN-2005/1 2 CB-ONN-2005/2 18A&B AA-ONN-2005/1 1 WB-ONN-2005/2 5 GV-ONN-2005/3SR-ONN-2005/1 10 RJ-ONN-2005/1 11 RJ-ONN-2005/2 14 RJ-ONN-2005/3 15 16 BLOCK NAME MB-DWN-2005/9 KK-DWN-2005/1 KG-DWN-2005/1 AN-DWN-2005/1 CB-ONN-2005/3CB-ONN-2005/4CB-ONN-2005/5 19 CB-ONN-2005/6 20 21 22 CB-ONN-2005/7 23 MB-OSN-2005/1 S-1 CB-ONN-2005/8 24 CB-ONN-2005/9 25 CB-ONN-2005/10 26 CB-ONN-2005/11 27 KG-OSN-2005/1 S-7 PR-ONN-2005/1 28 MB-DWN-2005/3MB-DWN-2005/4MB-DWN-2005/5 D-7 MB-DWN-2005/7 D-8 D-9 D-11 KK-DWN-2005/2 WB-ONN-2005/3WB-ONN-2005/4 6 7 MB-OSN-2005/2 S-2 MB-OSN-2005/3 S-3 MB-OSN-2005/5 S-5 MB-OSN-2005/6 S-6 CY-ONN-2005/1 29 KG-DWN-2005/2 PA-ONN-2005/2 3 KG-OSN-2005/2 S-8 MUMBAI PURNEA CAMBAY ASSAM-ARAKAN BENGAL GANGA SATPURA-REWA RAJASTHAN KERALA-KONKAN KRISHNA-GODAVARI ANDAMAN-NICOBAR MUMBAI KRISHNA-GODAVARI PALAR CAUVERY EXPLORATION BLOCKS AWARDED UNDER SEVENTH ROUND OF NELP ROUND UNDER SEVENTH AWARDED BLOCKS EXPLORATION ONLAND DEEP WATER DEEP 1. 2. 3. 4. 5. 6. 20. 30. 31. 32. 33. 34. 19. 21. 22. 23. 24. 25. 26. 27. 28. 29. 35. 36. 37. 38. 39. SL BASIN NO. 7. 8. 9. 10. 11. SHALLOW WATER 12. 13. 14. 15. 16. 17. 18. 40. 41. SYNOPSIS OF ACTIVITIES TILL 2011-12 24 ONLAND DEEP WATER DGH 11. 10. 9. SHALLOW WATER LBASIN NO. SL 22. 21. 20. 14. 13. 12. 23. 16. 15. 8. 5. 4. 3. 2. 1. 24. 19. 18. 17. 7. 6. 32. 31. 30. 29. 25. 28. 27. 26. EXPLORATION BLOCKS AWARDED UNDEREIGHTHROUNDOFNELP NI yrcro xlrto n rdcinAtvte 2011-12 - Hydrocarbon Exploration andProduction Activities - INDIA MUMBAI GUJARAT-KUTCH ASSAM-ARAKAN CAUVERY KRISHNA-GODAVARI ANDAMAN-NICOBAR KRISHNA-GODAVARI MUMBAI VINDHYAN CAMBAY KON20/ S-2 GK-OSN-2009/2 AA-ONN-2009/3 AA-ONN-2009/2 AA-ONN-2009/4 GON20/ S-25 S-24 S-23 KG-OSN-2009/4 KG-OSN-2009/3 KG-OSN-2009/2 BON20/ S-9 S-8 S-5 MB-OSN-2009/7 MB-OSN-2009/6 MB-OSN-2009/3 S-1 GK-OSN-2009/1 NDN20/ D-9 D-8 AN-DWN-2009/3 AN-DWN-2009/2 NAME BLOCK AA-ONN-2009/1 S-20 S-19 CY-OSN-2009/2 CY-OSN-2009/1 AN-DWN-2009/18 NDN20/ D-11 AN-DWN-2009/5 GON20/ S-22 KG-OSN-2009/1 AN-DWN-2009/13 D-7 AN-DWN-2009/1 D-6 D-1 KG-DWN-2009/1 MB-DWN-2009/1 BON20/ 18 17 16 CB-ONN-2009/8 15 CB-ONN-2009/7 CB-ONN-2009/6 CB-ONN-2009/5 VN-ONN-2009/3 BON20/ 14 13 12 CB-ONN-2009/4 11 CB-ONN-2009/3 CB-ONN-2009/2 CB-ONN-2009/1 NMP(PARTICIPATING MAP ON REF. NO D-24 D-19 (A&B) 1 9 3 2 4 AE 3)&IC(0 00-001,242 30-06-2010 ONGC (40), AWEL (30)&IOC BHP (100) BHP (100) BHP (100) AWEL (20)&IOC ONGC (40),GSPC(20), INTEREST) CONSORTIUM ONGC (50) JOGPL(47) JOGPL(47) OIL (50) Inc(100) International Energy Bengal ONGC (60) OIL (50) NTPC (10)& APGIC (10) ONGC (50) CEIL (10) ONGC (90) ONGC (80) GAIL (10)&GSPC ONGC (70),NTPC(10), ONGC (60) ONGC (60) ONGC (70) ONGC(45) & APGIC (10) BGEPIL(30), CEIL(10) JPIL (87)&JPPL(13) ESGPL (100) HCIL (100) NTPC (100) ONGC (100) ONGC (90) ONGC (50) HCIL (100) ESGPL (100) ESGPL (100) &ONGC(50) &ONGC(50) , CIL(90) & CIL(90) &OIL(50) I 3)&GI 1)3-621 4,040 30-06-2010 , OIL(30)&GAIL(10) , OIL(30), &GSPC(50) PI 1)&NP 1)3-621 1,472 & APGIC (10) 30-06-2010 , APGIC (10)&NTPC EP(7 OP(6 00-001,740 30-06-2010 , JEKPL(17)&JODPL(36) EP(7 OP(6 00-002,217 30-06-2010 , JEKPL(17)&JODPL(36) & OIL(40) & OIL(30) & & GSPC(10) OIL(15), OIL (40) RN OA 52,573SQ.KM. : GRAND TOTAL AEO AW DATE OF SIGNING 00-001,865 1,876 30-06-2010 1,492 30-06-2010 30-06-2010 CONTRACT 00-001,362 30-06-2010 00-003,992 30-06-2010 00-00136 144 177 30-06-2010 165 30-06-2010 30-06-2010 30-06-2010 1,250 30-06-2010 00-0058 30-06-2010 00-0071 68 11330-06-2010 30-06-2010 30-06-2010 00-001,264 30-06-2010 00-0084 30-06-2010 00-0084 30-06-2010 00-004,007 30-06-2010 00-00835 30-06-2010 00-002,961 30-06-2010 00-004,002 30-06-2010 00-001,621 30-06-2010 00-001,988 1,471 30-06-2010 30-06-2010 00-003,995 4,981 30-06-2010 30-06-2010 00-001,800 30-06-2010 TOTAL AREA :29,778 TOTAL AREA :16,488 TOTAL AREA :6,307 (NELP-VIII) (As on01.04.2012) (SQ. KM.) ARDED AREA SYNOPSIS OF ACTIVITIES TILL 2011-12 25 AREA ARDED DGH (SQ. KM.) (As on 01.04.2012) (NELP-IX) TOTAL AREA : 2,986 AREA TOTAL TOTAL AREA : 11,505 : AREA TOTAL 28-03-2012 1,361 28-03-2012 1,625 28-03-2012 396 28-03-2012 39 28-03-2012 131 CONTRACT 28-03-2012 171 SIGNING 28-03-201228-03-2012 535 782 28-03-201228-03-2012 61 49 27-06-2012 122 28-03-2012 534 & Natural Resources Ltd. Oil North East India Petroleum Ltd. Authority of India Ltd. GRAND TOTAL : 14,491 SQ.KM. Jubilant Oil & Gas Pvt. Ltd. Jubilant Securities Pvt. Ltd. Deep Natural 28-03-2012 4909
KGN Industries (90)KGN Industries 28-03-2012 3776 & & & GAIL (10)
(15) & (10) IOC (20) OIL(30) & GAIL (10) , ONGC(40) & BPRL(20) , ONGC(30), GAIL(20) & , ONGC(30), GAIL(20) Deep EnergyDeep -MPONR Deep Energy LLC. QuestPan -Sanklap - -NR(V)L Mercator Petroleum Ltd. -ENI Omkar Natural Resources Pvt. Ltd. - Quest JOGP -JSPL Oil Sankalp Pan India Consultants NTPC Niko Resources (NELP-V) Ltd. - - PONEI - POGC ENI India Ltd. -HOEC -GAIL - Power Corporation Ltd. Thermal National NIKO Premier -GEO Polish Oil & Gas Company PPCL - Ltd. Hindusthan Oil Exploration Company -GGRCRL - Gas -ACL Niko Resources Ltd. Gaz - Geo Global Resources (India) Inc. Ltd. Prize Petroleum Company GPI -XOH (Barbados) Inc. GeoGlobal Resources - Ltd. Canoro Resources - Ltd. Assam Company - - Gazprom GeoPetrol International Inc. X Oil, Maruritius ONGC(60), ONGC(90) INTEREST) Deep Energy LLC (10), East West Petroleum (10) East West OIL(40) KGN Oil & Gas Pvt. Ltd. (90) & Gas Pvt. Ltd. KGN Oil (100) Sankalp Oil & Natural Resources Ltd. Deep Energy LLC (10) & Focus Energy Ltd. (90) Ltd. Birkbeck Investments ONGC (100) Deep Energy LLC (10) Pratibha Oil & Natural Gas Pvt. Ltd.(100) (20) & Pan India Consultants (80) Frost Ltd. International ONGC (80) & CONSORTIUM OF DATE AW Safak WSB Energy Pvt. Ltd. (75) Safak WSB Energy Pvt. Ltd. GAIL (25), BPRL (25), EIL (20) OIL(40) Resources Limited BFIL (15) & MIEL (15) INDIA -Activities Hydrocarbon Exploration and Production - 2011-12 fshore Holdings Ltd. GK-OSN-2010/1 S-1 VN-ONN-2010/1 4 VN-ONN-2010/2 5 RJ-ONN-2010/2CB-ONN-2010/1 8 CB-ONN-2010/3 9 CB-ONN-2010/4 11 CB-ONN-2010/5 12 CB-ONN-2010/6 13 CB-ONN-2010/10 14 18 BLOCK NO REF. CB-ONN-2010/11 19 AA-ONN-2010/2 2 GK-OSN-2010/2 S-2 AA-ONN-2010/3 3 State Petroleum Corporation Ltd. State Exploration & Production (India) Inc. Exploration (Alpha) Ltd. Energy Equity India Petroleum Pty. Ltd. Energy Equity India Petroleum Pty. British Gas Explo. & Prod. India Ltd. GUJARAT-KUTCH VINDHYAN CAMBAY RAJASTHAN ASSAM-ARAKAN EXPLORATION BLOCKS AWARDED UNDER NINTH ROUND OF NELP OF NELP NINTH ROUND UNDER AWARDED BLOCKS EXPLORATION FELVPLHEPIJTI -EEIPL -BPRL - Focus Energy Ltd. CEIL Ltd. Petroleum Videocon - -CPIL Hardy -CESL Inc. Joshi Technologies CEHL - Bharat Petroleum Resources Ltd. MIL - -BGEPIL Ltd. Cairn Energy India Pty. -Naftogaz Cairn Petroleum India Ltd. Cairn Energy Search Ltd. - Santos - - Cairn Energy Hydrocarbons Ltd. BHPAdani - Mosbacher India LLC India Naftogaz BPEAL - Santos - - Billiton Pvt. Ltd. BHP Aadani Welspun BP ONGCIOCOIL -GSPCRIL - Gas Corpn. Ltd. Oil & Natural EOL - -Okland Indian Oil Corpn. Ltd. - Gujarat Oil India Ltd. - - Reliance Industries Ltd. Essar Oil Ltd. Okland Of 2. 1. 5. 6. 4. 8. 10. 12. 7. NO. NAME ON MAP (PARTICIPATING 9. 11. 13. SL BASIN 14. 3. SHALLOW WATER ONLAND SYNOPSIS OF ACTIVITIES TILL 2011-12 26 O (o fBok)PENL EPINL-INL-I EPI EPVNL-INL-I EPVI EPI TOTAL NELP-IX NELP-VIII NELP-VII NELP-VI NELP-V NELP-IV NELP-III NELP-II NELP-I DEEP WATER (66) PRE-NELP NO. (No.ofBlocks) 6 KRISHNA-GODAVARI (17) — 26,130 — 8,695 7,950 3,288 76,596 3,676 1,800 — 128,135 — 1,800 3,676 76,596 3,288 7,950 8,695 — — 26,130 ANDAMAN-NICOBAR(11) 8 — MAHANADI-NEC(14) 7 KRISHNA-GODAVARI (17) 6 1CAMBAY (4) 11 2MUMBAI (10) 12 6PALAR (1) 16 — KRISHNA-GODAVARI (8) 14 CAUVERY (2) 13 GRAND TOTAL: : TOTAL AREA SOUTHREWA (2) 32 — 775 RAJASTHAN (11) 19 GUJARAT-KUTCH (1) 18 VINDHYAN (6) 17 ONLAND (110) : TOTAL AREA — 5,725 GUJARAT-KUTCH (5) 9 SHALLOW WATER(34) : TOTAL AREA PALAR (1) 5 CAUVERY-PALAR (4) — 4 CAUVERY (5) 3 KERALA-KONKAN(7) 2 MUMBAI (7) 1 SL. 0GJRTSUAHR 2 — GUJARAT-SAURASHTRA (2) 10 26 ASSAM-ARAKAN (24) 1,901 — 5,754 6,256 3,415 81 1,719 363 4,125 567 24,181 567 4,125 363 1,719 81 3,415 6,256 5,754 — — — KRISHNA-GODAVARI (3) 28 1,901 DECCANSYNECLISE(2) 27 — ASSAM-ARAKAN(24) 26 GANGA VALLEY (2) 25 — HIMALAYAN FORELAND (1) 24 CAUVERY (6) 23 PALAR (1) 22 5MAHANADI-NEC(2) 15 1PAHT-OAAI()2,5 — 21,850 PRANHITA-GODAVARI (1) 21 CAMBAY (42) 20 29 MIZORAM (2) MIZORAM 29 0PURNEA (3) 30 1BENGAL (3) 31 DGH NI yrcro xlrto n rdcinAtvte 2011-12 - Hydrocarbon Exploration andProduction Activities - INDIA BASIN-WISE DISTRIBUTIONOFPEL AREAS UNDEROPERATION BASIN 4190 ,0.57758 ,2.01,1.15,5.22,1.76371,0 167,613.92 11,505 6,307 863,227.22 14,491 27,011.87 52,573 56,659.72 112,954.87 13,712.91 306,227.72 58,926.41 4,229.20 112,487 7,795.88 100,673.88 6,203.25 16,154.25 47,774 — 40,965.09 34,189.09 2,525.69 — 449.25 26 169.20 807 645.72 1340.87 932 1,718 8613.73 1,718 932 1340.87 645.72 807 169.20 26 449.25 — 2,525.69 ,3.0— 7,137.40 ,7 ,6 ,5 3 ,9.02,1 6751,8 ,8 86,726.50 2,986 16,488 16,725 22,014 1,795.50 — 530 9,951 9,461 6,776 ,5 — 1,051 — — — — — — — — — — ,6 ,6 — 4,061 9,461 — — — — — — — 213— 12,183 — 833— 38,313 — — — — — — — — — — — — — — — — — — — — ,9 — 5,890 — (PRE-NELP &NELPBLOCKS) — — ,5 — 6,155 — — — — — — — — 19,190 — — — — — 435— 14,325 — — — — — — — — — ,1.8— 1,513.88 — — — 43,983 32,789 — 12,324 33,909 — — 123,005 — — 33,909 12,324 — 32,789 43,983 — 23818278 34827546,1 978—608,886.80 — 29,778 69,218 227,554 43,418 108,257.80 92,348 530 — — — — — — — — — — — — — — — — — 46,785 17,050 68,786 — — — 144,804 — — — 68,786 17,050 46,785 — — — — 20733.80 — AREA ( 4 5.059960 3,137 — — 946.00 589 957.00 645 — — — — ,6.52,649 2,365.75 — — — — — — — — ,6 1,651 1,262 — — — ,6.6819418—5525,536.56 535 — 4,158 8,139 5,567.16 — — ,9.02,616 1,795.50 — — — — Sq. Km) 300—1,3 507— — 25,017 11,837 — 23,080 ,7 027—12086522,875 8,685 1,250 — 10,267 2,673 — 345———42,635 — — — 23,445 — — — — ,5 ,2 — — 2,227 8,354 — 643——— — — 46,403 — — — 32779—— — 789 13,277 — 9,417 — — 6,832 — — — 19,528 — 5,233 12,034 2,261 — — ,3 ,4 6,185 — — 3,648 2,537 — ,3 ,9 ,6 — 5,766 4,691 1,131 — 6,589 — — — — — — — — — 173—— — 11,733 — 976291—22,757 — 2,961 19,796 — ,0 1,807 — — 1,807 5,014.75 — — — 6,155 — — — — — — — — — 6,832 — — — ,8 — 2,983 — — — — — — — — — — — — 5,462.50 — — — ,0 ,8 11,217 2,986 2,506 — — — — — — — 80,667.80 14,066 60,728 10,581 21,850 11,733 2,983 13,522 12,479 12,118 2,913 1,513 9,417 775 SYNOPSIS OF ACTIVITIES TILL 2011-12 61 49 27 165 122 325 248 136 218 185 133 741 280 319 957 1,800 1,362 3,619 1,077 1,949 24.25 223.87 10,008 13,277 39,704 16,496 14,445 12,460 258,448 5014.75 1,293.72 4,227.05 5,896.40 10,522.80 23,586.64 12,184.36 18,944.20 DGH 402,725.18 2 1 9 2 (As on 01.04.2012) — 1800 — — 1362 — —— 248 136 — — — 325— — 165 — ——— ——— ——— ——— ——— — 3957 — 789 — 9219 218 — — 946 — 131 280 — — 185 — — 133 — — — — — — 1949 — — — — 34471 5233 — — — — 223.87 — — — — — — — — — — — — 1424 — — — —— 16496 — — 13277 — — — — — —— —— —— —— — — 102.72 1191 — — —— — — 3619—— — — — ———— — 4232.16 2616 — — 535 —— —— —— —— —— — — 741 —— —— —— —— — 957 — — 14445 — — — 1298 2810 — — — 2365.75 2649 — — — —— — 1262 9417 — 4949 — — — — — — — — — — 1858.40 81 — — — — — — — — — — — — — — — — — 1095 — 7576 1517 1705 567 — — — — 530 39.80 172 7273 1217 — — INDIA -Activities Hydrocarbon Exploration and Production - 2011-12 — — — — — — — — — — — — — — — — — — — — — — — — — — — — — — (PRE-NELP & NELP ROUNDS) (PRE-NELP — — — — — — 24.25 — — — — — — — — — — — — — — — — — — — 425 — — — — — — — — — — — — — — — — — — — — ————————6 — ————————4 — ————————1 — — — — — — — — — — — 319 866 19.05 — 3316.20 — 22162.64 — PRE-NELP NELP-1 NELP-II NELP-III NELP-IV NELP-V NELP-VI NELP-VII NELP-VIII NELP-IX TOTAL 5 4801.20 — 1 2 1 1 6 3 2 1 1 1 1 2 3 1 2 4 1 4 1 6 9 1 2 2 86 2123 16773 4061 7795.88 90319.80 14438.50 165113 65601 32693 3807 12 26 7258 31001 11644 92348 19174 20973 76050 — — — 210 40,965.09 47,774 16,154.25 100,673.88 112,487 58,926.41 306,227.72 112,954.87 52,573 144,91 863,227.22 COMPANY-WISE DISTRIBUTION OF PEL AREAS UNDER OPERATION AREAS PEL OF DISTRIBUTION COMPANY-WISE ANY/ NO.OF 35 OIL PRATIBHA 36 INDIA PAN 37 SANKALP 29 BGEPIL 30 BENGAL ENERGY 1 31 ESGPL 32 HCIL 33 JPIL 34 NTPC 24 DEEP ENERGY25 PET. MERCATOR 4 26 2 OMKAR NATURAL 2 27 RES. VASUNDHARA 1 28 QUEST 17 NAFTOGAZ 18 PRIZE PETROLEUM 1 19 GAIL 20 IOCL 21 BILLITON BHP 22 EXPLORATION BP 10 1 23 ADAANI WELSPUN 3 8 ESSAR 9 JOGP 10 FOCUS 16 PETROGAS 1 6 HOEC 7 CANORO 11 GGR 14 ENI 15 SANTOS TOTAL 2 RIL 3 OIL NO. OPERATOR BLOCKS 1 ONGC SL. COMP 4 CAIRN 5 GSPC 12 NR(V)L 13 NIKO SYNOPSIS OF ACTIVITIES TILL 2011-12 28 DGH NI yrcro xlrto n rdcinAtvte 2011-12 - Hydrocarbon Exploration andProduction Activities - INDIA SYNOPSIS OF ACTIVITIES TILL 2011-12 29 DGH INDIA -Activities Hydrocarbon Exploration and Production - 2011-12 SYNOPSIS OF ACTIVITIES TILL 2011-12 30 DGH NI yrcro xlrto n rdcinAtvte 2011-12 - Hydrocarbon Exploration andProduction Activities - INDIA SYNOPSIS OF ACTIVITIES TILL 2011-12 31 DGH (%) (%) 100.00 100.00 (As on 01.04.2012) on (As ) 61.00 0.42 49.00 0.34 131.00 0.90 325.00 0.62 165.00 0.31 535.00 3.69 122.00 0.84 136.00 0.26 248.00 0.47 9,219.00 63.62 5,233.00 9.95 1,800.00 3.42 3,957.00 7.53 3,807.00 26.27 4,949.00 9.41 . Km. 14,491.00 52,573.00 32,693.00 62.19 q S ( (Sq. Km.) (Sq. Present Area Area Present Present Area Area Present
) BGEPIL 1,705.00 OIL ENERGYBENGAL 3.24 ESGPL HCIL 1,362.00NTPC 2.59 JPIL DEEP ENERGY ONGC 567.00OIL FOCUS 3.91 GAIL SANKALP OIL PRATIBHA INDIA PAN ONGC BILLITON BHP CAIRN JOGP TOTAL TOTAL / COMPANY OPERATOR COMPANY / COMPANY OPERATOR JPIL NTPC ESGPL INDIA -Activities Hydrocarbon Exploration and Production - 2011-12 PRATIBHA OIL PAN INDIA BENGAL ENERGY NELP - IX NELP - VIII OIL PRE-NELP & NELP ROUNDS SANKALP ( BGEPIL DEEP ENERGY DEEP JOGP GAIL OIL FOCUS ONGC CAIRN CAIRN BHP ONGC BILLITON COMPANY-WISE DISTRIBUTION OF PEL AREAS UNDER OPERATION OPERATION UNDER COMPANY-WISE DISTRIBUTION OF PEL AREAS SYNOPSIS OF ACTIVITIES TILL 2011-12 32 DGH 24. 23. 21. 20. 19. 18. 22. 16. 13. 12. 15. 11. 10. 14. 13. 12. 11. 10. 9. 28. .FIELDS AW A. 25. 27. 26. 17. 9. 8. 7. 6. 5. 4. 3. 2. 8. 2. 1. 1. C. PRODUCINGFIELDSDISCOVERED/DEVELOPEDINEXPLORATION BLOCKSBY PVT./JV COMP 1. B. AWARD OFFIELD 7. 6. 5. 4. 3. ROUND/ NO. SL.
NI yrcro xlrto n rdcinAtvte 2011-12 - Hydrocarbon Exploration andProduction Activities - INDIA SMALL AND MEDIUM SIZED FIELDS AWARDED TO PVT/JV COMPANIES PVT/JV TO AWARDED FIELDS SIZED MEDIUM AND SMALL II II I I I MEDIUM- SIZEDFIELDS II I SMALL- SIZEDFIELDS I CAMBAY PY-1 ASSAM-ARAKAN CAUVERY OFFSHORE KG OFFSHORE RAJASTHAN CAMBAY UFO ABYLAKSHMI (CB-OS/2) GULF OFCAMBAY SA-RKNKHARSANG K-G OFFSHORE ASSAM-ARAKAN CAUVERY OFF. MUMBAI OFF. CAMBAY MID&SOUTH TAPTI MUMBAI OFFSHORE AI IL FIELD BASIN AWAITING FINALIZATION OFCONTRACT ARDED DA1, DA2&DA3(RJ-ON-90/1) ALLORA PY-3(CY-OS-90/1) N. KATHANAN. UNAWA KANAWARA BHANDUT AMGURI RJ-ON/6 (SGL) BAOLA CAMBAY OGNAJ INGOLI (CB-ONN-2000/1) ESU (CB-ON/3) TARAPUR-1 (CB-ON/2) SABARMATI MATAR PALEJ-PROMODA (CB-ON/7) MODHERA BHEEMA (CB-ONN-2000/2) DHOLKA DHOLASAN GAURI (CB-OS/2) CB-X WAVEL MUKTA SANGANPUR KARJISAN INDRORA PANNA BAKROL D-1, D-3&MA(KG-DWN-98/3) HAZIRA LOHAR N. BALOL NS-A (CB-ONN-2000/2) RA ASJOL R A TNA-R-SERIES VV A } HERAMEC LTD. GSPCL (70)&HERAMECLTD.(30) HERAMEC LTD. HERAMEC LTD. HERAMEC LTD.(30) HOEC (25),GSPCL(45)& CRL /GOI HOEC (100) NIKO RIL (60) OILEX NL HOLDINGS(I) LTD. & OILEXNL HOLDINGS(I)LTD. (15) OILEX NL(30) EOL (70) GSPC (50),GAIL CEIL (35) FOCUS(7) & GSPCL(60) OILEX NL HOLDINGS(I) LTD. GSPC(56) HOEC(35), INTERLINK PETROLEUMLTD. NIKO (65) & GSPC (35) NIKO(100) INTERLINK PETROLEUMLTD JOSHI TECH.INC.(JTI) CAIRN(40) CAIRN(40) NIKO(100) JOSHI TECH.INC.(JTI) BGEPIL CAIRN(40) SELAN EXPL.TECH.LTD. SELAN EXPL.TECH.LTD. SELAN EXPL.TECH.LTD. BGEPIL SELAN EXPL.TECH.LTD. GEOPETROL (25)&OIL(40) JUBLIANT ENERGY(KHARSANG)(25), GEO-ENPRO HARDY POL(10) SELAN EXPL.TECH.LTD. RELIANCE IND.LTD. LTD. BRITISH GASEXPLO.&PROD.INDIA ONGC (40) RAVVA OIL PTE.LTD.(12.5)& (PARTICIPA HOEC (50)&GSPCL HERAMEC LTD. & HYDROCARBON RES.DEV. CEIL PRIZE PETROLEUMCORP. LTD. OSRIMDATE CONSORTIUM (BGEPIL)(30), (22.5), VideoconIndustriesLtd. (33.33)&GSPCL(66.67)
, BPEAL(30)&NIKO(10) (30), (30), (18) , ESSAROIL L &ONGC(30) , CEHL(35)&ONGC(30) , GGR(14)& ONGC (30) , ISIL(45.5),NOCL(17.5) & ONGC(30) , ONGC(50)& , ONGC(50)& , ONGC(50)& (60) & ASSAM CO.L GSPC(35)&ONGC(30) , ONGC(40), TING INTEREST) RIL RIL (10), , GSPC (55), GSPC , (30)&GSPCL (70) (30)&GSPCL (70) (30)&GSPCL (30)&GSPCL (30) & (30) & ONGC (40)& (RIL) (30) TD.(50) &ONGC(40) ONGC (40) ONGC (40) (100) TPL(10) TPL(10) (100) TPL(10) TPL ANIES (100) (100) (100) (100) (100) CO. (P)LTD. (40) (21)&HOEC (40)&GSPCL TD. (40) (100) (100) (70) (70) (25), (50) GRAND TOTAL (50) 6)2.99 6.00 23.09.94 (60)
RELINQUISHED CONTRACT TOTAL AREA : AREA TOTAL OA RA:: AREA TOTAL SIGNING 23.02.01 30.15.65 23.02.01 30.16.85 23.02.01 30.152.75 23.02.01 30.127.30 23.02.01 50.00 06.10.95 23.09.94 23.02.01 23.09.94 30.4161.00 23.09.94 23.02.01 05.04.95 20.02.95 20.02.95 22.12.94 60.45.00 36.00 130.00 16.02.04 13.03.95 13.03.95 22.12.94 60.413.65 16.02.04 16.06.95 30.55.00 13.03.95 1,471.00 22.12.94 30.515.00 03.02.95 23.02.01 23.02.01 28.10.94 FPRESENT OF :31.6Sq.Km. :3710.66 (Sq. Km.) 3,010.26 3111.17 389.12 176.00 777.00 430.00 121.06 331.26 700.40 AREA 81.00 75.00 14.03 12.70 12.20 48.00 33.30 50.70 20.22 10.00 57.60 7.81 6.30 5.80 7.64 2.14 4.03 3.09 8.80 9.00 4.40 SYNOPSIS OF ACTIVITIES TILL 2011-12 33 DGH INDIA -Activities Hydrocarbon Exploration and Production - 2011-12
DGH has acquired 55,668.3 LKM of High Resolution Aeromagnetic (HRAM) and 13994.64 DGH has acquired 55,668.3 LKM of High Resolution over Kutch, Gujarat through McPhar. Airborne Gravity Magnetic (AGM) data LKM DGH has completed reprocessing of 12000 LKM of 2D seismic data of west coast of India data DGH has completed reprocessing of 12000 LKM of 2D seismic during the 2007-08. through M/s GGS-Spectrum Controlled Source Electromagnetic Acquisition & processing of Speculative DGH has completed covering an area of 2146.5 (CSEM) survey in KG-DWN-2005/3 by EMGS, Norway in 2008 sq.km. Aeromagnetic surveys amounting to 24,723 LKM were carried out in Himalayan Foreland area Aeromagnetic surveys amounting to 24,723 LKM were carried out during the year 2003-04, 2004-05 and 2005-06. 690.6 GLK of 2D seismic data has been acquired through NGRI in unexplored Kutch onland has been acquired through NGRI 690.6 GLK of 2D seismic data basin. in the northwestern part Integrated geophysical surveys, carried out jointly by DGH and NGRI with a maximum sediments of the Deccan Synclise, revealed sub-trappean Mesozoic-Gondwana thickness of 3 Kms. 16174 LKM 2D seismic data have been acquired, processed and interpreted through GX- have been acquired, processed 16174 LKM 2D seismic data 2005-07 under speculative survey during in eastern & western offshore USA Technology, and awarded in NELP- a good number of blocks were offered programme. Based on this data VI. During 1999-2003, 25,000 LKM of 2D seismic surveys were carried out in the deep waters of During 1999-2003, 25,000 LKM the southern tip. including Andaman, east and west coasts A 2D seismic coverage of 0.053 million sq. km. was achieved in 1997-98 in the onland areas A 2D seismic coverage of 0.053 survey was repeated in Bihar in 2002-03 over 0.05 million 2D seismic M.P. Bihar and of U.P., and potential of Vindhyan These surveys were carried out to assess the hydrocarbon sq. km. comprising of a number of highs and paleo-embayment new lower Vindhyan A Ganga basins. studies have led to the These mapped for the first time. lows basement features has been and awarded 3 blocks were offered areas and with new data, prospective demarcation of certain In 2003-04, 805.0 GLK 2D rounds of NELP. fourth and fifth in Ganga basin under second, assess the prospectively of the area to have been acquired from Chambal Valley seismic data NELP-V and VI in Three Blocks have been awarded in basin. of the Vindhyan western part basin. Vindhyan The DGH has carried out, either alone or in collaboration with reputed companies, several companies, with reputed or in collaboration either alone has carried out, The DGH 2 to This totals areas. information in hitherto unexplored/poorly-explored to upgrade projects onland (18%). (82%) and covers both offshore million sq kms and Andaman areas and over the eastern and western offshore satellite gravity surveys Of this total, geophysical surveys speculative offshore million sq. Kms. Joint venture account for 1.642 about 0.246 million sq. Kms. Andaman cover and area in eastern offshore within the same thickness structure, tectonics, and sedimentary given valuable indications to These surveys have and for for modeling studies provided inputs in the deep waters and have and play recognition prospect map of the area. of hydrocarbon the preparation
z z z z z z z z z z
z GEOSCIENTIFIC STUDIES BY DGH BY STUDIES GEOSCIENTIFIC SYNOPSIS OF ACTIVITIES TILL 2011-12 34 DGH z z z z z z z z z z z z NI yrcro xlrto n rdcinAtvte 2011-12 - Hydrocarbon Exploration andProduction Activities - INDIA in January2008,currentlythemodelingstudyof Kerala-Konkanbasinisinprogress. being carriedoutbyBeicp-Franlab,France.ContractwassignedbetweenDGH&Beicp-Franlab basins namely(i)Bengalonlandbasinand(ii)Kerala-Konkanoffshore basin. The studyis Petroleum systemmodelingstudies:DGHhastaken upthepetroleumsystemmodelingoftwo drilling activitiesareenvisaged. BRGM, (France)andMECL(India)inSeptember2007.Geologicalfieldmapping,sampling shale deposits andsyncrudepotentialinNorthEasternpart ofIndia”wassignedbetweenDGH, Oil ShaleInvestigations: The contractfortheproject“Resourceestimationinrespectofoil hydrocarbon gases. been completedin2007. About 1000soilsamples werecollectedandanalyzedforlight Geochemical surveysinDeccanSyneclineBasin:SurfaceSoilsamplinghas with ~100 TB data. seismic data hasbeencompleted for11246 (Rawdata 10372+Processeddata 874)Cartridges Archival fromlowerdensitymediatohigherofRawandProcessed2D/3D through GEOPIC,ONGC. The ProcessingandInterpretation of690.6GLKonland2Dseismicdata hasbeencompleted Narmada -CambaybasinbyNGRI. DGH hascompletedanalysisof Aerial images/Remotesensingdata for302,500sq.kmareain in CentralIndiathroughNGRI,Hyderabad. DGH hasacquired103stations {Sihore-Akola(63stns)&Indore-Jalgaon(40stns)}ofLandMT Fugro MulticlientservicesPtyLtd, Australia. Speculative 2Dseismic API projectacquing2109.113 LKMdata wascompletedthroughM/s. and interpretedthroughM/s.FugroData Services,Switzerland. Under Speculative 2Dseismic API project1498.35LKMdata hasbeenacquired,processed Geo Ltd., UK. Speculative reprocessingof2Dseismicdata of10638LKMwascarriedoutthroughMsSpectrum coast ofIndiawascompletedthroughMsGX Technology. Speculative 2Dseismic API project(India,Span-II) acquiring9632.5LKMdata inEast&West completed throughM/s.PGS. Speculative 2Dseismic API projectacquiring7240.725LKMdata inoffshore Andaman was SYNOPSIS OF ACTIVITIES TILL 2011-12 35 DGH Agreement/ Agreement/ MOU Services Pty Ltd Australia Switzerland signed with Petroscan 2008-10 GXT 2006-09 NGRI 2005-07 GXT 2003-04 NGRI 2007-08 GGS Spectrum 2009-10 Geo Ltd Spectrum 1997-98 Alpha Geo 2005-06 NRSA 2003-04 Alpha Geo 2003-05 NRSA 2010-12 GEOPIC, ONGC 1995-96 NRSA 1997-98 Alpha Geo (80 sq.km.) LKM &13Stn. 2006-08 NGRI 13 LKM 2009-10 Fugro Multiclient 600 & 50 stations, 2003-04 NGRI 4307.275 LKM12,000.65 LKM 2001-02 2002-03 Large Large 1498.35 LKM 2009-109632.5 LKM Fugro Data Services, 700 LKM 1484.75 LKM2835.925 LKM4319.45 LKM 1999 2001-02 2001-02 Large Western Geco Large 2146.5 sq. km. 2007-08 EMGS 16,174 LKM Achievement (API)Achievement Year 302,500 sq. km 2006-08 NGRI 7428.685 LKM &RI of 4625 LKM 1996-97of old data 3606.375 LKM &RI of 695 LKM Western Geophysical 1996-97of old data Western Geophysical 7240.725 LKM 2007-09 PGS 1.642 Million Sq. Km. 1995-98 352 Stations 1996-98 NGRI (12,000 LKM) (10,638 LKM) fshore fshore fshore 2109.1 fshore fshore fshore fshore Reprocessing fshore 133.984 fshore fshore Onland 103 Stations 2006-09 NGRI Offshore Offshore Offshore Onland Stations 303 Of Onland 690.6 GLK Area Offshore Reprocessing Offshore Onland INDIA -Activities Hydrocarbon Exploration and Production - 2011-12 GM Offshore (Acq.) seismic Of seismic Of Seismic Offshore Seismic (P&I) OnlandGLK 690.6 CSEM seismic2D seismic2D Of Of 2D Seismic 2D seismic 2D 2D 2D Seismic 2D Seismic Of 2D 2D seismic Onland 566 GLK 2D seismic2D Of 2D seismic 2D Seismic Land MT Land Airborne GM Onland 13,994.64 LKM 2009-10 Mcphar Aero-Magnetic Onland LKM 12,765 (Re-processing) (Re-processing) GM sensing data 2D seismic & GM Of Airborne HRAM Onland 55,668.3 LKM 2007-09 Mcphar 2D Seismic Onland LKM 1135.05 2002-03 Alpha Geo Aero-Magnetic OnlandLKM 11,958 Aero-Magnetic Onland 23,730 LKM MS & MMT& MS Of Gravity, MT, DRS, MT, Gravity, Onland 6000 Stations, 2D Seismic Onland 805.00 GLK 2D Images/ Remote Survey Type 2D seismic & Analysis of AerialAnalysis of Onland GEOSCIENTIFIC STUDIES BY DGH BY STUDIES GEOSCIENTIFIC OFFSHORE ONLAND Narmada-Tapti Area Narmada-Tapti Punjab and Foot Hills of Himalayas Punjab and Foot Hills OFFSHORE Deccan Syneclise ONLAND 26 Kutch 23 Coast (WC) West 16 and east coast West VI. GRAVITY -MAGNETIC SURVEYS & OTHER GEOPHYSICAL SURVEYS & OTHER GEOPHYSICAL -MAGNETIC SURVEYS VI. GRAVITY 29 (Amriti) Vindhyan 19 Andaman InfillSeismic 2D IV. SEISMIC SURVEYS IV. 20 (ST) Southern Tip 21 East Coast (EC) 22 Andaman-Nicobar (AN) 24 (GV) Ganga Valley 25 (CV) Chambal Valley 14 Offshore Western 15 Offshore Western 17 Andaman Islands of India 2D seismic Of SURVEYS GEOPHYSICAL INTEGRATED V. 28 Deccan Syneclise (DS) 27 Kutch III. SPECULATIVE SURVEYS III. SPECULATIVE 10 & Eastern Offshore Western 2D 9 (VN-ON-90/5) Vindhyan 5 Sl. Area/Block 30 Gulf of Kutch 31 Central India 32 Narmada-Cambay/ 6 East Coast II. JOINT VENTURE SPECULATIVE SURVEYS OFFSHORE SURVEYS II. JOINT VENTURE SPECULATIVE 7 Andaman-Nicobar 12 Andaman Ofshore 13 Eastern Offshore 18 Kutch 11 Offshore Western No. SURVEY I. RECONNAISSANCE 1 & Eastern Offshore Western Gravity Satellite 8 (GV-ON-90/5) Ganga Valley 2D seismic Onland 634 GLK 2 & Onland Offshore Kutch 34 Nagpur-Wardha-Belgaum Himalayan Foreland MT SYNOPSIS OF ACTIVITIES TILL 2011-12 36 DGH : NI yrcro xlrto n rdcinAtvte 2011-12 - Hydrocarbon Exploration andProduction Activities - INDIA GEOPHYSICAL SURVEYS CARRIEDOUTBY DGH GEOPHYSICAL SURVEYS CARRIEDOUTBY DGH MARINE SEISMIC GULF OFKUTCH & MT SURVEY & MT A N A B A R A E S I (AEROMAGNETIC SURVEY) BLOCK-3: KUTCH (SATELLITE GRAVITY SURVEY) GRAVITY(SATELLITE 55,668 LKM WESTERN OFFSHORE 8,05,000 Sq. Km. 8,05,000 Sq. PAKISTAN RAJASTHAN REMOTE SENSING DATA SENSING REMOTE ANALYSIS OF AERIAL / AERIAL OF ANALYSIS GUJARAT LAKSHA DWEEP SEISMIC SURVEY 2D ONLAND NARMADA-TAPTI BASIN STUDIES (100Stations) STUDIES MAGNETO TELLURICS GOA PUNJAB KARNATAKA DECCAN SYNECLISE DECCAN (INT. GEOPH. SURVEY) GEOPH. (INT. MAHARASHTRA HARYANA 40,000 Sq. Km. Sq. 40,000 JAMMU & KASHMIRJAMMU & (Cuddapah) KERALA Block-4 DELHI HIMALAYAN FOOTHILLS HIMALAYAN HIMACHAL PRADESH (HRAM SURVEY) TAMIL NADU 11,958 LKM (REGIONAL MTPROFILE) NAGPUR - BELGAON NAGPUR UTTARANCHAL MADHYA PRADESH NAGPUR - WARDHA NAGPUR ANDHRA PRADESH ANDHRA 12,000 Sq.Km. (MT SURVEY) (MT SRILANKA VINDHYAN (AMRITI) UTTAR PRADESH (G-M SURVEY)
80 Sq. Km. 80 Sq. N CHHATISGARH LAND MTSURVEY INT. GEOPHYSICAL SURVEYS (DS) SURVEYS GEOPHYSICAL INT. SATELLITE GRAVITYSURVEY AERIAL & RS STUDIES LAND GM SURVEY ANDAMAN INFILL SEISMIC SURVEYS SEISMIC SURVEYS SEISMIC
- Onland (GV ,CV & KUTCH)(GV ,CV - Onland - 2D MS & MMT - Deep Water (EC,ST&AN)
E P ORISSA JHARKHAND LEGEND
CHINA A (SATELLITE GRAVITY SURVEY) GRAVITY(SATELLITE ANDAMAN OFFSHORE
BIHAR L 2,92,000 Sq. Km. 2,92,000 Sq. (U.P., Bihar, Jharkhand & W.B.) Jharkhand Bihar, (U.P., WEST BENGAL (SATELLITE GRAVITY SURVEY) GRAVITY(SATELLITE EASTERN OFFSHORE 5,45,000 Sq. Km. 5,45,000 Sq. SIKKIM Block-1 BANGLADESH BHUTAN MEGHALAYA BENGAL SPECULATIVE SURVEYS SPECULATIVE JV SPECULATIVE SURVEYS SPECULATIVE JV -OffshoreCoast &Andaman) (East & VN-ON-90/5) (GV-ON-90/5 -Onland - INDIA SPAN(16,174 LKM) -SEISMIC SURVEY (7,240.725 LKM) ANDAMAN& NICOBAR ISLANDS - IDF (1498 LKM) - RE-PROCESSING (10,638LKM) - RE-PROCESSING (12,000 LKM) - CSEM (2,146.5 ) -CSEM SKM - IDF-II (2109.1 LKM) - &HRAMSURVEYAGM - INDIA SPAN-II (9632.5 LKM) TRIPURA BAY OF ASSAM MIZORAM MANIPUR ARUNACHAL PRADESH NAGALAND MYANMAR (BURMA) (Manipur & Nagaland) & (Manipur Block-2 DGH ACTIVITIES DURING THE YEAR 2011-12 ACTIVITIES DURING THE YEAR 2011-12
- E&P Highlights - NELP-IX blocks awarded (till 31.03.12) - Oil & Gas Production - Hydrocarbon Discoveries
INDIA - Hydrocarbon Exploration and Production Activities - 2011-12 37 DGH
38 INDIA - Hydrocarbon Exploration and Production Activities - 2011-12 DGH
EXPLORATION & PRODUCTION HIGHLIGHTS 2011-12
S. Subject Parameter ONGC OIL Pvt/JVs Total No. (Nomination) (Nomination)
1 Initial In-place reserves Gas (BCM) 2123.99 332.79 1255.30 3712.08 (as on 01.04.2012) Oil (MMT) 4526.73 787.97 816.56 6131.26 O+OEG (MMT) 6650.72 1120.76 2071.86 9843.34
2 Ultimate Reserves Gas (BCM) 1200.48 180.72 676.59 2057.79 (as on 01.04.2012) Oil (MMT) 1429.40 236.72 194.89 1861.01 O+OEG (MMT) 2629.88 417.44 871.48 3918.80
3 Accretion of In-place reserves Gas (BCM) 97.95 6.00 46.59 150.54 Oil (MMT) 99.09 11.62 - 4.11 106.6
O+OEG (MMT) 197.04 16.91 42.48 251.14 ACTIVITIES DURING THE YEAR 2011-12
4 Accretion of Ultimate Reserves Gas (BCM) 43.76 2.69 35.92 82.37 Oil (MMT) 33.16 6.03 0.00 39.19 O+OEG (MMT) 76.92 8.40 35.92 118.87
5 2D seismic data acquired Onland (GLKM) 2535 758.97 4180 7473.97 Offshore (GLKM) 11071 0.0 35764 46835 TOTAL 13606 758.97 39944 54308.97
6 3D seismic data acquired Onland (SKM) 2315 267.70 5180 7762.70 Offshore (SKM) 7506 0.00 19346 26852 TOTAL 9821 267.70 24526 34614.70
7 Exploratory wells drilled Onland 100 12 39 151 Offshore 35 0 26 61 TOTAL 135 12 65 212
8 Development wells drilled Onland 238 23 76 337 Offshore 42 0 10 52 TOTAL 280 23 86 389
9 Exploratory meterage drilled Onland (‘000 M) 244.65 45.10 82.78 372.53 Offshore (‘000 M) 130.79 0 82.12 212.91 TOTAL 375.44 45.10 164.90 585.44
10 Development meterage drilled Onland (‘000 M) 445.58 71.43 118.37 635.38 Offshore (‘000 M) 113.11 0 7.78 120.89 TOTAL 558.69 71.43 126.15 756.27
11 Oil & Gas production Gas (BCM) 23.32 2.63 21.52 47.47 Oil (MMT) 23.71 3.85 10.53 38.09 O+OEG (MMT) 47.03 6.48 32.05 85.56 CBM (BCM) - - - 0.084 ♦ Issuance of Essentiality Certificates for import of goods used in petroleum operations. 9 Clearances issued during April 2011 to March 2012. 11,577 cases valued at Rs. 2,511.11 Crores.
INDIA - Hydrocarbon Exploration and Production Activities - 2011-12 39 DGH
EXPLORATION BLOCKS AWARDED UNDER NINTH ROUND OF NELP (NELP-IX) (As on 01.04.2012)
SL BASIN BLOCK REF. NO CONSORTIUM DATE OF AWARDED NO. NAME ON MAP (PARTICIPATING SIGNING AREA INTEREST) CONTRACT (SQ. KM.)
SHALLOW WATER 1. GUJARAT-KUTCH GK-OSN-2010/1 S-1 ONGC(60), OIL(30) & GAIL (10) 28-03-2012 1,361 2. GK-OSN-2010/2 S-2 ONGC(90) & GAIL (10) 28-03-2012 1,625
TOTAL AREA : 2,986
ONLAND 3. ASSAM-ARAKAN AA-ONN-2010/2 2 OIL(40), ONGC(30), GAIL(20) & 28-03-2012 396 East West Petroleum (10) 4. AA-ONN-2010/3 3 OIL(40), ONGC(40) & BPRL(20) 28-03-2012 171 5. VINDHYAN VN-ONN-2010/1 4 Deep Energy LLC(10)&KGNIndustries (90) 28-03-2012 3776 6. VN-ONN-2010/2 5 Deep Energy LLC (10), Deep Natural 28-03-2012 4909 Resources Limited (15) & Safak WSB Energy Pvt. Ltd. (75) 7. RAJASTHAN RJ-ONN-2010/2 8 Focus Energy Ltd. (10) & 28-03-2012 535 Birkbeck Investments Ltd. (90) 8. CAMBAY CB-ONN-2010/1 9 ONGC (100) 28-03-2012 782 9. CB-ONN-2010/3 11 Deep Energy LLC (10) & 28-03-2012 534 KGN Oil & Gas Pvt. Ltd. (90) 10. CB-ONN-2010/4 12 Pratibha Oil & Natural Gas Pvt. Ltd.(100) 28-03-2012 61 11. CB-ONN-2010/5 13 Pan India Consultants (20) & 28-03-2012 49 Frost International Ltd. (80) 12. CB-ONN-2010/6 14 ONGC (80) & IOC (20) 28-03-2012 39 13. CB-ONN-2010/10 18 Sankalp (100) 27-06-2012 122 14. CB-ONN-2010/11 19 GAIL (25), BPRL (25), EIL (20) 28-03-2012 131 BFIL (15) & MIEL (15)
TOTAL AREA : 11,505 GRAND TOTAL : 14,491 SQ.KM.
ONGC - Oil & Natural Gas Corpn. Ltd. ACTIVITIES DURING THE YEAR 2011-12 ACTIVITIES DURING THE IOC - Indian Oil Corpn. Ltd. OIL - Oil India Ltd. GSPC - Gujarat State Petroleum Corporation Ltd. FEL - Focus Energy Ltd. BPRL - Bharat Petroleum Resources Ltd. Deep Energy - Deep Energy LLC., USA Pan - Pan India Consultants Sanklap - Sankalp Oil & Natural Resources Ltd. BIL - Birkbeck Investment Ltd., Mauritius GAIL - Gas Authority of India Ltd. East West - East West Petroleum DNRL - Deep Natural Resources Limited SWSBEPL - Safak WSB Energy Pvt. Ltd. KGN - KGN Oil & Gas Pvt. Ltd. FIL - Frost International Ltd. EIL - Engineers India Ltd. BFIL - BF Infrastructure Ltd. MIEL - Monnet & Esspat Energy Ltd.
40 INDIA - Hydrocarbon Exploration and Production Activities - 2011-12 DGH
COMPANY / BASIN WISE OIL & GAS PRODUCTION (01.04.2011 TO 31.03.2012)
Sl. COMPANY / BASIN PRODUCTION No. OPERATOR OIL (MMT)* GAS (MMSCM) O+OEG (MMT) NATIONAL OIL COMPANIES (NOC) 1 ONGC Rajasthan — 16 0.016 2 Cambay 5.630 1939 7.569 3 Cauvery Onland 0.246 1285 1.531 4 KG (Onland & Offshore) 0.343 1389 1.732 5 Assam-Arakan 1.205 1148 2.353 6 Mumbai Offshore 16.289 17540 33.829 TOTALONGC 23.719 23317 47.03 7 OIL Rajasthan — 223 0.223 8 Assam-Arakan 3.847 2410 6.257
TOTAL OIL 3.847 2633 6.48 ACTIVITIES DURING THE YEAR 2011-12 TOTAL NOCs 27.56 25950 53.51 PVT / JV COMPANIES 9 CAIRN KG Offshore 1.340 633.462 1.973 10 Gulf of Cambay 0.240 211.917 0.452 11 Rajasthan 6.552 287.838 6.840 12 RIL KG Offshore 0.681 15611.410 16.292 13 BG-RIL-ONGC Mumbai Offshore 1.417 4299.878 5.717 14 GEO-ENPRO Assam-Arakan 0.092 21.579 0.113 15 GOI - ACL Assam-Arakan 0.0009 8.417 0.001 16 HOEC Cambay 0.009 11.649 0.021 17 Cauvery Offshore 0.005 139.668 0.144 18 JTI Cambay 0.037 9.094 0.046 19 NIKO Cambay 0.021 197.110 0.218 20 SELAN Cambay 0.026 9.508 0.035 21 HERAMAC Cambay 0.002 3.199 0.005 22 HRDCL - PPCL Cambay 0.0001 0.135 0.000 23 GSPCL Cambay 0.051 3.213 0.054 24 HARDY Cauvery Offshore 0.050 13.503 0.062 25 OILEX Cambay 0.001 0.000 0.001 26 ESSAR Cambay 0.001 0.000 0.001 27 FOCUS Rajasthan 0.0006 63.193 0.064
TOTAL PVT./JV 10.53 21524 32.05
TOTAL 38.09 47474 85.56 COAL BED METHANE (CBM) 1 GEECL Raniganj South 0.0 70.04 0.070 2 ESSAR Raniganj East 0.0 9.066 0.0090 3 ONGC Jharia 0.0 3.559 0.0035 4 RIL Sohagpur East 0.0 0.381 0.0003 5 Sohagpur West 0.0 1.144 0.0011 TOTAL 0.0 84 0.084 INDIA GRAND TOTAL 38.09 47558 85.644 * NOTE : FIGURES INCLUSIVE OF CONDENSATE (MMT)
INDIA - Hydrocarbon Exploration and Production Activities - 2011-12 41 DGH
INITIAL IN-PLACE AND ULTIMATE RESERVES OF HYDROCARBONS (AS ON 01-04-2012)
INITIAL IN-PLACE ULTIMATE RESERVES
11% 11%
22% 21% 67% 68%
OIL PVT/JV ONGC OIL PVT/JV ONGC
EXPLORATORY WELLS DRILLED (2011-12)
ONLAND OFFSHORE 0% 8%
26% 43%
57% 66%
ACTIVITIES DURING THE YEAR 2011-12 ACTIVITIES DURING THE OIL PVT/JV ONGC OIL PVT/JV ONGC
TOTAL EXPLORATORY WELLS
6%
30%
64%
OIL PVT/JV ONGC
42 INDIA - Hydrocarbon Exploration and Production Activities - 2011-12 DGH
DEVELOPMENT WELLS DRILLED (2011-12)
ONLAND OFFSHORE 0% 7% 19%
22%
71% 81%
OIL PVT/JV ONGC OIL PVT/JV ONGC ACTIVITIES DURING THE YEAR 2011-12
TOTAL DEVELOPMENT WELLS
6%
22%
72%
OIL PVT/JV ONGC
OIL & GAS PRODUCTION (2011-12)
GAS PRODUCTION OIL PRODUCTION O+OEG PRODUCTION
OIL OIL OIL 7% 8% 9%
ONGC Pvt/JV ONGC Pvt/JV Pvt/JV ONGC 69% 15% 73% 19% 24% 76%
INDIA - Hydrocarbon Exploration and Production Activities - 2011-12 43 DGH
HYDROCARBON DISCOVERIES
A total of 35 hydrocarbon discoveries have been made by ONGC (25), OIL (7), RIL (2) & CEIL (1) in Nomination, NELP and Pre-NELP blocks and fields during 2011-12.
Sl. Basin/State Prospect Name Discovery Well Name of Type of No. PEL / ML / NELP Discovery NOMINATION REGIME ONGC 1 Western Offshore(SW) BH-67 BH-F BOFF-123 PEL Gas 2 B-127E-A B-127E-1 BOFF-123 PEL Oil & Gas 3 GK-42-1 GK-42-A Kutch Off. Block-I Ext. PEL Oil & Gas 4 Western Onland East Linch (New pool) LNBU (LN-81) Linch ML Oil 5 North Kadi (New pool) NK-472 (NKXV) Jakasana ML Oil 6 Viraj (New pool) Viraj-58 (VJEP) Viraj ML Oil 7 North Kadi (New pool) North Kadi-461 (NKPI) Linch Extn.I ML Oil 8 KG Offshore (SW) GS-70-1 (New pool) GS-70-AA GS-15/23 ML Oil & Gas 9 GS-29-AH GS-29-6 GS-29 ML Oil & Gas 10 Cauvery Onland Periyakudi-1 Periyakudi-1 (PDAA) L-II PEL Oil & Gas 11 North Kovilkalappal North Kovilkalappal-3 L-II PEL Oil & Gas (NKKAA) 12 Cambay KVAD Vemardi-1 Karjan Extn.-II PEL Oil & Gas 13 Vindhyan (Frontier) Nohta-2 (New pool) R-NA-B Damoh-Jabera-Katni PEL Gas 14 A&AA / Assam Patharia Pattharia-5 (PTAA) Karimganj Dist. PEL Gas 15 GKAP G-354 Namti ML Oil & Gas 16 Khoraghat KH-31 (KHAV) Nambar ML Oil 17 A&AA / Tripura Gojalia (New pool) Gojalia-13 (GOAB) Gojalia ML Gas OIL 18 A&AA / Assam Dikcham Structure DIROI-5 Moran Extension ML Oil 19 A&AA / Assam Amgurigaon Structure NHK-595 Naharkatiya Extension ML Oil 20 A&AA / Assam Kharikatia Structure NHK-594 Chabua ML Gas + Cond. ACTIVITIES DURING THE YEAR 2011-12 ACTIVITIES DURING THE 21 A&AA / Assam North West Makum Makum-41 Hugrijan ML Oil 22 A&AA / Assam West Makum Structure Makum-43 Hugrijan ML Gas 23 A&AA / Assam East Zaloni Structure NHK-597 Hugrijan PML Gas 24 A&AA / Assam Balimara Structure Balimara-1 Dumduma ML Oil
PSC REGIME Sl. Operator Block / Field Discovery Well Name of Discovery Type of No. Discovery 25 ONGC GS-OSN-2004/1 GSSO41NAA-1 GSSO41NAA-1 Gas 26 CB-ONN-2004/3 Uber-2 Uber-2 Gas + Cond. 27 KG-OSN-2004/1 Chandrika South-1 NACS-1 Gas 28 KG-OSN-2004/1 Alankari -1 KGOSNO41NAAL-1 Gas+Cond. 29 NEC-DWN-2002/2 MDW-13 MDW-13 Gas 30 AA-ONN-2001/2 Hortoki-1 Hortoki-1 (HOAB) Gas 31 AN-DWN-2002/1 ANDW-1 ANDW-1 (ANDW-C) Gas 32 CB-OSN-2003/1 Aliabet # 3 Aliabet # 3 - ABAF Gas + Cond. 33 RIL CY-PR-DWN-2001/2 CYPR-D6 Dhirubhai – 53 Gas + Cond. 34 KG-DWN-2001/1 KG-D9-A2 Dhirubhai – 54 Gas 35 CEIL KG-ONN-2003/1 Nagayalanka-SE-1 Nagayalanka-SE-1 Oil & Gas
44 INDIA - Hydrocarbon Exploration and Production Activities - 2011-12 DGH
NEW DISCOVERIES CHANDRIKA SOUTH #1 (KG-OSN-2004/1) OPERATOR : ONGC Structure / Testing Result Leads / Expl. Efficacy Well No. & Location Chandrika South The 1941 Lower Pliocene The discovery opened up a new hitherto Channel / Chandrika south channel sand was untested Lower Pliocene channel area for KGOSN041NACS#1 / tested in two intervals of 1978.5- Exploration in the block . This new discovery KG-OSN-2004/1 1975.5, 1974-1972m, and 1946.5 - in the block KG-OSN-2004/1 has led to 1952m and found to be gas bearing accretion of In-place of 7.65 BCM
KGOSN041NACS#1 ACTIVITIES DURING THE YEAR 2011-12
Depth Map on CS Channel with RMS attribute Seismic Section along XL: 5111 passing through showing CS#1 the well CS#1 (KG-OSN-2004/1) ALANKARI#1 (KG-OSN-2004/1) OPERATOR : ONGC
Structure / Testing Result Leads / Expl. Efficacy Well No. & Location Alankari / The Mio-Pliocene sand pack from The discovery opened up the Mio-Pliocene KGOSN041NAAL#1/ 1738- 1832m. The well tested in the play for further exploration. This new KG-OSN-2004/1 interval from 1829.5-1832m and discovery in the block KG-OSN-2004/1 has found to be gas bearing led to accretion of In-place of 3.20 BCM KGOSN041NAAL#1
Depth Map near to Alankari Pay top Seismic Section along passing through the well Al#1 (KG-OSN-2004/1)
INDIA - Hydrocarbon Exploration and Production Activities - 2011-12 45 DGH
NEW DISCOVERIES MDW-13 (NEC-DWN-2002/2) OPERATOR : ONGC Structure / Testing Result Leads / Expl. Efficacy Well No. & Location
Top of Mid. Miocene / The mid Miocene sand pack Net First time Hydrocarbon evidence and their MDW-13 / pay is 7.3m and 0.9813 production potentiality have been assessed NEC-DWN-2002/2 MMscmd Flow rate has been from Mid. Miocene in the block NEC-DWN- observed. 2002/2. As a follow one well MDW-14 has been drilled and found gas bearing.
MDW-13 N
Miocene Top MDW-13
Mid-Miocene Top
Within Mid-Miocene
DD: 4904m
Inline 1580 Passing Through Well MDW-13 Depth Map on Top of Mid. Miocene ANDW#1 (AN-DWN-2002/1) OPERATOR : ONGC
Structure / Testing Result Leads / Expl. Efficacy Well No. & Location
ANDW-1 / Depth: 3084.2m, Formation Pressure: First time gas discovery has been made in the 4645.42 psi (1.06 MWE), Mobilit y: 32.86, Andaman deep waters in well ANDW#1(Mio- AN-DWN-2002/1 / Pliocene).On analyzing the data operator submitted no Mio-Pliocene Sequence Permeabilty:55 MD, Open hole form thickness considered: 2.7m, potential commercial interest notification because the reservoirs are very thin and silt to very fine sands and AOFP: 1.55 MMscmd could not be traced for its lateral extension. ACTIVITIES DURING THE YEAR 2011-12 ACTIVITIES DURING THE
ANDW-1
ANDW-2 Area I Target-I Area VII ANDW-4
Target-II ANDW-3 Area III Target-III Area VIII
Area IV ANDW-1
Block AN-DWN-2002/1 showing the Inline 1947 showing the drilled wells with Target (I-III) 3D Areas and wells.
46 INDIA - Hydrocarbon Exploration and Production Activities - 2011-12 DGH
NEW DISCOVERIES ALIABET #3 - ABAF/BALB-4(CB-OSN-2003/1) OPERATOR : ONGC
Structure / Testing Result Leads / Expl. Efficacy Well No . & Location Hazad Top(MiddleEocene) Obj I: 2184.5 – 2183 m (MD) This gas discovery in CB-OSN-2003/1 within /Aliabet #3/ 2181 – 2176m (MD) NELP-V block will open up significant area for 6mm Bean: Gas @ 39954 m3/d further exploration and exploitation. In this CBͲOSNͲ2003/1 Condensate @ 11 m3/d discovery Operator found New Sands which are FTHP : 2050 Psi, CHP: 2100 Psi not present in Aliabet # 2 discovery.
Aliabet-3
ALIABET-3
Dadhar Top ACTIVITIES DURING THE YEAR 2011-12
Hazad Top Y-MARKER
Int erpre te d S ei smi c li ne 450 -A27 pass ing WllLWell Log M Mtiffotif of Time Structure Map near top of Hazad with through proposed location Aliabet-3 Aliabet-3 pinchout boundries of various sand units HOAB (AA-ONN-2001/2) OPERATOR : ONGC
Structure / Testing Result Leads / Expl. Efficacy Well No. & Location Bhuban /HOAB/ Object IV : 3287 – 3292 (Lower Bhuban The success of this well in Mizoram NELP Block, AAͲONNͲ2001/2 Fti)Formation) AA-ONN-2001/2 has opened upanew area in 4 mm bean, gas flow 5, 52,674 SCF /d this logistically tough and geologically challenging with 147 KSc SCHP , 103 KSc STHP fold belt for future exploration. and Flare height 6-7 ft.
Location map of block AA-ONN-2001/2
Isochron Map of a Horizon close to Middle Bhuban Top Interpreted Seismic Section along the line M07-07
INDIA - Hydrocarbon Exploration and Production Activities - 2011-12 47 DGH
NEW DISCOVERIES GSS041NAA-1(GS-OSN-2004/1) OPERATOR : ONGC Structure / Testing Result Leads / Expl. Efficacy Well No . & Location
Mesozoic / GSS041NAA-1 / MDT Results: This is first hydrocarbon discovery in the NELP GS-OSN-2004/1 Obj 1: 4795.5m- 4784.5m (11m) Block of Western Offshore. The discovery made in ¼ ‘’ : Gas 40606 m3/d block, GS-OSN-2004/1 has opened up the area FTHP: 1080 psi for future exploration in Mesozoic section. FTHT: 85 deg F
GSS041NAA-1
Seismic section showing through well GSS041NAA-1 Structure Map ABJECT-I Pay Top UBER-2 (CB-ONN-2004/3) OPERATOR : ONGC
Structure / Testing Result Leads / Expl. Efficacy Well No. & Location
(Hazad Member-GS-6 OBJECT-II : 2177.5-2173.5 Gas This is anew gas discovery in NELP block, sand) UBER# 2 @33086 m3/d & con densa te 37. 5 m 3/d CB-ONN-2004/3 whic h will open up siifitignificant area CB-ONN-2004/3 for exploration and exploitation. ACTIVITIES DURING THE YEAR 2011-12 ACTIVITIES DURING THE SW UBER-2 NE
UBER-2
Time Structure Map at Hazad Top
Well Log Motif of UBER-2 3D Seismic inline 540 passing through well UBER-2
48 INDIA - Hydrocarbon Exploration and Production Activities - 2011-12 DGH
NEW DISCOVERIES B-127E-A /B-127E-1 (BOEF 123 PEL) OPERATOR : ONGC
Structure / Testing Result Leads / Expl. Efficacy Well No. & Location
B-127E-A /B-127E-1/ Object I: 2651.5 – 2648.5 & 2638.5 – 2637 This discovery has opened up the area for BOEF 123 PEL (Panna Formation) further exploration and would also help in Oil: 1076 bopd incremental value creation for the planned Gas: 1,88,704 m3/day at half inch B-127-B-55 cluster. FTHP: 1700 psi ACTIVITIES DURING THE YEAR 2011-12
Inline 2545 through well B-127E-1 Structure Map H4 showing B-127E prospect BH-67 (BOEF 123 PEL) OPERATOR : ONGC
Structure / Testing Result Leads / Expl. Efficacy Well No. & Location
BH-67 / BOEF-123 PEL / Object I: 2066 – 2064 & 2062.5 – This discovery is the south of Bombay High field in Oligocene 2059.5 (Basal Formation, Oligocene) Basal Clastics has opened up scope for further ½’’ choke: exploration in Basal clastics in the nearby areas. Gas: 130000 m3/day FTHP: 1000psi
Line 2100 passing through well BH-67 Well Log Motif of BH-67
INDIA - Hydrocarbon Exploration and Production Activities - 2011-12 49 DGH
NEW DISCOVERIES G-354 / GKAP (Namti PML) OPERATOR : ONGC
Structure / Testing Result Leads / Expl. Efficacy Well No . & Location
GKAP / Geleki-354 / Namti Obj-I: 2877-2868m (Tipam Formation, Miocene) The multiple pays encountered in PML Block / Miocene Oil: 107 m3/day, 6mm bean this well have reinforced the Gas: 11314 m3/day, 6mm bean prospectivity of south-west Geleki FTHP: 97 kg/cm2 area. Commercial hydrocarbon Obj-II: 2810-2804m (Tipam Formation, Miocene) production from TS-3B has Oil: 72 m3/day, 6mm bean, established a new pool together with Gas: 12706 m3/day, 6mm bean TS-3A indicating increase in FTHP: 60 kg/cm2 hydrocarbon column towards south.
OBJ-I OBJ-II Log Motif of Object-I & Object-II in well G-354 (GKAP) Structure Contour Map on Top of TS-3B GK-42-1 / GK-42-A (KUTCH OFFSHORE BLOCK-1 PEL) OPERATOR : ONGC
Structure / Testing Result Leads / Expl. Efficacy Well No. & Location
GK-42-1 / GK-42-A / Object-I: 1372-1369m, Nakhatrana Formation, The discovery in the south of GK-28 Kutch Offshore Block – Palaeocene) prospect has given a boost to exploration in 1 Extension PEL / 3/8” Choke: this part of Kutch Offshore Basin and has Gas: 9898 m3/day, Liquid: 36 blpd (Oil water opened up scope of early monetization of Palaeocene emulsion with 20% oil), FTHP: 250 psi discoveries. ACTIVITIES DURING THE YEAR 2011-12 ACTIVITIES DURING THE
Well log motif of GK-42-1 GK-42 Prospect Structure Seismic section passing through well GK-42-1 Contour Map of Paleocene Pay
50 INDIA - Hydrocarbon Exploration and Production Activities - 2011-12 DGH
NEW DISCOVERIES GS-29-AH/GS-29-6 (GS-29 PML) OPERATOR : ONGC
Structure / Testing Result Leads / Expl. Efficacy Well No . & Location
GS-29-AH / GS-29-6 / GS-29 Object-I: 2390–2414.5m (Ravva Formation, Miocene) This discovery along with the PML/ Miocene Oil: 617 m3/day, 32/64” Choke successful delineation of GS- Gas: 1,23400 m3/day, 32/64” Choke 29-1 pay sand would enable to FTHP: 2377 psi go forward with the formulation Object-II: 2237–2245 m (Ravva Formation, Miocene) development plan of GS-29 Oil Oil: 570.33 m3/day, 32/64” Choke discovery. Gas: 1,18925 m3/day, 32/64” Choke FTHP: 2262 psi ACTIVITIES DURING THE YEAR 2011-12
WellLogmotifofGSWell Log motif of GS-29-6(AH)6 (AH) Seismic line : 642 through well GS-29-6 (AH) showing oil bearing sand KH-31 (KHAV) (NAMBER PML) OPERATOR : ONGC
Structure / Testing Result Leads / Expl. Efficacy Well No. & Location
KH-31 (KHAV) / Nambar Object: 2288–2290 & 2296-2298m This first oil discovery in Kopili Formation in PML/ Late Eocene (Kopilli Formation, Late Eocene) Khoraghat-Nambar area towards the southern part of Oil: 64 m3/day, 6mm bean Dhansiri Valley will lead to further exploration Gas: 3100 m3/day, 6mm bean activities in the area. FTHP: 63 kg/cm2
Structure Map on close Inline 852 passing through well KH-31 (KHAV) to Kopili pay top Well Log motif of KH-31 (KHAV)
INDIA - Hydrocarbon Exploration and Production Activities - 2011-12 51 DGH
NEW DISCOVERIES NORTH KOVIKALAPPAL-03 (NKK-3) (L-II PEL) OPERATOR : ONGC
Structure / Testing Result Leads / Expl. Efficacy Well No . & Location
NKKAA / North Object: 2135–2145m (Andimadam This has opened up the area further east of Kovikalappal-03/ L-II PEL Formation, Cretaceous) NKK-1 for exploration/appraisal. Block/ Cretaceous Oil: 80 m3/day, 6mm bean Gas: 10000 m3/day, 6mm bean FTHP: 84.4 Ksc
Structure Contour Map on Line TR 2160 passing through well KK-23 & NKK-3 top of Sand Well Log motif of NKK-3 PATHARIA-5 (KARIMGANJ DISTRICT PEL) OPERATOR : ONGC
Structure / Testing Result Leads / Expl. Efficacy Well No. & Location
PTAA / Patharia - 5/ Object I: 1136-1128m (Bokabil Formation, Miocene) The success of this well has Karimggjanj District PEL Gas: 9400 m3/dayy, with little water, 3mm bean reinforced the hydrocarbon Block/ Miocene FTHP: 44 Ksc prospectivity of the northern plunge Object II: 1121-1114m (Bokabil Formation, Miocene) of Patharia Anticline in Cachar Fold
ACTIVITIES DURING THE YEAR 2011-12 ACTIVITIES DURING THE Gas: 4820 m3/day with little water, 4mm bean Belt areas. FTHP: 45 Ksc
Time map on the top of a reflector close to new Seismic Section IL 650 passing through well PT-5 gas sand of PT-5 (within Bokabil)
52 INDIA - Hydrocarbon Exploration and Production Activities - 2011-12 DGH
NEW DISCOVERIES PERIYAKUDI-1 (PDAA) (L-II PEL) OPERATOR : ONGC
Structure / Testing Result Leads / Expl. Efficacy Well No . & Location
PDAA / Periyakudi-1/ L-II Object: 4350-4273 m (Andimadam Besides the presence of hydrocarbons in PEL Block/ Cretaceous Formation, Cretaceous) deeper horizons of Early Creataceous having Oil: 3.34 m3/day, 6mm bean huge reservoir thickness. Pattern of Gas: 5500 m3/day, 6mm bean hydrocarbon occurrence has opened new vistas in Synrift Exploration in Cauvery Basin. FTHP: 15.8 Ksc ACTIVITIES DURING THE YEAR 2011-12
Line 2239 through well PD-1 Well Log motif of PDAA Vemardi-1 (KVAD) (KARJAN EXTN.-II PEL) OPERATOR : ONGC
Structure / Testing Result Leads / Expl. Efficacy Well No. & Location
KVAD / Vemardi-1 (B- Object: 578-576.5 & 572.5-571m (Ankleshwar This is a new prospect discovery Vemardi)/) / Karjan Ext. II Formation, Middle to Upper Eocene) which will result in reserve PEL/ Middle to Upper Oil: 5 m3/day, 6mm bean accretion and additional area for Eocene Gas: 6336 m3/day, 6mm bean development FTHP: 525 psi
KVAD
Inline 927 passing through location KVAD Time map close to Trap top
INDIA - Hydrocarbon Exploration and Production Activities - 2011-12 53 DGH
NEW DISCOVERIES DIROI-5 (MORAN EXTENSION ML) OPERATOR : OIL
Structure / Testing Result Leads / Expl. Efficacy Well No . & Location
Dikcham Structure in Moran Object: 4503.5-4508.5, 4504-4508 and The discovery of oil within the Lakadong + Extension ML / DIROI-5 (Loc. 4498-4503m (Lakadong & Therria sand Therria sand in this well has opened up new MFH)/ Palaeocene-Lower / Palaeocene-Lower Eocene) area for exploration in Diroi Area especially in A total of 331 bbls of well-fluid was Palaeocene-Lower Eocene formations. The Eocene unloaded by NPU/CTU/self-unloading. well has helped in accretion to In-place volume Oil: 98.5% traces (API: 28.6-32.8°, of O+ OEG in 2P Category is about 0.30 PP: 30-33°C) MMSKL..
Well Diroi -5 : Depth Contour Map Close to Seismic section XL-159 across well Diroi-5, Borbil-Diroi 3D Lakadong +Therria Top NHK-595 (NAHARKATIYA EXTENSION ML) OPERATOR : OIL
Structure / Testing Result Leads / Expl. Efficacy Well No. & Location
Amgurigaon Structure in Object: 2808 - 2820m (Barail The discovery of oil within the Barail Formation in Naharkatiya Extension Formation / Upper Eocene to Lower this well has opened up new area for exploration in ML / NHK-595 (Loc. Oligocene) Amgurigaon area within Nahakatiya Extension ML Oil: 48 KLPD @6mm bean, 99.5% area. This well has helped in accretion to In-place NLC)/ Upper Eocene to (API: 27.30, PP: 360C) volume of O+OEG in 2P Category is about 4.38 Lower Oligocene
ACTIVITIES DURING THE YEAR 2011-12 ACTIVITIES DURING THE FTHP: 52.7 kg/cm2 MMSKL.
Amgurigaon Structure well NHK-595) - Depth Inline 372 passing through well NHK-595 Contour Map Close to Barail Top
54 INDIA - Hydrocarbon Exploration and Production Activities - 2011-12 DGH
NEW DISCOVERIES NHK-594 (CHABUA ML) OPERATOR : OIL
Structure / Testing Result Leads / Expl. Efficacy Well No. & Location
Kharikatia structure in Object: 3744.0-3746.0 m (Lakadong The discovery of gas within the Lakadong & Chabua ML/ NHK-594 (Loc. & Therria sand / Palaeocene-Lower Therria sand in this well has opened up new area CM)/ Palaeocene Lower- Eocene) for exploration in Kharikatiya area especially in Gas: 50,000-55000 SCUMPD and Palaeocene-Lower Eocene formations within Eocene about 10klpd condensate through Chabua ML area. The well has helped in 4mm bean. FTHP: 263-264 kg/cm². accretion to In-place volume of O+OEG in 2P Category is about 0.63 MMSKL. ACTIVITIES DURING THE YEAR 2011-12
Kharikatia Structure with well NHK-594 – Depth Seismic section XL-1175 passing through well NHK-594 Contour Map Close to Langpar Top MAKUM-41 (HUGRIJAN ML) OPERATOR : OIL
Structure / Testing Result Leads / Expl. Efficacy Well No. & Location
North-West Makum Object: 2657.5-2663.5m & 2650.5-2654m The discovery of oil within the Barail Arenaceous structure of Makum-North (Barail Formation / Upper Eocene to zone in this well has opened up anew ppylay for Hapjan oil field in Hugrijan Lower Oligocene) exploration/exploitation in North-West Makum ML/ Makum-41 (Loc. HVI) / Oil: 42 klpd (Oil: 38 klpd & water: 4 klpd) structure within Hugrijan ML area. This well has Upper Eocene to Lower through 6.5 mm bean, helped in accretion to In-place volume of Oligocene (API: 14.2°, PP: <9°C), FTHP: 27 kg/cm². O+OEG in 2P Category is about 4.58 MMSKL.
Seismic Inline 1741 (Khagorijan-Matimekhana3D) with NW Makum Structure with well MKM-41 – Depth well MKM-41 (NW Makum) Contour Map Close to 34mfs/Near Top Barail 3/4
INDIA - Hydrocarbon Exploration and Production Activities - 2011-12 55 DGH
NEW DISCOVERIES MAKUM-43 (HUGRIJAN ML) OPERATOR : OIL
Structure / Testing Result Leads / Expl. Efficacy Well No . & Location
West Makum structure in Object: 2696-2702m (Barail Formation The discovery of gas within the Barail Hugrijan ML/ Makum-43 (Loc. / Upper Eocene to Lower Oligocene) Formation in this well has opened up new play HVL) / Upper Eocene to Lower Gas: 50,000 SCMD with minor amount for exploration/ exploitation in West Makum Oligocene of condensate through 5 mm bean structure within Hugrijan ML area. The well has FTHP: 179 kg/cm2. helped in accretion to In-place volume of O+ OEG in 2P Category is about 0.62 MMSKL.
Seismic crossline 1173 (Khagorijan -Matimekhana3D) with West Makum Structure with well MKM-43 – Depth well MKM-43 (West Makum) Contour Map Close to 34mfs/Near Top Barail NHK-597 (HUGRIJAN ML) OPERATOR : OIL
Structure / Testing Result Leads / Expl. Efficacy Well No. & Location
East Zaloni structure in Object: 1549.0-1455.0m (Girujan The discovery of gas within Girujan Formation in this Huggjrijan ML/ NHK-597 (Loc. Formation / Miocene to Pliocene) well has opened up new gas ppylay exploration HUM)/ Miocene to Gas: 14,200 SCMD through 4 mm /exploitation in the Area within Hugrijan ML area. This Pliocene bean. FTHP: 136 kg/cm2. well has helped in accretion to In-place volume of O+ OEG in 2P Category is about 0.10 MMSKL. ACTIVITIES DURING THE YEAR 2011-12 ACTIVITIES DURING THE
East Zaloni Structure with well NHK-597 In line 77 passing through well NHK-597 (Loc. HUM) Depth Contour Map Close Top Girujan
56 INDIA - Hydrocarbon Exploration and Production Activities - 2011-12 DGH
NEW DISCOVERIES Balimara-1 (DUMDUMA ML) OPERATOR : OIL
Structure / Testing Result Leads / Expl. Efficacy Well No . & Location Balimara structure in Object: 4049.0-4055 m (Barail Formation The discovery of oil within Barail Formation in Dumduma ML/ Balimara- / Upper Eocene to Lower Oligocene) this well has opened up new play for oil 1 (Loc. DGF)/ Upper Oil: 77 klpd (oil: 75 klpd, water: 2 klpd) exploration/ exploitation in Balimara structure Eocene to Lower through 5 mm bean, (API: 31.30; PP: within Dumduma ML area. The well has helped in accretion to In-place volume of O+ Oligocene 330C). FTHP: 84 kg/cm2. OEG in 2P Category is about 1.60 MMSKL. ACTIVITIES DURING THE YEAR 2011-12
SiSeism ic sect ion a long IL98IL 985 pass ing t hroug hhh the BliBalimara SihllBliStructure with well Balimara-1 – DhCDepth Contour well Balimara-1 Map Close to 34 SB / Near Top Barail NAGAYALANKA-SE-1 OPERATOR : CEIL
Structure / Testing Result Leads / Expl. Efficacy Well No. & Location Nagayalanka-SE-1 / Average oil flow rate 70 bbl/day and average gas This discovery has opened up KG-ONN-2003/1 flow rate 0.6 mmscfd thewest GdGodavari sub-bibasin for hydrocarbon exploration.
NAGAYALANKA-SE-1
Location map of block KG-ONN-2003/1 Seismic section showing through well Well Log Motif of Nagayalanka-SE1 Nagayalanka-SE-1
INDIA - Hydrocarbon Exploration and Production Activities - 2011-12 57 DGH
NEW DISCOVERIES Dhirubhai-53 (CYPRIIID6-SA1) (CY-PR-DWN-2001/2) OPERATOR : RIL
Structure / Testing Result Leads / Expl. Efficacy Well No . & Location MesozoicSequence/ Well Flowed gas @ 37 MMSCF /day Opened up synrift prospect in the Mesozoic CYPRIIID6ͲSA1/ and 1100 bbls/day condensate (45 section in this area of Cauvery basin. degree API) @ 56/64 ‘’ choke for 24 CYͲPRͲDWNͲ2001/2 (CYPR D6) hrs with a flowing THP 2282 psia Ͳ and WHT 103 oF
Seismic section showing through well CYPRIIID6-SA1 Well Log Motif of CYPRIIID6-SA1 Dhirubhai-54 (KG-D9-A2) (KG-DWN-2001/1) OPERATOR : RIL
Structure / Testing Result Leads / Expl. Efficacy Well No. & Location LateMioceneSequence Following hydrocarbon interesting Led to identify different hydrocarbon bearing /DhirubhaiͲ54(KGͲD9Ͳ zones with geol ogi cal age/f ormati on chlhannel levee complfLMilexes of Lower Miocene age. 3375 – 3382m MDRT (Gas) A2)/KGͲDWNͲ2001/1 (KG III D9) 3465 – 3475m MDRT (Gas) Ͳ Ͳ 3616 -3621m MDRT (Gas) ACTIVITIES DURING THE YEAR 2011-12 ACTIVITIES DURING THE
Seismic depth section passing through location for KG-D9-A2 Depth Structure Map of Late Miocene Gas sand
58 INDIA - Hydrocarbon Exploration and Production Activities - 2011-12 DGH
NEW POOLS : WESTERN ONLAND LNBU /LN-81 OPERATOR : ONGC
Structure / Testing Result Leads / Expl. Efficacy Well No. & Location
Obj-IV: 1857-1854 m, East Linch / LNBU / This is a new prospect discovery in this part of the flowed oil @ 29 m3/d block. This will open up significant area for exploration LN-81 through 5 mm bean. and exploitation.
LNBU
Kalol top
K-X ACTIVITIES DURING THE YEAR 2011-12 LCT Mandhali Top
OCS Top
STUDY AREA
PtMfProspect Map of MhMehsana shihowing s tdtudy area PART OF IL 350 SHOWINGLOCATION LNBU
NKXV / NK-472 OPERATOR : ONGC
Structure / Testing Result Leads / Expl. Efficacy Well No. & Location
This well, N.Kadi-472 produced oil for the first time North Kadi / Obj-I: 1279-1277 m , from MP-IV unit of Mandhali Member in North Kadi NKXV / flowed oil @ 23.7 m3/d area. This new pool discovery is likely to open up new NK-472 through 6 mm bean. areas for further exploration and will also contribute for reserve growth and production.
NK-472
North Kadi
Prospect Map Time Structure Map at the Top of Kalol-X
INDIA - Hydrocarbon Exploration and Production Activities - 2011-12 59 DGH
NEW POOLS : WESTERN ONLAND VJEP / VIRAJ-58 OPERATOR : ONGC
Structure / Testing Result Leads / Expl. Efficacy Well No. & Location
This is for the first time oil & gas has been discovered in Obj-I:1869-1866 m, Viraj / VJEP / commercial quantities in Mandhali Member of Kadi flowed oil @ 108 m3/d Formation in Viraj Field. The new pool discovery is likely Viraj-58^ through 5 mm bean. to open up new areas for exploration and will also contribute in reserve growth and production.
VIRAJ-58
VIRAJ
Log motif of the Mandhali Member Prospect Map Structure Map At The Top Of L-I NKPI / NORTH KADI-461 OPERATOR : ONGC
Structure / Testing Result Leads / Expl. Efficacy Well No. & Location
North Kadi / Obj-II: 1316-1312.5 m, This is a new pool discovery and has opened up large area NKPI / produced oil @17 m 3/d eastfthNtht of the North KdiKadi Fie ld for fur ther expl orati on and North Kadi-461 through 8 mm bean. exploitation of Mandhali Reservoirs.
ACTIVITIES DURING THE YEAR 2011-12 ACTIVITIES DURING THE NK-461 NK- W 460(P) E
Kalol Top North Kadi
Mandhali Top OCS Top
INLINE 390 - Showing well, NK-461 Prospect Map
60 INDIA - Hydrocarbon Exploration and Production Activities - 2011-12 DGH
NEW POOLS : KG OFFSHORE GS-70-AA / GS-70-1 OPERATOR : ONGC Structure / Testing Result Leads / Expl. Efficacy Well No. & Location
GS-70 / Obj-I: 3703-3697 m, produced oil @ The discovery is of significant techno- GS-70-AA / 69.10 m3/d, gas @ 78,000 m3/d and economic value in the proposed GS-70-1 water @ 1.5 m3/d through 6 mm bean. development plan of the area.
GS-70-1
GS- MIO-PLIO 70-1 TOP
GS-70-1 ACTIVITIES DURING THE YEAR 2011-12 GS-70-1 PAY TOP
N S Inline 11118 through well GS-70-1 Time map of a Horizon close to pay sand of well GS-70-1 NEW POOLS : VINDYAN (SON VALLEY) R-NA-B / NOHTA-2 OPERATOR : ONGC
Structure / Testing Result Leads / Expl. Efficacy Well No. & Location
Object - Barefoot: Well, Nohta-2 has produced gas for the first time from Nohta-2 / R-NA-B / 1727-1702 m, flowed Rohtas Formation of Meso-Neo Proterozoic age in Damoh- Nohta-2 gas @ 3724 m3/d Jabera-Katni PEL of Vindhyan Basin. The new discovery is through 6 mm bean. likely to open up new areas for exploration and will also contribute in reserve growth and production. Nohta#1& 2
Charkaria
Jardepahar Nohta#1& 2 Kajrahat
WO Top Karaundi 4850m Jabera# WO Base 2 Inverted Damoh Depression
SW NE SEISMIC LINE MP-19-06 Isochron map at wedge out top within Kajrahat formation
INDIA - Hydrocarbon Exploration and Production Activities - 2011-12 61 DGH
NEW POOLS : AAFB (TRIPURA)
GOAB / GO-13 OPERATOR : ONGC
Structure / Testing Result Leads / Expl. Efficacy Well No. & Location
Gojalia / Obj-IV: 1957-1953 m, flowed gas @ This is a new pool discovery from Middle GOAB / 1,01,200 m3/d and through 10 mm Bhuban Formation which has reaffirmed GO-13 bean. the hydrocarbon prospectivity of the southern part of Gojalia Structure. GO-13
GO-13
Interpreted line TR-43-07 Time Map: Top Of Middle Bhuban ACTIVITIES DURING THE YEAR 2011-12 ACTIVITIES DURING THE
62 INDIA - Hydrocarbon Exploration and Production Activities - 2011-12 DGH UNCONVENTIONAL HYDROCARBONS & OTHER ACTIVITIES
UNCONVENTIONAL HYDROCARBONS & OTHER ACTIVITIES
- Gas Hydrates
- Shale Oil & Gas
- Underground Coal Gasification
- Oil Shale
- Coal Bed Methane
- Recovery Enhancement Techniques implemented by NOC’s
- New Technology used / adopted
- Environmental Issues & CSR
INDIA - Hydrocarbon Exploration and Production Activities - 2011-12 63 DGH
64 INDIA - Hydrocarbon Exploration and Production Activities - 2011-12 DGH
UNCONVENTIONAL HYDROCARBONS GAS HYDRATES Steered by the Ministry of Petroleum and Natural Gas and technically coordinated by Directorate General of Hydrocarbons (DGH), National Gas Hydrate Program (NGHP) is a consortium of National E & P companies, namely ONGC, GAIL, OIL and national research institutions NIO, NIOT and NGRI. During the period 1998 to 2003, data of Krishna Godavari Basin (offshore), Cauvery Basin (offshore), Gulf of Mannar and Western offshore were studied by ONGC for assessing Gas Hydrate prospectivity. These studies provided technical support in formulating NGHP-1 program, wherein 21 sites were drilled/ cored in Indian offshore during 28th April, 2006 to the 19th August, 2006 through the ship Joides
Resolution by Overseas Drilling Ltd. USA. Gas Hydrate layer was encountered at sites NGHP-01-10 UNCONVENTIONAL HYDROCARBONS & OTHER ACTIVITIES in the Krishna-Godavari Basin and at site NGHP-01-17 in offshore of the Andaman Islands. The following are highlights of the findings: • Established presence of gas hydrate in KG, Mahanadi and Andaman deep waters in numerous complex geologic settings. • Collected an unprecedented number of gas hydrate cores • Most of the recovered gas hydrate was characterized as either pore-filling grains or particles disseminated in coarser grain sediments or as a fracture-filling material in clay dominated sediments. • Gas hydrate was found occurring in “combination reservoirs”. • Delineated and sampled one of the richest marine gas hydrate accumulations yet discovered (Site NGHP-01-10 in the KG Basin). • Discovered one of the thickest and deepest (612M) gas hydrate occurrences yet known (offshore of the Andaman Islands, Site NGHP-01-17). • Scientific Contribution globally acknowledged. NGHP Expedition-02 Based on the findings of NGHP Expedition-01, the Krishna Godavari deepwater basin and the Mahanadi deep waters have been considered potential areas where large tracts of turbidity sand channel systems can be expected in the delta sequence accumulations. Three areas in KG offshore namely ‘A’ in Vizag offshore (Industrial well L1-1A area), Area ‘B’ in Krishna Offshore (South of KD Prospect) and Area ‘C’ (East of GD Prospect) have been identified. The aims and objectives of the NGHP Expedition-02 are is to identify gas hydrate bearing sands, identify the free gas below the gas hydrate stability zone and identify suitable location for carrying out pilot production testing in NGHP Expedition-03. 3D seismic data interpretation is in progress to identify potential sand channel systems. The results of the studies will yield potential sites for NGHP Expedition-02. The NGHP Expedition-02 consists of an exclusive logging while drilling programme, followed by intensive coring and G & G Acquisition. Identification of Locations: Based on the geophysical studies carried out so far in Area ‘A’ (320 sq.km in Krishna Godavari Offshore Deepwater areas) 8 sites have been evaluated and prioritized for Leg-01 of the NGHP Expedition-02. These locations have been prioritized and extended in consultation with USGS scientists. Geoscientific studies are in progress to identify more locations in the area.
INDIA - Hydrocarbon Exploration and Production Activities - 2011-12 65 DGH
Resource Estimation: Earlier studies have prognosticated gas hydrate resources of 1894 TCM for India and 933 TCF (USDOE, Feb 2012) is the concentration of gas hydrate in sands within the gas hydrate stability zone. This estimate is encouraging although the estimated presence of sand is approximated based on gross geological depositional models. NGHP is carrying out resource estimation of the gas hydrates in offshore areas of East Coast. MoU for Gas Hydrates NGHP has MoU with USGS, USDOE, USMMS, JOGMEC and IFM-Geomar for collaborative research in gas hydrates. USGS scientists are in close consultation for prioritizing locations.
UNCONVENTIONAL HYDROCARBONS & OTHER ACTIVITIES HYDROCARBONS & OTHER UNCONVENTIONAL GAS HYDRATE CORE SAMPLES FROM KG BASIN – EXPEDITION-01
Exploitation of methane from Gas Hydrates A collaborative project with IIT, Kharagpur was taken up to firm up theoretical background of the method. The project has brought out that the heat transfer rates are very slow and hence the ultimate production rate by thermal stimulation will be very low. (a few thousand cubic meter per day). Also the studies at IEOT, ONGC has brought out that apart from the problem of low production rates, sea floor stability is a more serious problem in carrying out gas production from gas hydrates in shallow marine environments. A conceptual mining method is being considered and various technical aspects are being looked into. Future plans As per observation of the team consisting of scientists from DGH, NGRI, NIO etc. headed by USGS expert Dr. Tim Collette the sites presented by KDMIPE in an area having 3D seismic coverage in offshore
66 INDIA - Hydrocarbon Exploration and Production Activities - 2011-12 DGH
Krishna-Godavari Basin (Vizag offshore) hold merit and warrant drilling for Gas Hydrate prospects because of occurrence of sand facies in Gas Hydrate Stability Zone and observation of distinct BSR. The NGHP technical committee agreed to test probable gas hydrate bearing sand in channel-levee system by drilling of six out of eight proposed locations in area ‘A’as top priority and two as alternate locations during NGHP-02 expedition. The paleogeographic reconstruction of study area provided insight into sediment supply and the gas sourcing and charging reasonably fits into tectono-stratigaphic model and proven-petroleum system of KG Basin (offshore).
Global Analogues : 2011-12 Field Program, North Slope Alaska (Source: NETL) Ignik Sikumi field trial in the Prudoe Bay area of North Slope Alaska began in December, 2011, with the reconstruction of the ice pad around the well head installed the prior winter (Figure1). Throughout January and February 2012, equipment was installed to conduct the exchange trial, fluids UNCONVENTIONAL HYDROCARBONS & OTHER ACTIVITIES were re-circulated to confirm the well’s mechanical integrity. The well was then filled with a mixture of CO2 and N2 gas that displaced the well preservation fluids. An oriented perforating gun was lowered, and a 30-ft interval of casing was perforated at six-inch spacing with no damage to the downhole pressure temperature gauges or the fiber-optic cables. A sand screen designed to control sand production was then set across the perforated interval. Between February’15 and Feb‘28, 2012, 210,000 standard cubic feet (scf) of blended CO2(23%) and N2(77%), along with small volumes of chemical tracers, were successfully injected into the formation. Mixed gas was used rather than pure CO2 Figure 1: Ignik Sikumi Field Trial Site, North Slope, Alaska to enhance opportunities for carbon dioxide to interact with native methane-hydrate by inhibiting formation of secondary CO2-hydrate – both by displacing movable formation water and by changing the reservoir chemistry near the wellbore. The injection phase proceeded smoothly, and injectivity increased slowly and steadily during the test, without any indications of formation fracturing. Once the planned gas volumes were injected, the well was shut-in and reconfigured for flow back. On March 4, 2012, the well was re-opened and produced a mixture of gases under its own energy, for one-and-a-half days, before it was shut-in for installation of a downhole jet pump. For the next seven days, the well was produced by pumping fluids from the wellbore, thereby lowering pressure at the level of the perforations to draw fluids from the formation, while remaining above the pressure that would destabilize any native CH4-hydrate. Ignik Sikumi #1 produced water and gas at a wide range of rates during this phase, accompanied by intermittent recovery of very fine-grained sand. Pressure drawdown was below methane-hydrate stability pressure. During this phase of the field test, hydrate dissociation was successfully initiated and gas production rates peaked. After producing for two and a half days, the wellbore was shut-in to mitigate an ice plug that formed in the flare line. During this shut-in period, the downhole jet pump was also replaced with a model that permitted lower drawdown pressures. Production was reinitiated on March 23, 2012 and the well flowed continuously for the next 19 days, until final shut-in on April 11, 2012. During this final period, flowing reservoir
INDIA - Hydrocarbon Exploration and Production Activities - 2011-12 67 DGH
Figure 2: After measurement and compositional pressures were smoothly lowered and production rates steadily analysis, gas is flaredat the ignik Sikumi # 1 well site increased. The recovered gas was progressively dominated by methane. Overall, the well produced for 30 days during the 38- day flow-back period, with cumulative gas production approaching one million standard cubic feet. The well was plugged and abandoned in accordance with the regulations of the Alaska Oil and Gas Conservation Commission, including filling the wellbore to surface with cement, capping the well, cutting the well off below ground surface, then backfilling it to fit the pre-existing tundra landscape. The site will continue to be visually monitored as spring thaw removes all visible signs of the test site.
Challenges Met
The Ignik Sikumi field trial overcame a number of challenges. First, careful program planning and management enabled a complex scientific field experiment to be conducted in the midst of normal operation activities in the Prudhoe Bay Unit with no interference with the simultaneous production operations. Second, the field team successfully managed the oriented perforating of the target zone with no damage to the well’s extensive downhole monitoring equipment, enabling full collection of data throughout the duration of the test. Third, careful engineering of the gas injection phase enabled the precise mixing and control of injectant components, as well as the management of injection pressure such that the targeted volume of 210,000 scf of gas was injected within the allotted time without fracturing the formation, an event that would have made real-time monitoring and post-test modeling more difficult. Fourth, the team addressed the potential for rapid loss of injectivity due to direct CO2-hydrate formation through the use of a N2-CO2 gas mixture. This mixture met the program goal of modifying the near-wellbore physical and chemical environment in such a way that injection could occur without adversely affecting the hydrate-bearing reservoir. Fifth, the well was successfully transitioned from injection to production, during which the downhole pressure was lowered in a controlled manner, enabling the measurement and management of produced gases, fluids, and solids, at pressures both above and below the dissociation pressure of native CH4-hydrate. Ignik Sikumi #1 flowed for UNCONVENTIONAL HYDROCARBONS & OTHER ACTIVITIES HYDROCARBONS & OTHER UNCONVENTIONAL approximately 30 days, at rates as high as 175,000 scf/d. During the final phase of drawdown testing, gas rates steadily increased from 20,000 scf/day to 45,000 scf/day while significantly exceeding both the duration and the cumulative gas recovery of prior field testing programs. Finally, water and fine formation sand were liberated as by-products of dissociation, and the production of both were efficiently managed as the test progressed.
Nordic-Calista Drilling Rig #3 on site at the Ignik Sikumi #1 well, Prudhoe Bay Unit, Alaska North Slope - photo courtesy ConocoPhillips
68 INDIA - Hydrocarbon Exploration and Production Activities - 2011-12 DGH
SHALE OIL & GAS
Shale gas has gained predominance particularly in USA and contributes approx. 20% of total gas production. The experience accumulated so far in USA with the exploration and exploitation of these plays has encouraged other countries to venture into such plays. Though Shale gas was recognized much earlier, two things in particular, horizontal multilateral drilling with water fracturing and improved prices of gas in the US markets, have changed the scenario rapidly after 2001.
There are large basinal segments, which appear interesting from Shale Gas point of view, by drawing analogy from US basins. A systematic approach has been initiated by DGH under MOPNG since 2010 to identify, characterize and prioritize the Indian sedimentary basins for focused shale oil /gas exploitation and also to assess and establish the potential of fields.
Memorandum of understanding (MOU) has been signed between Department of State, USA and MOPNG, UNCONVENTIONAL HYDROCARBONS & OTHER ACTIVITIES GOI on November 06,2010 to cooperate in areas of
a. Assessment of Shale Gas Resources in India.
b. Training
c. Assistance in regulatory frameworks
d. Investment Promotion
In this respect technical workshops were held during Jan 2011, May 2011 and Jan 2012, at Delhi attended by USGS Team, MOPNG, DGH, ONGC, OIL , GAIL and several others.
MOPNG, Government of India through DGH has taken initiative to identify prospective areas for Shale Gas exploration in India. DGH has been entrusted asked to prepare a road map for issue related to Policy and Legal framework prior to forthcoming first round of offer of shale oil / blocks of India.
• DGH under MoP & NG has initiated steps to
a. Identify prospective areas for Shale Gas exploration and acquisition of additional geo- scientific data
b. Formulation of Policy for Shale Oil & Gas exploration
c. Launch First Shale Oil & Gas round
• Based on the data available from conventional oil/gas exploration in the country for the last so many years, it appears that following sedimentary basins may be prospective from Shale gas point of view under Phase-I.
♦ Cambay Basin ♦ Gondwana Basin ♦ KG Basin ♦ Cauvery Basin ♦ Indo-Gangetic Basin ♦ Assam Arakan Basin
However, detailed analysis of geo-scientific data gathered during conventional exploration of Oil/Gas is being carried out to identify areas/basins prospective for shale gas.
INDIA - Hydrocarbon Exploration and Production Activities - 2011-12 69 DGH
Studies have been initiated for 12 basins / sub basins (including 6 basins given above) to analyze geo-scientific data gathered over the years to assess shale oil/gas prospectivity, for future action plan.
• GoI has granted permission to ONGC for an R&D project in Gondwana Basin in the existing two CBM Blocks for exploration of Shale Gas. ONGC has drilled 4 Pilot wells to gather data relevant to Shale Gas. Presence of gas has been reported by ONGC. Further studies on the samples are in progress.
• A Multi Organizational Team (MOT) of DGH, ONGC, OIL, GAIL has been formed by MOPNG to analyze the existing data set and suggest methodology for Shale Gas development in India.
• Studies have been awarded to ONGC & CMPDI to identify prospective areas in 12 Basins / sub basins.
• MoP&NG / DGH are in discussion with other agencies to address Environmental issues and issues related for social impact etc.
• Different agencies have reported upon the shale gas resources in India. EIA, USA (Apr’11) has reported a GIP concentration of 1170 TCF, risked gas-in-place of the order of 293 TCF with 69 TCF as recoverable in 4 Indian basins. USGS (Jan’12) has estimated 6.1 TCF as technical recoverable in 3 Indian basins and mention potential for Shale oil. Media reports mention shale gas resources ranging from 300 to 2100 TCF in India.
Future Action Plan
• Identification of prospective areas in different sedimentary basins
• Finalization of Shale Gas Policy & necessary amendments in P & NG Rules, if required
• Carving out and Offering of Blocks, based on availability of all necessary clearances and finalization of Shale Gas policy.
Shale Gas Pilot Project-Damodar Basin: (provided by ONGC)
UNCONVENTIONAL HYDROCARBONS & OTHER ACTIVITIES HYDROCARBONS & OTHER UNCONVENTIONAL • ONGC has undertaken a pilot study in the Damodar Valley, were 4 wells have been drilled. The first shale gas well RNSG#1, and other wells in the series viz. NKSG#2, RNSG#2, NKSG#1 have been drilled and completed with full set of logs and extensive coring in the Barren Measures Shales. This has marked the completion of drilling and phase-2 operations.
• Well RNSG#1 (Damodar Basin, Jharkhand and West Bengal) flowed the shale gas at surface on 25th January, 2010.
• The Shale gas project was to be completed in 7 phases. All the phases have been successfully accomplished and in the Raniganj sub basin the Gas in Place (GIP) has been estimated based on the subsidence modeling as 35 TCF and based on the core log data the same has been estimated as 48 TCF.
70 INDIA - Hydrocarbon Exploration and Production Activities - 2011-12 DGH
UNDERGROUND COAL GASIFICATION (UCG) submitted by ONGC
ONGC signed an Agreement of Collaboration (AOC) with M/s Skochinsky Institute of Mining (SIM), Russia on 25th November, 2004 for implementation of Underground Coal Gasification (UCG) program in India. As follow-up MOUs was signed with various coal companies for accessing the coal/lignite blocks for evaluating their suitability to UCG. After evaluating a number of coal/lignite blocks, Vastan Mine block belonging to GIPCL in Surat district, Gujarat was found suitable for UCG. This site has been taken up by ONGC as an R&D project to establish UCG technology.
Work at Vastan Mine Block:
All the ground work and inputs for pilot construction have been finalized for implementation of UCG pilot UNCONVENTIONAL HYDROCARBONS & OTHER ACTIVITIES at Vastan. In order to implement UCG the following steps have been undertaken:
• The “Environmental Clearance” from MoEF, GoI has been obtained in the month of Feb’ 2010.
• Basic and detailed engineering design has been prepared with the help of SIM, Russia and Ukrainian Design Institute, OJSC Dongiproshakht in November, 2009.
• The spade work for execution of pilot module in terms of land acquisition, electric supply, water connection, soil survey etc. have been initiated.
• Draft contract for construction of UCG pilot has been finalised after cost optimisation and inclusion of Indian vendors.
Status of other UCG Sites:
In parallel action, other sites have been taken up for studying their suitability for UCG. ONGC and Neyveli Lignite Corporation Limited (NLC) jointly identified Tarkeshwar in Gujarat and Hodu-Sindhari & East Kurla in Rajasthan. One more site was also jointly identified by ONGC & Gujarat Mineral Development Corporation Ltd, Gujarat (GMDC) viz. Surkha in Bhavnagar Distt., Gujarat. The data of all the fields have already been analysed for evaluating the suitability of these sites for UCG and all the sites have been found suitable for UCG. These projects will be taken up on the basis of learning curve from Vastan project.
OIL SHALE
• Oil Shale prospectivity mapped in Assam-Arakan Basin
• Oil Shale resources estimated to be around 400 MMT of oil upto a depth of 500m in selected areas in Assam-Arakan Basin
• Vision document on Oil Shale prepared
INDIA - Hydrocarbon Exploration and Production Activities - 2011-12 71 DGH
COAL BED METHANE (CBM)
India, having the fourth largest proven coal reserves in the world, holds significant prospects for exploration and exploitation of CBM. The prognosticated CBM resources in the country are about 92 TCF (2608 BCM). In order to harness CBM potential in the country, the Government of India formulated CBM poilcy in 1997 wherein CBM being Natural Gas is explored and exploited under the provisions of OIL Fields (Regulation & Development) Act 1948 (ORD Act 1948) and Petroleum & Natural Gas Rules 1959 (P&NG Rules 1959) administered by Ministry of Petroleum & Natural Gas (MOP&NG).
CBM blocks were carved out by DGH in close interaction with MOC & CMPDI. Till date, four rounds of CBM bidding rounds have been implemented by MOP&NG under the CBM policy resulting in award of 33 CBM blocks which covers 17,200 Sq.km out of the total available coal bearing areas for CBM exploration of 26,000 sq.km Exploration under CBM policy has been undertaken by national and international companies. Total prognosticated CBM resource for awarded 33 CBM blocks, is about 63.85 TCF (1810 BCM), of which, so far, 8.92 TCF (252.8 BCM) has been established as Gas in Place (GIP). Commercial CBM production has started from 1 block since 14th July 2007 which contributes about 0.25 MMSCMD of CBM production. Four more CBM blocks are expected to start commercial production in near future. The total CBM production is expected to be around 4MMSCMD by end of 12th plan. UNCONVENTIONAL HYDROCARBONS & OTHER ACTIVITIES HYDROCARBONS & OTHER UNCONVENTIONAL
CBM BLOCKS AWARDED SO FAR
72 INDIA - Hydrocarbon Exploration and Production Activities - 2011-12 DGH
CBM BLOCKS AWARDED SL COAL FIELD / STATE BLOCK NAME CONSORTIUM DATE OF AWARDED NO. (PARTICIPATING SIGNING AREA INTEREST) CONTRACT (SQ. KM.) CBM-I ROUND 1. RANIGANJ EAST / WEST BENGAL RG(E)-CBM-2001/1 EOL (100) 26.07.2002 500 2. BOKARO / JHARKHAND BK-CBM-2001/1 ONGC (80) & IOC (20) 26.07.2002 95 3. N. KARANPURA / JHARKHAND NK-CBM-2001/1 ONGC (80) & IOC (20) 26.07.2002 340 4. SOHAGPUR EAST / M.P SP(E)-CBM-2001/1 RIL (100) 26.07.2002 495 5. SOHAGPUR WEST / M.P SP(W)-CBM-2001/1 RIL (100) 26.07.2002 500 TOTAL AREA : 1930
ON NOMINATION BASIS 6. RANIGANJ NORTH / WEST BENGAL RANIGANJ NORTH ONGC (74) & CIL (26) 06.02.2003 350 7. JHARIA / JHARKHAND JHARIA ONGC (90) & CIL (10) 06.02.2003 85 UNCONVENTIONAL HYDROCARBONS & OTHER ACTIVITIES 8. RANIGANJ SOUTH / WEST BENGAL RANIGANJ SOUTH GEECL (100) 31.05.2001 210 TOTAL AREA : 645
CBM-II ROUND 9. SOUTH KARANPURA / JHARKHAND SK-CBM-2003/II* ONGC (100) 06.02.2004 70 10. NORTH KARANPURA / JHARKHAND NK(WEST)-CBM-2003/II* ONGC (100) 06.02.2004 267 11. SONHAT / CHATTISGARH & M.P. SH(NORTH)-CBM-2003/II RIL (100) 06.02.2004 825 12. BARMER / RAJASTHAN BS(1)-CBM-2003/II* RIL (100) 06.02.2004 1045 13. BARMER / RAJASTHAN BS(2)-CBM-2003/II* RIL (100) 06.02.2004 1020 TOTAL AREA : 3227
CBM-III ROUND 14. RAJMAHAL / JHARKHAND RM-CBM-2005/III* ARROW(35)-GAIL(35)-EIG(15)-TATA(15)07.11.06 469 15. BIRBHUM / WEST BENGAL BB-CBM-2005/III* BPE(100) 16.11.06 248 16. TATAPANI RAMKOLA / CHATTISGARH TR-CBM-2005/III* ARROW(35)-GAIL(35)-EIG(15)-TATA(15)07.11.06 458 17. MAND RAIGARH / CHATTISGARH MR-CBM-2005/III* ARROW(40)-GAIL(45)-EIG(15) 07.11.06 634 18. SOHAGPUR / M.P. SP(N)-CBM-2005/III GEO(10)-REL(45)-RNPL(45) 07.11.06 609 19. SINGRAULI / M.P. SR(N)-CBM-2005/III COALGAS(10)-DIL(90) 07.11.06 330 20. KOTHAGUDEM / ANDHRA PRADESH KG(E)-CBM-2005/III GEO(10)-REL(45)-RNPL(45) 07.11.06 750 21. BARMER / RAJASTHAN BS(4)-CBM-2005/III GEO(10)-REL(45)-RNPL(45) 07.11.06 1168 22. BARMER / RAJASTHAN BS(5)-CBM-2005/III GEO(10)-REL(45)-RNPL(45) 07.11.06 739 23. GODAVARI / ANDHRA PRADESH GV(N)-CBM-2005/III COALGAS(10)-DIL(40)-ADINATH(50)07.11.06 386
TOTAL AREA : 5791
CBM-IV ROUND 24. RAJ MAHAL / JHARKHAND RM(E)-CBM-2008/IV ESSAR OIL LIMITED (100) 29.07.10 1128 25. TALCHIR / ORISSA TL-CBM-2008/IV ESSAR OIL LIMITED (100) 29.07.10 557 26. IB VALLEY / ORISSA IB-CBM-2008/IV ESSAR OIL LIMITED(100) 29.07.10 209 27. SOHAGPUR / MP & CHHATTISGARH SP(NE)-CBM-2008/IV ESSAR OIL LIMITED (100) 29.07.10 339 28. SATPURA / MADHYA PRADESH ST-CBM-2008/IV DART ENERGY(80)–TATA POWER(20)29.07.10 714 29. NORTH EAST / ASSAM AS-CBM-2008/IV DART ENERGY(60)–OILINDIA(40) 29.07.10 113 30. MANNARGUDI / TAMIL NADU MG-CBM-2008/IV GEECL (100) 29.07.10 667
TOTAL AREA : 3727
RELINQUISHED CBM-II BLOCKS 1. SATPURA / M.P. ST-CBM-2003/II ONGC (100) 06.02.2004 714 2. WARDHA / MAHARASHTRA WD-CBM-2003/II ONGC (100) 06.02.2004 503 3. BARMER-SANCHOR / GUJARAT BS(3)-CBM-2003/II ONGC(70)&GSPCL(30) 06.02.2004 790 * : Relinquishment proposed by Operator Note : Name of Arrow Energy has been changed to Dart Energy
INDIA - Hydrocarbon Exploration and Production Activities - 2011-12 73 DGH
RECOVERY ENHANCEMENT TECHNIQUES IMPLEMENTED BY NOC’s
ONGC IOR/EOR efforts on a field scale are a continuous process for enhancement in recovery and have helped in realization of oil gain by arresting the natural decline of brown and mature fields of ONGC. The IOR/EOR schemes conceptualized in 2000-01 in 14 major fields have helped in sustaining production levels from the major brown fields since inception of the schemes and their effects are also seen in concluded fiscal year 2011-12. The major fields undergoing IOR/EOR programmes have witnessed continuous growth in Inplace volumes and all efforts are made to translate the same to reserves. The majors namely Mumbai High, Heera & South Heera are targeted through Rolling Development programmes, while the Balol and Santhal fields are on production through In-Situ Combustion (ISC) process. The performance of North Kadi field has improved post implementation of IOR programme. Some of the salient efforts on revitalization/redevelopment of major fields are given below:
Offshore areas Mumbai High: Integrated development plan (IOR Phase-II) for L-I, L-II and L-III reservoirs of Mumbai High North was firmed up and is under implementation for enhancing recovery from the field.
Heera Field: Post implementation of redevelopment programme in Heera field, there has been increased levels of oil production. The second phase of Heera redevelopment including Panna formation has been formulated and the FR was approved in March 2012.
D1 field: The field extension in D1 is addressed by additional development study. The inputs envisaged 14 development wells, 6 in D-1-4/11/12 block and 8 in D-1-14 block. Drilling activity at D1 main and D1-14 blocks is lined up for 1st quarter of 2012-13.
Bassein Field: Additional development of Bassein field considering integrated development of Mukta, Bassein and Panna Pays has been worked out during the year 2011-12. The study envisages 1 new platform, 18 locations (5 are proposed to be drilled as subsea).
IOR Projects under Implementation 1. Mumbai High South Redevelopment Project Phase-II: The project envisages an incremental Oil & gas production of 18.31 MMT and 2.70 BCM (revised) respectively by the year 2030.
2. Mumbai High North Redevelopment Project Phase-II: The project envisages an incremental Oil & UNCONVENTIONAL HYDROCARBONS & OTHER ACTIVITIES HYDROCARBONS & OTHER UNCONVENTIONAL gas production of 17.354 MMT and 2.987 BCM respectively by the year 2030. 3. Additional Development of Heera Part-II: The scheme envisages incremental oil gain of 13.363 MMT and 1.666 BCM of gas by 2034-35.
4. Part of Mumbai High South Field Redevelopment Phase III: The project is expected to result in incremental production of 1.031 MMT of oil and 213.817 MMm3 of gas by March 2030.
Onshore areas
ONGC has already identified and initiated IOR/EOR schemes in 11 major onshore fields i.e. Kalol, Sanand, Gandhar, North Kadi, Sobhasan, Jotana, Santhal, Balol, Lakwa-Lakhmani, Geleki and Rudrasagar to be implemented in stages through 13 schemes. IOR schemes in all the wells and major facilities in Kalol, Gandhar, North Kadi Phase-I & Phase-II, Sobhasan, Jotana & Santhal Infill have been completed.
74 INDIA - Hydrocarbon Exploration and Production Activities - 2011-12 DGH
IOR schemes under implementation:
Three IOR schemes in Assam i.e. Lakwa-Lakhmani, Geleki and Rudrasagar fields are under various stages of implementation.
These three IOR schemes were reviewed during the course of implementation and the following corrective measures are being taken up:
· Thrust on development drilling activity and prioritization of high potential wells.
· Tracing the bypassed / undrained areas based on the latest available simulation models due to
reservoir heterogeneities. UNCONVENTIONAL HYDROCARBONS & OTHER ACTIVITIES
· Use of high volume lift pumps (ESPs) in Lakwa field.
· Reservoir pressure maintenance by enhancement of water injection in Geleki Field operating under depletion drive to arrest the decline in reservoir pressure.
Enhanced Oil Recovery (EOR) Schemes under implementation:
Three EOR schemes in three onshore fields i.e. Sanand, Balol and Santhal in Gujarat have already been initiated.
Santhal Field: Santhal is the largest heavy oil field of ONGC and the field is under In-situ Combustion (ISC) since 1997. As on 31st March, 2012, 23% of the STOIIP has been recovered which is 6% more than envisaged in primary recovery. Once all the released wells are drilled in KS-II, the air injection shall be gradually increased to create a stabilized and uniform thermal front.
Balol Field: The response of In-situ Combustion (ISC) process post-B#45 in Balol is mixed. Overall the field has recovered 18% of the STOIIP. In the Phase-I, GGS-II and Block of 179 the recovery is 53%, 48% and 29% respectively. Block of 169 and 189 areas has performed satisfactorily with recovery of 21% and 26% respectively. But North Balol, which is having 5 MMt of STOIIP, has recovered only 6%.
Field scale WAG in GS-11 sand, Gandhar Field: Based on encouraging WAG pilot response, full scale reservoir implementation was studied targeting OIIP of 8.9 MMt. The oil production of 4.44 MMt is envisaged in 20 years, which gives incremental recovery of 7% (incl. 3% by WAG) with 7 OP, 3 WAG Injector, 7 Conversions to WAG Injectors. All the ten locations were subsequently released. The initial schedule for implementation of full field WAG injection has been rescheduled to December, 2012.
WAG Pilot in GS-9 (Central Block), Gandhar Field: WAG Pilot was commenced in June, 2010. It has been decided to implement full field WAG in GS-9 reservoir also. A WAG pattern with 25 producers and 20 injectors has been conceptualized.
INDIA - Hydrocarbon Exploration and Production Activities - 2011-12 75 DGH
The details of IOR/EOR schemes ONGC’s onshore areas and their envisaged oil/gas gain & cumulative incremental oil/gas gain are as under :
Sl. Name of the Envisaged incremental Cumulative incremental No. scheme Oil Gain (MMT) / Oil Gain (MMT), Gas Gain Gas Gain(BCM) (MMSCM)up to Mar’12 1 Gandhar Oil-4.338 &Gas-2.690by 2020 Oil-4.526Gas-2817.67 2 North Kadi Ph.I Oil-1.097by 2020 Oil-0.892 3 North Kadi Ph.II Oil-0.363by 2018 Oil-0.434 4 Jotana Oil-0.915by 2020 Oil-0.474 5 Sanand EOR * Oil-0.069(Revised)by 2020 Oil-1.125 6 Balol EOR + Oil-6.520by 2020 Oil-2.244 7 Santhal EOR + Oil-14.770by 2020 Oil-5.916 8 Santhal Infill Oil-0.326by 2013 9 Sobhasan Oil-1.194by 2020 Oil-0.641 10 Kalol Oil-2.656 &Gas-0.460by 2020 Oil-1.971Gas-365.03
* EOR gain is the total field production and envisaged oil production plan from the field till 2020 is 3.884 MMT.
+ EOR oil gain is less as air injection was stopped in Balol field and controlled in Santhal field after Balol 45 incident.
OIL A total of 43 water injectors were in operation covering 12 reservoirs in Nahorkatiya, Moran, Jorajan and Shalmari oilfields. The terminal water injection rate was around 9000 klpd. The cumulative water injection was 3,229,462 kls. In most of the reservoir blocks, which have been subjected to fairly long duration schemes, oil recovery has been in the range of 30-50%, far exceeding the recovery estimated from primary depletion. The improvement in oil recovery factor due to water injection, over the primary depletion recovery for most of the reservoirs has been of the order of 10-20%.
An Eocene reservoir in Kamkhat field has been identified for initiation of water injection (as a pilot project). Results of this pilot project are expected to provide insight into the applicability and efficacy of water injection in Eocene reservoirs and thereby determine its applicability to other Eocene reservoirs. UNCONVENTIONAL HYDROCARBONS & OTHER ACTIVITIES HYDROCARBONS & OTHER UNCONVENTIONAL In order to improve oil recovery, studies on applicability of EOR/ IOR methods as well as field development plan of major Eocene and Oligocene fields viz. Barekuri, Baghjan, Dikom, Kathaloni, Chabua, Tengakhat and Makum-North Hapjan were carried out. Detailed feasibility study on EOR/IOR applications in these fields have been made and it has been inferred that EOR methods have limited applicability in these fields since primary recovery is high due to very good sweep efficiency, good PI and good reservoir quality. Based on these studies, a few infills as well as horizontal wells were also drilled and the results have been found to be encouraging. Subsequently, a few infills as well as step out locations have been lined up for drilling. Studies have also been initiated to incorporate sand screens and inflow control devices (ICD) in horizontal wells.
The possibility of extended reach drilling (ERD) as well as multilaterals has also been examined to drain hydrocarbon potential from logistically inaccessible areas like Barekuri and Baghjan. This is envisaged to be field implemented following requisite approval from statutory bodies.
76 INDIA - Hydrocarbon Exploration and Production Activities - 2011-12 DGH
NEW TECHNOLOGY USED / ADOPTED
ONGC To keep pace with latest technology and state-of-the-art solutions, ONGC has a well defined programme to identify, evaluate and adopt new and emerging technologies in the field of exploration and development of hydrocarbons. ONGC has been continuously incorporating new data API, drilling, completion, production and work-over techniques as part of these efforts. The new technologies adopted and their usefulness are given below:
3D-Visualization Centre (Stereoscopic display):This technology will accelerate workflow from basin scale exploration through detailed prospect and reservoir analysis by quick subsurface viewing and analysing Multi-Attribute/Multi-Volume Seismic, Well and Cultural data and reservoir models. UNCONVENTIONAL HYDROCARBONS & OTHER ACTIVITIES The Fluid Eval: The Fluid Eval is Standard mercury free automated PC based system which analyzes the samples of oil and gas condensate. It is useful to study the phase behaviour of hydrocarbon fluids at reservoir conditions of temperature and pressure.
Induction of Common Reflection Angle Migration (CRAM) software from M/s Paradigm: CRAM gives accurate images of the complex reservoir and gives amplitude and phase preserved angle gathers. CRAM is an anisotropic multi-arrival solution that uses the entire wave field which solves complex imaging objectives including over thrust and salt delineation.
Petrel software for processing of seismic data from M/s Geoquest Systems B.V. : The software will be used for seismic data processing.
Induction of Geo-science core system and seismic interpretation module of Petrel software from M/s Geoquest Systems B.V. :The software enables better interpretation of seismic data for detailed prospect analysis.
Induction of MATLAB Software from M/s Designtech Systems Ltd: The software is helpful to establish Kalman filter applications for reservoir studies.
Multi-Component Seismic Survey- 3D- 3C: Multi component seismic is a developing tool which is used for special studies and reservoir characterization and delineation of pay sands. Proper utilization of reflections captured at longer offset can help in deeper seismic imaging including sub-basalt imaging.
DISCover (Deep Interpolated Streamer Coverage): DISCover (Deep Interpolated Streamer Coverage) technology of M/S Western-Geco is inducted for a Pilot Project in Western Offshore for which the seismic data has been acquired and processed. This technology gives 3D seismic data with enhanced bandwidth, providing both high resolution and deep penetration. This is expected to give improved imaging beneath highly absorptive overburdens such as basalt and salt, or acquiring data suitable for inversion to absolute rock properties.
Passive Seismic Tomography (PST): It has been decided to induct the Passive Seismic technology- proposal of M/s Parsan Overseas Ltd., in Frontier Basin. PST would provide a detailed 3-D seismic velocity and Poisson ratio model of upper few km of the crust. Careful interpretation can transfer the velocity model into a complete 3D subsurface image, whereas the FFC provides Fault geometry, generation mechanism and Fracture distribution
TuffTRAC: A new generation wire line-conveyed tractor, used for carrying out perforations. This tractor is designed for perforating high angle wells. It has advantages over Tubing conveyed perforation (TCP) because of less operation time.
Ultra HPHT TCP-DST: The technology is used to test wells in very High Temperature & Pressure conditions having temperatures beyond 450 °F. The perforation charges and the DST string are of ultra HPHT rating to facilitate well testing.
INDIA - Hydrocarbon Exploration and Production Activities - 2011-12 77 DGH
RF Safe perforating System: Radio Frequency perforating system is nearly foolproof safe practice providing protection against accidents caused by extraneous electricity is in place now. In this system, firing is controlled via an electronic system integrated into the microprocessor of each detonator which can be fired only after a specific digital coded signal is delivered to release an electronic switch.
Seismic Guided Drilling: It is an integrated and iterative approach i.e. a combination of surface seismic, depth imaging and anisotropic velocity modelling workflows with the more traditional inversion and reservoir modelling methods. Result is enhanced subsurface definition and improved well placement. This technology has already been tried in 2 wells ANDW-2 and ANDW-3 of Andaman area of East coast with considerable cost and time savings
Acreage Monitoring software (Acemon): Software developed inhouse for managing the data pertaining to all the acerages (pre NELP, NELP and ML). The software initially installed in A&AA basin is being rolled out to other work centres.
Microbial process for mitigation of wax deposition in flow lines: A microbial process for mitigation the problem of deposition of wax in the flow lines of wells of Mumbai High has been developed and successfully tried. The process has been found to be quite effective in controlling the deposition of wax.
Field implementation of various MEOR processes in the different fields of ONGC: Paraffin Degrading Bacterial (PDB) Job and Field trial of high temperature (96ºC) microbial system for enhanced oil recovery.
HPAI (High Pressure Air Injection) Set up: Studies have been carried out on AI Process in large no. of fields namely Nawagam, Gamij, Wasna, Geleki, Heera, Lanwa, Sobhasan (Mandhali pay), D1 fields in the “Air Injection Laboratory” setup of IRS. This setup has attracted overseas projects from PDVSA, Venezuela for studies on air injection process. This process would be instrumental in identifying candidate reservoirs for air injection as a part of EOR efforts and extending the heavy oil learning curve to the light/ medium oil system. A pilot project of AI in Gamij field is being conceptualized. Surfactant Alternate Gas : Surfactant Alternate Gas technique implemented in Western Onshore basin. After implementation incremental recovery 5.15 % of HCPV over 5 cycle of WAG process was achieved.
OIL OIL has adopted state-of-the art technology at par with other Global E&P Companies for exploration and development activities. The core areas where the new technology that has been adopted and integrated are : a. The Virtual Reality Centre, “Kalpalok” (virtual world) is effectively inter-twinned with TEAM Centre and projects carried out in TEAM Centre can be visualized in virtual collaborative environment of Kalpalok. Kalpalok is also connected with “Decision Centre” in OIL’s Corporate Office at NOIDA UNCONVENTIONAL HYDROCARBONS & OTHER ACTIVITIES HYDROCARBONS & OTHER UNCONVENTIONAL through video-conferencing and desk top sharing facility for effective collaboration and communication between geo-scientists at Fields Headquarter, Duliajan and E&D Team at NOIDA. This state of the art facility shall facilitate effective and faster decision-making, planning and co-ordination. The following are some important facts about the facility: i. Hardware and peripherals from DELL EMC ii. Display and Visualization System from Barco (as on installation date the display screen of Kalpalok was the biggest (6.00 mX2.14 m) Barco screen in India) iii. Software: Geoframe 4.5, Petrel 2011 from M/s Schlumberger, GIS from ESRI, image processing from ERDAS and Plotting software is ZEH 4.8 iv. Video Conferencing and sound system facility from Sight and Sound v. Total project Execution (turnkey) by M/s Schlumberger
78 INDIA - Hydrocarbon Exploration and Production Activities - 2011-12 DGH b. A Seismic to Modeling of real field data Work Association with M/s Schlumberger is in progress and about 32% of total targeted jobs have been completed as on 31.03.2012. c. The existing BLACK OIL simulation software ‘ECLIPSE’ was upgraded to ECLIPSE 2010.1 version in the month of April 2011. The upgraded version makes it possible to dynamically model the challenge of complex reservoir. d. ECLIPSE PARALLEL (a module of Eclipse Simulator Suite) license was installed on 24 March 2012. The usefulness of the software becomes critical when multiple uncertainty scenarios need to be run in a given time frame, which is quite common in Field Development studies nowadays where large Dynamic Models are run. e. Latest softwares such as Transient Analysis, MBAL, and Water Flood, GREAT are being used to monitor the reservoir performance and timely reservoir management for maximizing recovery
and implementation of suitable IOR – EOR schemes. UNCONVENTIONAL HYDROCARBONS & OTHER ACTIVITIES f. Use of latest wire-line logging technology, tools, log interpretation and wireline testing softwares to identify oil and gas zones in low resistivity sands, fluid types, collection of fluid samples for PVT studies etc. g. With the help of GEOLOG, borehole image processing and interpretation software helps to perform structural, sedimentological and petrophysical interpretation from the processed image data. This software facilitates analysis of fractures, in-situ stress, thin bed and also in shale gas prospects identification. h. On-line monitoring of drilling, mud and geological parameters through Mud Logging Unit (MLU) for better drilling efficiency and timely operational decisions. i. Drilling of horizontal wells to avoid drawdown related problems occurring in conventional vertical wells and to substantially increase the production rate. j. Technology such as PLT, CBL-USIT, and RST are used to ascertain remedial measures in case of sick wells. k. Production and injection data generated from producing and injection wells are managed with the help of a customized data base like GRPC. j. All the legacy G&G and drilling data since inception are available in a robust E&P Data Bank for quick retrieval and better decision making. PVT. / JV
I. Smart Horizontal Well Completions In Mangala Field, the horizontal wells are being drilled and completed with stand-alone sand screens and the latest Inflow Control Device (ICD) technology. Some of these wells have produced over 10,000 barrels/day and represent the highest rate onshore producers in India. These wells are equipped with heater string for flow assurance, Electric Submersible Pumps (ESP) for artificial lift and two downhole chemical injection lines for dosing of corrosion inhibitors, de-emulsifier chemicals. II. Micro-Seismic Hydro-Frac Monitoring in Rajasthan Cairn-ONGC JV is the first in India to use micro-seismic monitoring of hydraulic fracturing. It is used to delineate the size and orientation of induced hydro-fracs in the subsurface, as well as map out their propagation through time. It can also identify faults and preexisting fractures. This information is critical for optimal well placement, hydro-frac design and overall reservoir management. Micro-seismic frac monitoring was employed during two Raageshwari Deep Gas Field (RDG) frac campaigns in Rajasthan. It confirmed the principle stress direction, fracture orientation and identified the presence of a complex natural fracture network. The planned hydro-frac design for future wells has been modified in accordance with the improved subsurface understanding.
INDIA - Hydrocarbon Exploration and Production Activities - 2011-12 79 DGH
III. Enhanced Oil Recovery in Rajasthan: Cairn-ONGC JV has is studying application of aqueous-based chemical flooding EOR techniques for the Mangala, Bhagyam and Aishwariya fields. Early application of chemical flooding in these fields has been designed to extend their oil production plateau periods, increase recovery factor, reduce water production, mitigate future decline rates and potentially accelerate crude oil production. Alkali and surfactant chemicals injected water is planned to enhance the displacement efficiency. The first phase of laboratory studies for Mangala Field was successfully concluded in January 2007. The core-flood data was successfully matched in a reservoir simulator allowing full field simulation of polymer and Alkaline-Surfactant-Polymer (ASP) flooding and justify a pilot study in the field, now underway. IV. World’s Longest Heated Insulated Pipeline for Crude evacuation An ambitious pipeline project of national importance to transport and market highly waxy crude from Barmer of Rajasthan to the Gujarat coast has been designed and made functional by Cairn. The crude is being transported through Polyurethane Foam (PUF) insulated pipeline. A second pipeline for gas follows the oil line to supply fuel gas to intermediate heating stations and power generation at Viramgam and Bhogat terminals. To ensure continuous heat tracing of the oil pipeline, 35 unique Skin Effect Heat Management System (SEHMS) is used and 32 AGI are installed at every 18 to 20 kilometers along the pipeline. This 670 kilometer insulated and heated pipeline of such complexity is the first of its kind in the world. V. Expandable Sand Screens In order to reduce well costs and improve productivity of sand control completions, Expandable Sand Screens (ESS) technology was successfully applied in Cairn assets. VI. 4D Seismic in Ravva for mapping bypassed Pay: Application of 4D and High Density 3D seismic technology (4D / HD3D) in Ravva Field has imaged time lapse effects in the reservoir as result of hydrocarbon production and water injection. This is the first 4D in India. It allowed design of an infill drilling campaign in this mature, developed field. Further refinement and superimposition of 4D data with High Resolution 3D data is in progress to identify other value- adding opportunities. VII. Multistage hydro fracturing: In Cambay Field, the horizontal well was drilled in tight reservoir of 610m horizontal section with 8 fracture stages (16 fracture initiation points). VIII. The advancement in new technologies as utilized in seismic API by Operators under PSC regime are summarized below: • Acquisition of 2D seismic data with long offset i.e. with 10-12 km long streamer length. • Specially designed seismic source was used to map sub-trappean sediments. • A longer record length of up to 18sec used to image deeper subsurface.
UNCONVENTIONAL HYDROCARBONS & OTHER ACTIVITIES HYDROCARBONS & OTHER UNCONVENTIONAL • Synthetic Aperture Radar Technology • High Resolution Aero-Magnetic (HRAM) and Airborne Gravity Magnetic (AGM) data was acquired to understand basinal configuration. • Special seismic data processing steps were applied to attenuate coherent & incoherent noises and to handle out of plane multiples. • Generation of processed output in time and depth domain to have better subsurface geological imaging. • Interpretation of processed seismic data and other geophysical data such as GM, SAR etc. for regional understanding covering tectonic interpretation, lead identification and prospect mapping to have effective geological appraisal of the area for advance exploration.
80 INDIA - Hydrocarbon Exploration and Production Activities - 2011-12 DGH
ENVIRONMENTAL ISSUES ROLE of DGH towards Safety & Environment The Oil & Gas Industry needs to take its own, unilateral steps to increase dramatically safety throughout the industry including self policing mechanisms that supplement governmental enforcement. This goes a long way in building trust of the stakeholders. DGH under the aegis of MOP&NG ensures through the stipulations of the Production Sharing Contract under its Article 14, use of modern oil field and petroleum industry practices and standards including advance techniques, practices and methods of operation and compliance of applicable laws for protection of environment and conservation of natural resources. Studies by DGH on environmental issues
DGH with its proactive approach plays a vital role in addressing some of the key environmental issues UNCONVENTIONAL HYDROCARBONS & OTHER ACTIVITIES like Terrain stabilization and Wildlife and habitat protection. Out of two major studies initiated by DGH on environmental issues, Satellite tracking study of migratory path of Olive Ridley Sea Turtles in the east coast of India, is the biggest ever project of this kind in the world and the involvement of MOP&NG in sea turtle conservation and research activities was acknowledged in the various international forums. This study offered a better understanding of the distribution, habitat requirement and movement pattern of Olive Ridley sea turtles in the coastal waters off Orissa coast and the socio-economic concerns of fishermen and other stake holders with respect to their long term conservation and for rational planning of hydrocarbon exploration in this region. Wildlife Institute of India, Dehradun (WII) under the direction of Ministry of Environment & Forests, Government of India undertook the project study of satellite tracking study with 70 Platform Transmitter Terminals (PTT). Offshore Safety and Environmental Protection : With increasing shipping movement due to crude oil imports & upcoming deep water E&P activities in Indian waters and the aftermath of Macando oil well blowout in gulf of Mexico, a meeting was held earlier under chairmanship of Addl. Secretary P&NG on 23rd June 2010 to review offshore safety with representatives of MOEF, OISD, DGH, Coast Guard and all offshore operators. In the meeting, the Ministry reiterated Government’s commitment to ensure safe oil and gas operations. All E&P companies were advised to be ever prepared for any contingencies even at the cost of redundancy in safety systems and it was cautioned that the Gulf of Mexico disaster is a wakeup call and we should aim for 100% safe operations through upgradation of SOP’s and lessons learnt. For adequate oil spill response capability in India, the Ministry requested Coast Guard to take up the matter with concerned ministries to explore the possibility of setting up two oil response centres, as proposed by DGH one in the East Coast and the other in the West Coast of India which should be similar to EARL, Singapore and OSRL, U.K to handle larger oil spill. As a need of hour, based on the sensitivity and activities, total of eight locations in East Coast and West Coast of India were identified and MOU were set for pooling capability. These 8 locations are mentioned below : Location MOU among the Operators for pooling resources 1. VADINAR IOCL, RIL, ESSAR & BORL 2. HAZIRA CAIRN INDIA & NIKO 3. MUMBAI HIGH ONGC & BG 4. KOCHI BPCL & PORT 5. PUDUCHERRY HARDY & HOEC 6. KG BASIN / YANAM CAIRN, RIL, GSPC & ONGC 7. VIZAG HPCL & PORT 8. PARADEEP IOCL & PORT It was also decided that Tier I level Oil spill response facilities should be ensured during exploration / production phase to combat oil spill at incipient stage and it is being complied to. Presently Coast Guard is equipped with Level 2 oil spill response facilities and all E&P operators are members of EARL, Singapore and OSRO, U.K. for level 3 oil spill response. Coast Guard and other organisations are
INDIA - Hydrocarbon Exploration and Production Activities - 2011-12 81 DGH
imparting training to build up trained power to handle the response. There has been a close coordination among DGH, OISD, ICG and Ports on the issue of oil spill response capacity build up. Government of India is seriously considering establishing Oil spill response centres in Indian waters for larger oil spill contingency. Contribution to ecological restoration and environmental remediation by NOC’s
ONGC ONGC, being responsible organization for protection of environment and restoration of Biodiversity, has extended two major projects to conserve the vital biodiversity. Ringal Bamboo Plantation and Eco Forestry ONGC got planted 4.0 lakh ringal plants in Kedarnath Wildlife Division (KWD), Nanda Devi Biosphere region (NDBR) and Munsyari Block of Pithoragarh forest Division in Upper Himalaya. This project of eco-rebuilding of fragile Himalayan ecosystem is not only benefial from environmental point of view but also would be able to provide livelihood and employement opportunity to people living at high altitude having very meager source of income. So far more than 7.0 ringal plants have been planted in upper Himalayas. It is planned to cover 730 ha of forest area to plants in phased manner. Mangrove Plantation ONGC has undertaken a drive to plant mangrove in the coastal areas of Dadhar River and in the phase-I has planted more than 17 lakh mangrove plants and propugules against target of 5.0 lakh mangrove plants. During the year 2011-12, second phase of ‘Mangrove Restoration and Conservation Education Unit’ project has been launched to plant mangrove in Ankleshwar and Hazira. The project envisages planting of 5.0 lakh mangrove plants and 10.0 lakh propugules in Ankleshwar and 1.0 lakh mangrove plants in Hazira.
Bioremediation of oily sludge and contaminated soil UNCONVENTIONAL HYDROCARBONS & OTHER ACTIVITIES HYDROCARBONS & OTHER UNCONVENTIONAL ONGC has adopted an environmentally sound technique of bioremediation for treatment of oily sludge and oil contaminated soil in operating installations. The harmful organic components of sludge/ soil are converted into carbon dioxide and water after treatment. This technique has been successfully utilized for treatment of 25000 MT approx. of oily sludge/ oil contaminated soil during the year 2011-12.
Before Bioremediation After Bioremediation
82 INDIA - Hydrocarbon Exploration and Production Activities - 2011-12 DGH
OIL OIL has successfully carried out a project on Bio-remediation of oily sludge in collaboration with TERI. This technique is also now applied in fields wherever applicable. A project of Bio-remediation has been implemented in old pits containing oily sludge. OIL has carried out a pilot scale study on phyto-remediation of oil contaminated soil and field trial is in progress. The new initiative such as disposal of MSW in a scientific way, policy decision for environmental protection and safety of drilling locations to restore the well plinth to make it at least aesthetically acceptable after the drilling is completed and has brought encouraging results in controlling pollution and maintaining better environment in OIL’s operational areas.
Corporate Social Responsibility (CSR) by E&P Companies We are living at a time when the social context of business is being redefined. From the past decade, the social demand made on companies to be environmentally and socially responsible in their business has been increasing at unprecedented rates. The Companies now recognise the UNCONVENTIONAL HYDROCARBONS & OTHER ACTIVITIES importance of Corporate Social Responsibility and the need to strike a balance between the overall objectives of achieving corporate excellence vis-à-vis the corporate responsibility towards the community. Operators are making significant social investments in the communities where they operate and also contribute positively to local sustainability through their operations. The Corporate Social Responsibility (CSR) programmes by E&P companies in India fall under the various thematic areas of Education, Livelihood, Medical & Health, Environment, Disaster relief, Women empowerment, Cultural, Community improvement, Welfare, Economic Infrastructure & human development.
All CSR projects are mainly carried out by following ways: a) Directly by Operator/JV b) In association with State Government Departments c) In partnership with reputed NGOs d) By donation
Glimpse of CSR activities
INDIA - Hydrocarbon Exploration and Production Activities - 2011-12 83 DGH
84 INDIA - Hydrocarbon Exploration and Production Activities - 2011-12 DGH SUPPLEMENTARY INFORMATION SUPPLEMENTARY INFORMATION
- PEL & ML Details - Inplace reserves accretion, Oil/Gas Discoveries & Production trends - Details of Oil & Gas Discoveries in Pre-NELP and NELP - Extracts from XIITH Five Year Plan - Extracts from BP Statistics Review 2012 - Glossary of common Oil field Terms - List of some companies in Indian E&P sector
INDIA - Hydrocarbon Exploration and Production Activities - 2011-12 85 SUPPLEMENTARY INFORMATION 86 DGH 4 NI yrcro xlrto n rdcinAtvte 2011-12 - Hydrocarbon Exploration andProduction Activities - INDIA
P
A COMPANIES PVT/JV OIL AND ONGC, BY OPERATION UNDER AREAS ML PEL AND
K I GUJARAT S T A N 3 RAJASTHAN
2
DS-ONN-2003/1
MAHARASHTRA GOA 1 KARNATAKA PUNJAB JAMMU & KASHMIR HARYANA VN-ONN-
DELHI 2003/1 KERALA HP-1 MADHYA PRADESH MADHYA 5
HIMACHAL TAMIL NADU TAMIL PRADESH
ANDHRA PRADESH HF-ONN-2001/1 Kashipur MP-2 UTTAR PRADESH
GV-ONN-2004/1 GV-ONN-97/1 7 LANKA MP-1 SRI
Kashipur Extn Kashipur CHATTISGARH
6 N
E
9 P ML AREAS AREAS PEL ORISSA
GV-ONN-
BIHAR JHARKHAND A 2003/1 CHINA LEGEND CBM-III
Relinquished Area PVT/JV OIL ONGC CBM-II CBM-I PVT/JV OIL ONGC
NELP IX L 2002/1 ONN- GV- BENGAL WEST WEST WB-1
AN-DWN-2009/2 SIKKIM AN-DWN-2009/1 AN-DWN-2009/5
BANGLADESH
8 10
BHUTAN
MEGHALAYA AN-DWN-2005/1 ASSAM
TRIPURA
2009/3 AN-DWN-
& & AN-DWN-2002/2 AN-DWN-2002/1
N
I N
C A
O M
B A
A
D
R
N
A I
ARUNACHAL PRADESH
S
L
MIZORAM
A (AS ON01.04.2012)
D N
MANIPUR
S
: AN-DWN-2003/1 MYANMAR
NAGALAND AN-DWN-2009/13 AN-DWN-2003/2 AN-DWN-2009/18 11 SUPPLEMENTARY INFORMATION 87 DGH AJMER ONGC OIL PVT/JV CBM-I CBM-II ONGC OIL PVT/JV NELP-IX CBM-III CBM-IV Relinquished Area LEGEND PEL AREAS AREAS ML 2004/1 RJ-ONN- 2002/1 RJ-ONN-
RAJASTHAN
N JODHPUR A 2001/1 RJ-ONN-
BS(2)-CBM-2003/II T 2004/2 RJ-ONN- BS(5)-CBM-2005/III
ORJM-2 RJ-ONN-2004/3 S MANGALA ML MANGALA CB-0N/1 BHAGYAM SHAKTI FIELD SHAKTI BHAGYAM
Pt.A I
INDIA -Activities Hydrocarbon Exploration and Production - 2011-12 90/1 RJ-ON- 2003/II Pt.B 2005/III 2003/II BS(1)-CBM- BS(4)-CBM-
BS(3)-CBM- 1. RAJASTHAN BASIN RAJASTHAN 1. K RJ-ONN- 2000/1 RJ-ONN- RJ-ONN-2003/2
RJ-2
GUJARAT A KAAMESHWARI (W) KAAMESHWARI RJ-ONN-2005/3 RJ-ONN-2005/2 RJ-ONN-2005/1 ORJM-1
P RJ-ON/6 RJM-3 RJM-1 RJM-2 RJM-4 RJ-1 RJ-ONN-2003/1 SUPPLEMENTARY INFORMATION 88 DGH NI yrcro xlrto n rdcinAtvte 2011-12 - Hydrocarbon Exploration andProduction Activities - INDIA
CB-ONN-2002/2 (PT-B) CB-ONN-2002/2 CB-ONN-2005/2-B CB-ONN-2002/1 ML AREAS PEL AREAS CB-ON-1 MM-36 LEGEND CB-ONN-2009/1 Area Relinquished PVT/JV OIL ONGC PVT/JV OIL ONGC MM-28 NELP-IX CB-ONN-2009/2 M-1
MM-14 2005/2-A CB-ONN- M-10 MODHERA
M-6-II CB-ONN-2009/1
M-3 MM-24 MM-25
M-5
CB-ONN-2009/5
MM-13 2005/3
CB-ONN- M-7-B CB-ONN-2009/6 ASJOL
MM-37 (Pt-II) MM-23
AM-53 M-14 CB-ONN-2002/2
MM-37 (Pt-I) M-7-A
N. BALOL N. MM-1 (PT-A) CB-ONN-2009/7 MM-15 2. NORTH CAMBAY BASIN
AM-16
LOHAR MM-16 MM-2 MM-12 M-8 ALLORA M-6-I
CB-ON/3
MM-17 MM-3
MM-26
AM-15 MM-11
AM-44
MM-27
MM-18 MM-10
M-9 CB-ONN-2003/1 AM-19
MM-9 AM-45
MM-38
AM-36
UNAWA
(PART-A)
Ingoli Field Ingoli CB-ONN-2000/1 MM-5
A-6 MM-32
CB-ONN-2009/8 MM-4 BAOLA AM-17
C MM-19 B (Part:A) MM-7
MM-29 (Part-A) MM-29 MM-20
-ONN CB-ONN-2009/3 -
AM-49 2 MM-8
0 0 AM-34
CB-ONN-
AM-20 4 KARJISAN 2002/3 2002/3 MM-31 / AM-18 1 MM-6 MM-29 (Part-B) MM-29
AM-42 AM-14 MM-30 MM-22 DHOLASAN AM-1 (PT-A) (Part:B) CB-ONN-2009/3 SANGANPUR MM-34
AM-52
AM-3 AM-2
AM-32
CM-14 MM-33 A-13 AM-9
CB-
AM-35 ONN- 2005/6
MM-35 M-13
(PT-B)
AM-8
DHOLKA OGNAJ AM-43 AM-51
AM-12 AM-13 KANAWARA AM-31 A-3 AM-46
CAMBAY AM-48
MM-21 AM-10 CB-ONN-2005/4 AM-26 AM-29 SABARMATI AM-6 AM-4 A-2
CM-1
AM-50 AM-11
M-12 AM-27 AM-30 CB-ONN-2009/4
AM-24
AM-5 AM-47 AM-38 .KATHANA N. AM-37
CB-ON/2
AM-33 INDRORA
WAVEL
CB-ONN-2003/1 (PART-B) CB-ONN-2003/1
A-9 AM-40
AM-25
CB-ONN-2005/5 BAKROL A-10 AM-28 CB-ONN-2001/1
A-14 AM-7 AM-23
CB-ONN-2004/2 CM-3
A-1
AM-21 AM-39 AM-22 AM-41 CM-2 CM-16
Part-A CM-18 Part-B CM-15 C-1
AN-1 C-3
6 CM-4 SUPPLEMENTARY INFORMATION 89 DGH Relinquished Area NELP-IX ONGC OIL PVT/JV ONGC OIL PVT/JV LEGEND AN-7 ML AREAS PEL AREAS AN-5
CM-5 ML PROMODA CB-ON/7-R1
CM-12 CM-17
CB-ONN-2005/7 CM-7 CB-ONN-2005/8
CM-9 CB-ON/7-R2 CM-6
ANM-19
CM-4 CM-11 CB-ONN-2003/2
C-3 CM-10 CB-ONN-2005/9
CM-8
ANM-20 MATAR AN-9
C-2 CB-ONN-2004/5 C-1 ANM-4 ANM-1 ANM-41 ANM-29 CM-15 CM-13
ANM-2 ANM-27
ANM-36 ANM-22 ANM-3 ANM-21
CM-2
ANM-5 CM-16 AN-10 ANM-26 ANM-44 ANM-23
CB-ONN-2005/11 ANM-33 CB-ONN-2005/10 ANM-6 AN-16 ANM-35 CB-ONN-2004/2 CM-3
ANM-17 CB-ONN-2004/4
ANM-25 NS-A
ANM-24
ANM-34 BHEEMA
ANM-42 ANM-14 ANM-39 ANM-18
ANM-12 ANM-30 2004/3 ANM-28 CB-ONN- CB-ONN-2003/1 (PART-B) CB-ONN-2003/1 ANM-13 N. KATHANA N. ANM-38 ANM-40 ANM-11 CB-ON/2 ANM-44 ANM-10 ANM-16 ANM-15 CM-1 B-9
ANM-9 HAZIRA AM-46 CAMBAY ANM-37 ANM-7 ANM-31 INDIA -Activities Hydrocarbon Exploration and Production - 2011-12 ANM-8
BHANDUT GAURI AM-35 CM-14 KANAWARA LAKSHMI ANM-32 CB-OSN-2003/1 (PT-A) CB-OS/1 B-1 CB-OS/1 (PT-B) CB-OS/1 N. TAPTI (PART-A) CB-ONN-2003/1 3. SOUTH CAMBAY BASIN CAMBAY SOUTH 3. AMBE CB-OSN-2004/1 MID & SOUTH TAPTI MB-OSN-2004/1 SUPPLEMENTARY INFORMATION 90 DGH PEL AREAS PEL ML AREAS NI yrcro xlrto n rdcinAtvte 2011-12 - Hydrocarbon Exploration andProduction Activities - INDIA LEGEND PVT/JV OIL ONGC PVT/JV OIL ONGC NELP-IX Area Relinquished GS-DWN-2000/1 K-5 GK-OSN-2009/1 PAKISTAN GS-DWN-2002/1 4. KUTCH-SAURASHTRA BASIN
GS-DWN-2000/2 GK-OSJ-3 GS-OSN-
2004/1 GK-ON/4 GK-OSN-2009/2 GK-OS/5 GK-ON-90/2 SR-OSN- B-10 97/1 SR-OS-94/1 GS-OSN- 2001/1 GUJARAT BHUJ 2005/3 MB-OSN- 2003/1 GS-OSN- B-9 GS-OSN-
2000/1 B-1B B-1C 2005/4 MB-OSN-
RAJKOT BM-15 B-6 BM-16
B-6 BM-17
B-5 B-2 2005/1 MB-OSN BM-10
B-3
BM-6 BM-18
BM-2 BM-1 MB-OSN- BM-12
2005/5 BM 20 -O
MB-OSN- M SUPPLEMENTARY INFORMATION 91
DGH
CUDDAPAH
HYDERABAD
CY-DWN-2
CY-ONN-2004/2 BANGALORE
I L T N A D U A M
2001/3 ANDHRA PRADESH ANDHRA KK-DWN- TRIVANDRUM KK-OSN-2000/1 COCHIN
KERALA KK-OSN-2001/3 KK-DWN-2001/2 CALICUT
KK-OSN-2001/2 KK-DWN-2001/1 KK-2
KARNATAKA KK-OSN-97/3
MAHARASHTRA
GOA
KK-DWN-2002/3
KK-OSN-97/2 PANAJI KK-DWN-2005/1
KK-DWN-2002/2
MUMBAI
SURAT
KK-DWN-2000/4
2003/2
KK-1
KK-DWN- KK-DWN-2005/2
B-7
2004/2
MB-OSN-
CB-ONN-2004/5 BM-8 BM-22 BM-20
MB-OSN- 2009/7
BM-13 MB-OSN-2000/1
KK-DWN-2003/1 BM-7
BM-11 BM-5 MB-OSN- 2009/6 BM-4
B-1A
BM-23
BM-14 MID & TAPTI SOUTH BM-9 PANNA
BM-21 MB-DWN- 2005/9 KK-DWN-2004/1 BM-19
MUKTA MB-OSN- 2009/3
2005/2 2005/6 MB-OSN- MB-OSN- BM-3 BM-12
MB-DWN- 2005/5 BM-6 MB-DWN- 2009/1 BM-2 BM-24
KK-DWN-2000/1 2005/5 MB-OSN-
MB-DWN-2005/7
BM-1 BM-18
BARODA (VADODARA) 2005/1 B-6 2000/2 MB-OSN- BM-10
B-5 KK-DWN-2000/3 B-2 KK-DWN-
INDIA -Activities Hydrocarbon Exploration and Production - 2011-12
2005/3 MB-DWN- BM-16 BM-17 !(!(
CB-OSN-2004/1 BM-15 B-1C
B-1B MB-DWN- 2005/6 B-9
MB-DWN-2005/4
2005/2 MB-DWN- 2003/1 MB-OSN-2004/1 GS-OSN- 2000/1 LAKSHADWEEP GS-OSN-
GUJARAT MB-OSN-2005/3
GS-OSN-2001/1
SR-OS-94/1 SR-OSN- 97/1 SR-OSN- B-10 GS-OSN-2004/1 5. MUMBAI OFFSHORE & KERALA - KONKAN BASIN - KONKAN & KERALA OFFSHORE MUMBAI 5. GS-DWN- 2000/2 GS-DWN-2002/1 A R A B I A N S E A K-5 Relinquished Area NELP-IX ONGC OIL PVT/JV ONGC OIL PVT/JV LEGEND GS-DWN- 2000 /1 ML AREAS ML PEL AREAS SUPPLEMENTARY INFORMATION 92 DGH BANGALORE NI yrcro xlrto n rdcinAtvte 2011-12 - Hydrocarbon Exploration andProduction Activities - INDIA
TAMIL NADU TAMIL 2000/1 CY-OSN- CY-DWN- 2001/1
2009/1 CY-OSN-
CYL-4 CY-ONN-2004/2 CY-ONN-2003/1 CYL-6
CYM-21 CY-ONN-2002/2 CYO-2 CUDDAPAH 2009/2 CY-OSN- CYM-10 CY-ONN-2002/1
CYM-23 CYO-1
CYM-12
CYL-3 CYM-2
CYL-5 CYM-15 CY-ONN-2005/1
CY-OSN-97/2 CYM-19 PONDICHERY CYM-3 CYM-8
CYM-20 CYL-1 CYM-4
CYM-1 CYM-5 CYM-18 CYM-9
CYM-16
CYM-14
CYL-2
CYM-17 CYM-11 CYM-7
CYM-6
PR-ONN-2005/1 CY-ONN-2004/1 CYM-13 CYM-22 CY-OSN-97/1 PY-1 CY-OS/2 CY-OS-90/1 6. CAUVERY BASIN
(PY-3) PR-OSN-2004/1 CHENAI CY-PR-DWN-2001/4 CY-PR-DWN-2001/3 CY-DWN-2001/2 BENGAL BAY OF CY-PR-DWN-2004/1 CY-DWN-2004/1 CY-DWN-2004/3 KG-DWN-2004/1 CY-PR-DWN-2004/2 CY-DWN-2004/2 CY-DWN-2004/4 KG-DWN-2004/2 PEL AREAS PEL ML AREAS ML KG-DWN-2004/3 LEGEND PVT/JV OIL ONGC PVT/JV OIL ONGC Area Relinquished SUPPLEMENTARY INFORMATION 93
DGH MN-DWN-2004/2 MN-DWN-2004/1 Relinquished Area ONGC OIL PVT/JV ONGC OIL PVT/JV KG-DWN-2004/6 LEGEND KG-DWN-2002/1
ML AREAS MN-OSN-2000/1 PEL AREAS KG-DWN-2004/3 KG-DWN-2004/7 KG-DWN-98/5 OF BAY BENGAL
KG-DWN-2004/5 KG-DWN-2005/2 KG-DWN- 2009/1 KG-DWN- (Part:B) KG-OSN-97/1 KG-DWN-2004/2
KG-DWN-2001/1
(Part:A)
KG-DWN- 2009/1 KG-DWN- KG-DWN-98/4 KG-OSN-2005/2 (D-1&3) KG-DWN-2004/4 CY-DWN-2004/4 KG-OSN-2005/1 KGM-39 KG-DWN-98/3
CY-PR-DWN-2004/2 KG-OSN-2001/3 VISHAKHAPATNAM
KGM-38 KGM-36 KGO-3 2001/3 2001/2 KG-OSN- KGM-33 KG-OSN-
KG-DWN-2004/1 KGO-1 98/2
KGM-40 KGM-2 RAVVA KGM-28
KGM-35 KG-DWN- KG-DWN-2005/1 KGM-26
KGM-1
KGM-17 KGM-6 KGM-32
KGM-3 KGM-4
KGM-16
KG-ONN-2004/1 KAKINADA
KGM-19 KGM-5 KGM-35
INDIA -Activities Hydrocarbon Exploration and Production - 2011-12 KGM-30 KGM-7 KGM-21 KGO-7
KGM-22 KGM-8 KGM-37 KGM-18 ORISSA KGM-31 KGM-12 KGM-11 KGM-9 KGM-27 KGO-5 KGM-29 KGM-25 2004/1 KG-OSN- KGM-10 CY-DWN-2004/3 KGL-1 RAJAHMUNDRY KG-DWN-2003/1 KGM-23 CY-PR-DWN-2004/1 KG-DWN-98/1 2001/1
KG-OSN-
(Area-II)
7. KRISHNA-GODAVARI BASIN KRISHNA-GODAVARI 7. 4 KGM-14 /
KGL-2 9
KGM-24 0
PG-ONN-2001/1 0 2
- KGM-20 N (Area-I)
KGM-13 S CHATTISGARH
KGM-15
O - PG-ONN-2001/1
G 2001/3
K 2001/4 CY-PR-DWN- 2001/1 CY-PR-DWN- (Area-III) PG-ONN- KG-ONN-2003/1 PR-DWN-2001/1 KG-OSN- 2009/3 2004/1 KG-ONN-2004/2 PR-OSN- GN-ON-90/3 KG-ON/1 KG-OSN- 2009/2 KG-OSN- 2009/1 ANDHRA PRADESH PR-ONN- 2005/1 TAMIL NADU CHENNAI SUPPLEMENTARY INFORMATION 94 DGH DA SR-ONN-2004/1
KG-OSN- NI yrcro xlrto n rdcinAtvte 2011-12 - Hydrocarbon Exploration andProduction Activities - INDIA 2005/1 M.P. KG-DWN-2001/1 KG-DWN-98/4 MR-CBM-2005/III KG-OSN- CHATTISGARH KG-DWN- 2009/1 TR-CBM-2005/III
(Part:A) 2005/2 PRADESH
KG-OSN- ANDHRA (Part:B) 2009/1KG-DWN- 97/1 KG-DW IB-CBM-2008/IV N- 20 0 5 8. MAHANADI -NEC -BENGAL -DAMODAR BASINS / 2 KG-DWN-2004/7 KG-DWN- 98/5 NK(West)-CBM-2003/II ORISSA
KG-DWN- MN-OSN-2000/1 2002/1 JHARKHAND TL-CBM-2008/IV NK-CBM-2001/I MN-DWN- 2002/1
SK-CBM-2003/II MN-DWN-2004/1
MN-DWN-2004/2
BK-CBM-2001/I
MN-DWN-2002/2
MN-DWN-98/2 MN-OSN-2000/2 MN-ONN-2000/1 MN-DWN-2004/4
JHARIA BLOCK JHARIA WEST BENGAL MN-DWN-2004/3
RANIGANJ SOUTH MN-DWN-2003/1
MN-OSN-97/3
RG(East)-CBM-2001/I RM-CBM-2005/III
BB-CBM-2005/III
NEC-OSN-97/2
MN-DWN-2004/5
WB-1 MN-DWN-98/3 RANIGANJ NORTH 2005\3 WB-ONN- NEC-DWN-2002/2 RM(E)-CBM-2008/IV 2005\2 WB-ONN- NEC-DWN-2002/1 NEC-OSN-97/1 WB-OSN-2000/1 WB-ONN-2000/1 2005\4 WB-ONN- NEC-DWN- 2004/2 NEC-DWN- 2004/1 ML AREAS ML PEL AREAS G D A H N A B S E L LEGEND Relinquished Area CBM-IV CBM-III PVT/JV OIL ONGC CBM-II CBM-I PVT/JV OIL ONGC SUPPLEMENTARY INFORMATION
95
2
/
5
0
DGH 0
2
-
N
W
D -
G K VISHAKHAPATNAM
KG-DWN- 2009/1 KG-DWN- (Part:B)
2005/2 (Part:A) KG-DWN- 2009/1 KG-DWN- KG-OSN- TR-CBM-2005/III VARANASI MR-CBM-2005/III IB-CBM-2008/IV GV-ONN-2004/1 2005/1 KG-OSN- ORISSA KAKINADA SP(NE)-CBM-2008/IV ALLAHABAD SR-ONN-2005/1 SR-CBM-2005/III 2001/I SP(East)-CBM- RAJAHMUNDRY CHATTISGARH 2001/I SR(W)-CBM-2008/IV SP-CBM-2005/III SR-ONN-2004/1 SP(West)-CBM- PG-ONN-2001/1 KG-(East)-CBM-2005/III MADHYA PRADESH MADHYA WD-CBM-2003/II 2009/3 VN-ONN- KATNI DAMOH-JABERA- GN-ON-90/3 INDIA -Activities Hydrocarbon Exploration and Production - 2011-12 WD(N)-CBM-2008/IV ST-CBM-2008/IV
MAHARASHTRA WD(E)-CBM-2008/IV UTTAR PRADESH HYDERABAD ANDHRA PRADESH ANDHRA GWALIOR ST-CBM-2003/II
9. SATPURA-PRANHITA GODAVARI BASINS RAMPUR-PACHMARHI-ANHONI BHOPAL NELP-IX PVT/JV CBM-I CBM-II ONGC OIL ONGC OIL PVT/JV CBM-III CBM-IV Relinquished Area Relinquished LEGEND ML AREAS ML PEL AREAS PEL VN-ONN-2004/2 VN-ONN-2003/1 SUPPLEMENTARY INFORMATION 96 DGH NI yrcro xlrto n rdcinAtvte 2011-12 - Hydrocarbon Exploration andProduction Activities - INDIA
PEL AREAS BANGLADESH ML AREAS LEGEND PVT/JV OIL ONGC PVT/JV OIL ONGC NELP-IX Area Relinquished BHUTAN
MEGHALAYA A TM-8 & 9 & TM-8 BENGAL TM-14 TM-7 TM-15 TM-13 TM-6 10. ASSAM-ARAKAN BASIN
BAY OF TM-11
TM-10 T-3
GUWAHATI TM-16
TM-5
S TM-17 T-1 TM-12 TM-4
TM-3 TM-2 TM-1 T-1 TM-21
TRIPURA
AA-ONN- 2002/1 CHM-3
S AA-ONN-2001/1
CH-2B ARUNACHAL PRADESH CHM-1
CH-2A AA-ONN- CH-1B 2001/2 CH-3
2004/1 MZ-ONN-
2004/2 MZ-ONN- AS-ONN-2000/1
A CH-1A CHM-4 CHM-2 AA-ONJ/2 CH-4 AA-ONN-2009/1 AA-ONN- 2002/3 AA-ONN-2009/2 MYANMAR MIZORAM AA-ONN-2001/3 AA-ONN-2003/1
M AA-ONN-2002/4 DH-4 MANIPUR NG-3 DH-2 DHM-8 DHM-4 DHM-2 DHM-7
AA-ONN-2005/1 DHM-1 DHM-5 DHM-6 NG-1 DHM-10 DH-1 DH-3 AA-ON/7 NAGALAN DHM-9 DHM-3
AA-ONN-2001/
NGM-1 SUPPLEMENTARY INFORMATION 97 DGH OA-11 Kharsang (Pt-B) OA-10 OAM-11 OA-12
Relinquished Area
NELP-IX ONGC OIL PVT/JV ONGC OIL PVT/JV
OA-10 (Pt-A) OA-10 LEGEND OAM-16 AA-ONN-2003/2 OA-9 AA-ONN-2004/5 ML AREAS ML OAM-10 PEL AREASPEL
OA-13
OA-8 OA-16
AA-ONN-2003/3
OAM-9 AA-ONN-2004/4 OAM-8 OAM-20 OA-7A OA-5 OAM-7 OA-17 OAM-14
OA-4
OAM-18
OAM-19 AAP-ON-94/1 MYANMAR OAM-4 Deomali Extn
OAM-5
OA-15 OA-7B
OA-6 OAM-21 OA-3 OAM-12 OAM-6 OAM-3 OAM-17 OAM-2
UAM-1 OAM-15 OAM-13 UAM-2
UA-1 UAM-20 OAM-1 NG-2
UAM-3 UAM-4 OA-2 UA-1 UAM-13 INDIA -Activities Hydrocarbon Exploration and Production - 2011-12
OA-14
UAM-19
AA-ONN-2004/2 Pt-B AA-ONN-2004/2 UAM-17 UA-1 UAM-14
UAM-15
UAM-5 UAM-8
UA-1
UAM-11
UAM-9
UAM-12 UAM-18
UAM-7
UAM-6 AA-ONN-2004/2 Pt-A AA-ONN-2004/2
UA-1 11. ASSAM-ARAKAN BASIN ASSAM-ARAKAN 11. UAM-16 Amguri UAM-10 NAGALAND AA-ONN- 2009/3 NGM-1 AA-ONN-2004/3 AA-ONN-2004/1
NG-1 DHM-1
AA-ONN- 2009/4 AA-ONN-2001/4 KOHIMA DHM-9 MANIPUR OA-1 AA-ON/7 DHM-10 DHM-3 AA-ONN-2001/3 DHM-2 ARUNACHAL PRADESH ARUNACHAL DH-4 DH-3 AA-ONN-2005/1 DHM-4 DHM-5
AA-ONN-2002/4
DHM-6 DHM-7
AA-ONN-2003/1 DH-2 NG-3 DHM-8 SUPPLEMENTARY INFORMATION 98 DGH 11 10 9 8 7 6 5 4 3 sa-rknA-N-023N4 50.51095.00 05.02.05 N-48 8 7 AA-ONN-2002/3 6 5 Assam-Arakan 4 sa-rknMurkongselek (NF) 2 Assam-Arakan 1 PRE-NELP /NELPBLOCKS 1Kiha-Gdvr KG-O Krishna -Godavari 11 2196.00 Mizoram 10 21.01.08 9 20 RJ-ONN-2004/2 3 2 Rajasthan 1 No. NOMINATION BLOCKS BASIN Sl. 2Cauvery 12 NI yrcro xlrto n rdcinAtvte 2011-12 - Hydrocarbon Exploration andProduction Activities - INDIA Murkongselek (F) Jairampur Extn. Borhat Dibrugarh Deomali Jairampur Namchik Namsai Dirak AON21/ 80.2396.00 84.00 28.03.12 218.00 108.00 30.06.10 28.06.07 2 28.06.07 4 10 AA-ONN-2010/2 9 AA-ONN-2009/4 AA-ONN-2004/2 AA-ONN-2004/1 Tinsukia AON21/ 80.2171.00 28.03.12 3 AA-ONN-2010/3 1330.00 21.01.08 15 21 RJ-ONN-2005/2 RJ-ONN-2004/3 ZON20/ 20.73213.00 22.05.07 7 MZ-ONN-2004/1 BLOCK NAME YON20/ -03.61 1621 30.06.10 S-20 CY-OSN-2009/2 N20/ 816.02.08 28 NN-2004/1 PELs OPERATED OIL BY E.N.EFFECTIVE REF. NO. ON MAP DATE OF PEL (Sq. Km.) (Sq. Km.) (Sq. Km.) (Sq. DATE OFPEL ON MAP A1 10.623.25 01.04.06 OA-11 A1 80.5113.50 18.02.05 OA-17 A1 10.5195.00 01.05.05 OA-10 A1 50.1111.00 15.02.11 OA-15 A1 50.1427.00 15.02.11 OA-14 A1 10.618.00 01.04.06 OA-12 A30.40 95.00 01.04.08 OA-3 A20.40 449.00 01.04.02 OA-2 OA-6 A81.10 85.00 18.11.01 OA-8 A92.10 370.00 25.11.04 OA-9 10.2480.00 01.04.02 21.81517.00 22.12.08 RN OA 14826.75 GRAND TOTAL TOTAL TOTAL RATOTAL AREA 511 As on01.04.2012 12460.00 2366.75 3213.00 2366.75 5043.00 1621.00 2072.00 511.00 AREA SUPPLEMENTARY INFORMATION 99 AREA DGH 5275.08 1427.27 3309.70 1371.00 2490.18 4208.00 1828.00 16557.00 31447.06 18538.23 As on 01.04.2012 AREA TOTAL 20.07.05 876.50 28.04.06 320.00 01.04.04 824.00 28.12.03 1517.50 01.10.04 16557.00 TOTAL ONLAND TOTAL TOTAL OFFSHORETOTAL 49375.06 TOTAL NOMINATIONTOTAL 67913.29 A&B 01.04.03 733.00 -1 10.11.03 1828.00 6 19.11.06 846.00 14 30.06.10 58.00 20 22.12.08 31.00 222324 20.10.07 28.05.07 17.05.07 32.00 423.00 113.00 26 22.12.08 270.00 25 28.05.07 70.00 T-1 15.09.03 1528.58 K-5 B-9 28.12.04 7537.00 B-2 N57 05.12.05 1795.50 N52 18.10.04 36.00 N45 19.08.03 26.00 GO-5 22.10.04 74.00 M-1 04.09.05 11.10 B-10 28.12.04 8950.00 A-10 10.12.05 30.27 HP UA-1 01.04.02 456.50 CH-4 AN-7 26.03.04 833.00 DH-3 01.10.01 60.00 AN-5 24.10.03 365.40 DH-4 20.01.01 83.00 NG-3 28.04.06 650.00 NG-2 NG-1 28.04.06 620.00 CYL-1 01.04.04 948.16 CYL-3 01.04.04 1542.02 KGL-1 KGL-2 13.01.04 1792.20 KGO-7 15.05.03 1190.00 KGO-1 16.12.04 107.00 K ON MAPON OF PEL DATE (Sq. Km.) (Sq. Km.) CH-1 / 2 / 3) B-1 A,B&C 14.11.03 13452.06 Extn.I M-13 03.11.03 187.50 atni MP-1 10.11.03 4208.00 INDIA -Activities Hydrocarbon Exploration and Production - 2011-12 OPERATED BY ONGC BY OPERATED
a ad PELs ar District - IE CB-ONN-2009/4 CB-OS/1 Dimapur CB-OSN-2003/1 CB-ONN-2005/4 CB-ONN-2005/10 CB-ONN-2002/1 CB-ONN-2004/1 CB-ONN-2004/3 CB-ONN-2004/4 CB-ONN-2004/2 Cachar District C (Assam) Sector-V Tripur West Bhandari Bhagty Block - IA CB-ONN-2001/1 SW of BH & DCS AreaSW B-6KG-OS-DW-III 01.01.04 631.50 Merapani District Golaghat Charada - Mansa Charada L-II 1B Singphan Saurashtra-Dahanu BLOCK NAME NO. REF. EFFECTIVE Kangra-Mandi Valod Extn.II Karjan Raj-Pardi BB-OS-DW-I BB-OS-DW-II Damoh-Jabera-K Patan-Thar 11 18 5 4 6 9 10 17 3 7 8 13 14 15 16 27 Offshore K-G 28 Block 2 25 24 26 29 10 Assam - Arakan Sibsag 11 12 PRE-NELP / NELP BLOCKS 1 Cambay 22 Mumbai Offshore (BOFF 1 Off Bombay 21 Offshore Gujarat-Kutch GK-DW-1 19 Foreland Himalayan 23 No. 2 3 7 89 Onland K-G 1A 6 Onland Cauvery L-I NOMINATION BLOCKS NOMINATION 1 Cambay Sl. BASIN 20 Vindhyan 4 5 SUPPLEMENTARY INFORMATION 100 DGH 58 57 56 55 K-G Offshore 54 44 KK-DWN-2002/2 Kerala-Konkan43 Offhsore 42 Purnea 25 24 CY-ONN-2002/2 Cauvery Onland 14 1CueyPlrOfhr YP-W-041D 50.713451.00 15.05.07 D8 PALAR 53 CY-PR-DWN-2004/1 52 Cauvery-Palar Offshore 51 50 45 41 GS-OSN-2004/1 GK-OSN-2009/138 Saurashtra36 Offshore Gujarat35 -Kutch - Him.Foreland34 33 32 Vindhyan 29 Ganga Valley28 27 26 23 16 Cambay13 12 BASIN No. Sl. 31 30 22 21 AA-ONJ/2 20 19 18 Assam-Arakan 18 17 15 6CueyOfhr CY-DWN-2004/1 49 Cauvery48 Offshore 46 37 9Mma fsoeMB-OSN-2 MumbaiOffshore 40 39 NI yrcro xlrto n rdcinAtvte 2011-12 - Hydrocarbon Exploration andProduction Activities - INDIA BLOCKNAME KG-DWN-98/5 YP-W-042D 30.79994.00 23.05.07 D9 CY-PR-DWN-2004/2 AA-ONN-2001/4 PA-ONN-2005/1 PA-ONN-2005/2 KG-DWN-2004/1 KG-OSN-2004/1 KG-DWN-2002/1 KK-DWN-2004/1 KK-DWN-2002/3 CY-DWN-2004/4 KK-DWN-2005/2 MB-OSN-2005/6 GK-OSN-2010/2 GK-OSN-2009/2 VN-ONN-2009/3 GV-ONN-2005/3 AA-ONN-2009/3 CY-ONN-2004/2 CB-ONN-2010/6 VN-ONN-2004/2 VN-ONN-2004/1 AA-ONN-2005/1 AA-ONN-2002/4 AA-ONN-2001/3 AA-ONN-2001/2 AA-ONN-2001/1 CY-ONN-2004/1 CY-DWN-2004/3 CY-DWN-2004/2 GK-OSN-2010/1 GV MB-OSN-2005/5 VN-ONN-2003/1 PR-ONN-2005/1 CB-ONN-2010/1 PA-ONN-2004/1 KG-DWN-98/2 HF-ONN-2001/1 PELs -ONN-2004/1
OPERATED BY ONGC 005/1 E.N.EFFECTIVE REF. NO. ON MAP DATE OF PEL (Sq. Km.) (Sq. Km.) (Sq. Km.) (Sq. DATE OFPEL ON MAP -52.20 19234.00 22.12.08 D-15 6 30.5267 23.09.05 N63 4 80.6645.00 28.04.06 N42 4 80.61060.00 28.04.06 N49 4 90.34005.00 1496.00 29.07.03 01.05.03 N40 N39 4 91.3110.00 19.12.03 N41 4 00.31513.88 10.06.03 N43 5 10.4140.00 31.08.04 N56 1 50.711951.00 15.05.07 D10 2 70.415682.00 17.03.04 D27 2 60.47950.00 06.02.04 D28 2 70.417107.00 17.03.04 D26 - 21.82811.00 22.12.08 S-1 - 21.82820.00 22.12.08 S-6 - 80.21625.00 28.03.12 S-2 - 00.01242.00 30.06.10 S-2 - 21.82402.00 22.12.08 S-5 - 80.21361.00 28.03.12 S-1 - 00.01264.00 30.06.10 S-1 51.40 4490.00 12.04.00 D5 72.50 12025.00 21.05.07 D7 10.50 12324.00 09.05.07 D1 52.50 12059.00 23.05.07 D5 62.50 12017.00 21.05.07 D6 21.40 7295.00 12.04.00 D2 42.50 10302.00 28.05.07 D4 13.50 375.00 30.05.08 31 00.50 214.00 02.05.08 30 02.20 2227.00 22.12.08 10 42.31 39.00 28.03.12 14 82.20 1807.00 22.12.08 28 51.20 8354.00 11.12.07 15 1-1277.00 - 11 41.90 2537.00 12.09.07 14 81.10 4466.00 17.01.08 18 71.10 5801.00 17.01.08 17 50.71131.00 25.05.07 6 21.8363.00 22.12.08 1 00.084.00 30.06.10 3 80.2782.00 28.03.12 9 21.81096.00 22.12.08 2 00.01250.00 30.06.10 9 2552.00 22.12.08 3 50.76589.00 25.04.07 1 AREA TOTAL TOTAL AREA 3.00 23445.00 14190.00 10581.00 46403.00 12081.00 64347.00 8033.00 9040.00 1513.88 6185.00 1807.00 4521.50 729.00 AREA SUPPLEMENTARY INFORMATION 101 AREA DGH 67557.80 11733.00 83898.00 36660.00 402725.18 AREA TOTAL TOTAL GRAND TOTAL 470638.47 5 22.12.08 3792.00 67 22.12.08 22.12.08 4001.00 3940.00 D7 19.05.00 4988.00 S-8 22.12.08 1881.00 S-7 22.12.08 2810.00 D-9 30.06.10 3992.00 D-8 30.06.10 3995.00 D11 07.05.07 11851.00 D19 22.12.08 11837.00 D15 23.05.07 10907.00 D16 22.12.08 1727.00 D12D14 08.05.07 23.05.07 6205.00 11922.00 N24 16.08.01 4061.00 S-25 30.06.10 835.00 S-22S-23 30.06.10 30.06.10 1472.00 1471.00 ON MAPON OF PEL DATE (Sq. Km.) (Sq. Km.) REF. NO.REF. EFFECTIVE 2/1 D33 17.03.04 8238.80 INDIA -Activities Hydrocarbon Exploration and Production - 2011-12 OPERATED BY ONGC BY OPERATED
PELs KG-DWN-2004/2 WB-ONN-2005/2 KG-DWN-2004/6 KG-OSN-2005/2 KG-OSN-2009/1 KG-OSN-2009/2 AN-DWN-2002/2 D34 17.03.04 12495.00 KG-OSN-2005/1 AN-DWN-2009/1AN-DWN-2009/3 AN-DWN-2009/5 D-7AN-DWN-2009/13AN-DWN-2009/18 30.06.10 D-11 D-19 4981.00 D-24 30.06.10 30.06.10 30.06.10 4002.00 4007.00 4040.00 KG-DWN-2005/1 AN-DWN-2003/1AN-DWN-2005/1 D39 05.12.05 9970.00 KG-DWN-2004/5 KG-DWN-2004/3 WB-ONN-2005/4 KG-OSN-2009/4 MN-OSN-2000/2 MN-DWN-2002/1MN-DWN-2002/2 D29WB-ONN-2005/3 D30 17.03.04 17.03.04 7483.00 8542.00 AN-DWN-2009/2 NEC-DWN-2002/2 D32 17.03.04 11586.00 BLOCK NAME
shore MN-DWN-98/3 65 66 67 64 81 82 83 84 85 86 63 78 79 80 62 77 Off. Andaman-Nicobar AN-DWN-200 61 60 76 73 68 59 Offshore K-G 69 Off - NEC Mahanadi 70 71 72 74 Bengal 75 No. Sl. BASIN SUPPLEMENTARY INFORMATION 102 DGH 45 44 43 42 39 38 36 35 34 32 31 30 29 28 5 4 3 2 20 46 41 40 37 33 27 24 21 19 18 17 16 15 14 13 12 11 10 7 6 1 Sl. 26 25 23 22 o OPERATOR No. 9 8 NI yrcro xlrto n rdcinAtvte 2011-12 - Hydrocarbon Exploration andProduction Activities - INDIA LIMITED INDUSTRIES (Subjudice) CANORO FOCUS HOEC ESSAR CAIRN RELIANCE COMPANY / PRE-NELP &NELP BLOCKSWITHPVT. /JVCOMPANIES eaaKna KDN20/ 1 30.320468.00 03.04.03 D16 KK-DWN-2001/1 Kerala-Konkan Cambay aata JO/ 62.89 4026.20 21.08.99 16 1424.00 AA-ON/ 22.12.08 GK-ON/4 Assam-Arakan 119.05 14 Cambay 21850.00 RJ-ON/6 11.02.03 G-K Onland 29.03.93 RJ-ONN-2005/1 19 1252.00 24 Rajasthan 02.05.08 9417.00 AAP Rajasthan 11 2961.00 24.04.07 3111.20 Assam -Arakan GN-ON-90/3 CB-ON/3 Pranhita-Godavari MB-OSN-2 30.06.10 15.05.95 5 AA-ONN-2004/3 Mumbai offshore D-1 17 Assam-Arakan PR-OSN-2004/1 Cambay MB-DWN-2009/1 Mumbai offshore Palar offshore RJ-ON-90/1 KG-ONN-2 Krishna Godavari Cambay Rajasthan 6700.00 07.06.00 D1 KG-DWN-98/1 K-G Offshore BASIN Cambay 23515.00 03.04.03 D17 AS-ONN-2 KK-DWN-2001/2 Assam-Arakan Offshore 14325.00 03.04.03 PR-D MN-D Mahanadi-NEC Offs. D20 Palar Offshore CY-DWN-2001/2 Cauvery Offshore arstaOf.G-S-001 N81.80 5890.00 16.08.01 N18 GS-OSN-2000/1 GK-OSJ/3 Saurashtra Offs. Gujarat-Kutch- avr-aa fs C Cauvery-Palar Offs. CB-OS/2 NDN20/ 1 50.711316.00 15.05.07 D19 MN-DWN-2004/3 GDN9/ 30.60 7645.00 8695.00 07.06.00 03.04.03 D3 D24 KG-DWN-2001/1 KG-DWN-98/3 JON21/ 80.2535.00 28.03.12 4232.16 28.01.06 8 N65 RJ-ONN-2010/2 RJ-ONN-2003/2 46.00 02.05.08 13 1988.00 AA-ONN-2004/5 30.06.10 S-24 KG-OSN-2009/3 11904.00 3288.00 21.05.07 05.12.05 D13 D37 KG-DWN-2004/4 KG-DWN-2003/1 NDN20/ 2 30.710454.00 8822.00 23.05.07 21.05.07 D21 11813.00 9885.00 D20 15.05.07 MN-DWN-2004/5 17050.00 15.05.07 D18 MN-DWN-2004/4 05.12.05 19174.00 D17 18.03.04 D38 MN-DWN-2004/2 D31 MN-DWN-2004/1 MN-DWN-2003/1 NEC-DWN-2002/1 NEC-OSN-97/2 11856.00 23.05.07 D16 KG-DWN-2004/7 CB-ONN-2003/1 LC AERF O EFFECTIVE REF.NO. BLOCK NAME CB-ON/7 YP-W-014D20.40 10590.00 03.04.03 D22 CY-PR-DWN-2001/4 BON20/ 80.72616.00 28.05.07 2 CB-OSN-2004/1 CB-ON/1 -RDN20/ 2 30.38600.00 03.04.03 D21 Y-PR-DWN-2001/3 O-411 81.0305.00 28.11.00 14 -ON-94/1 N20/ 2 30.36155.00 03.04.03 D23 WN-2001/1 N9/ 60.60 7195.00 07.06.00 D6 WN-98/2 32.30 319.00 27.03.01 13 7 0/ 3 5754.00 — N32 000/1 0/ 6 80.71262.00 08.02.07 N69 003/1 0/ - 21.82810.00 22.12.08 S-3 005/3 (A&B) ON MAP DATE OF PEL (Sq. Km.) (Sq. Km.) (Sq. Km.) (Sq. DATE OFPEL ON MAP 1 70.09461.00 07.06.00 N15 6 50.6635.00 05.06.06 N66 80.90 1533.00 05.09.03 18 2- 22 11.40 775.00 19.04.03 21 205.00 - 7 51.15725.00 05.10.01 2 TOTAL AREA TOTAL TOTAL AREA 7.64 258,448.00 As on01.04.2012 105170.00 50088.00 19190.00 43983.00 14325.00 11615.00 12184.36 18944.20 23586.64 2168.00 6155.00 5754.00 4227.05 319.00 AREA SUPPLEMENTARY INFORMATION 103 AREA DGH 741.00 957.00 280.00 1293.72 1077.00 1949.00 3619.00 5014.75 5896.40 13277.00 10522.80 16496.00 10008.00 14445.00 39,704.00 AREA TOTAL 16 22.12.08 1217.00 N53 21.05.04 93.40 ON MAPON OF PEL DATE (Sq. Km.) (Sq. Km.) (Part-A&B) 2 D40 05.12.05 13110.00 /1 19 06.11.07 4613.00 005/2 D-17 22.12.08 1949.00 005/2 S-2 22.12.08 1191.00 002/1 N55 22.11.04 505.00 INDIA -Activities Hydrocarbon Exploration and Production - 2011-12 -DWN-2005/1 D14 22.12.08 14675.00 G-OSN-2001/3 N38 12.03.03 530.00 NEC-DWN-2004/2 D23 09.05.07 8706.00 VN-ONN-2010/2 5 28.03.12 4909.00 CB-ONN-2010/11 19 28.03.12 131.00 CB-ONN-2010/3 11 28.03.12 534.00 MB-DWN-2005/5MB-DWN-2005/7MB-DWN-2005/9 D-9MB-OSN-2009/3 D-11MB-OSN-2009/6 22.12.08 D-13 22.12.08MB-OSN-2009/7 3169.00 22.12.08 S-5 3324.00 S-8 3138.00 30.06.10 S-9 30.06.10 1492.00 30.06.10 1876.00 1865.00 CB-ONN-2004/5 26 26.09.07 7.72 CB-ONN-2005/7MB-DWN-2005/3 23MB-DWN-2005/4 D-7 22.12.08 D-8 22.12.08 199.00 22.12.08 3097.00 3408.00 CB-ONN-2000/1CB-ONN-2002/3CB-ONN-2003/2 N29 N54KG-ONN-2004/2 17.07.01 N67 29.07.04 425.00 01.04.06 29 39.80 172.00 10.01.08 1140.00 AA-ONN-2003/1AA-ONN-2009/1AA-ONN-2009/2 N59 1 2DS-ONN-2003/1 - 30.06.10 30.06.10 2217.00 N68 1740.00 81.00 - 2365.75 RJ-ONN-2005/3 DS-ONN-2004/1 27 07.06.07 2649.00 CB-ONN-2002/2 BLOCK NAME NO. REF. EFFECTIVE offshore Kerala-Konkan off.Kerala-Konkan KK Assam-ArakanCambay Mumbai offshore AA-ONN-2004/4 MB-OSN-2 12 07.09.07 95.00 Krishna-Godavari KG-DWN-2 Satpura-RewaVindhyan SR-ONN-2005/1 VN-ONN-2010/1 11 22.12.08 4 789.00 28.03.12 3776.00 Rajasthan - NECMahanadi RJ-ONN-2003/1 NEC-DWN-2004/1South-Rewa N64Cauvery D22Cambay 04.01.06 SR-ONN-2004/1 08.05.07Cambay 1335.00 7790.00 CY-ONN-2005/1Mumbai offshore 16 MB-DWN-2005/2 CB-ONN-2005/2 12.07.07 29 13277.00 D-6 18 A&B 22.12.08 22.12.08 22.12.08 946.00 3660.00 81.00 Cambay Deccan Syneclise Deccan Andaman-Nicobar AN-DWN-2003/ OnlandCauvery Mizoram CY-ONN-2003/1 N70 MZ-ONN-2004/2 28.07.06 957.00 8 25.05.07 3619.00 Cambay GodavariKrishna CB-ON/2 K Mumbai OffshoreRajasthan MB-OSN-2004/1Mumbai Offshore 23 3 MB-OSN-2004/2Assam-Arakan RJ-ONN-2004 23.11.00 12.06.07 AA-ONN-2002/1 4 866.00 1520.00 OnlandCauvery N47 21.05.07 CY-ONN-2 07.04.04 741.00 1260.00 Cambay BASIN PRE-NELP & NELP BLOCKS WITH PVT. / JV COMPANIES / PVT. WITH BLOCKS & NELP PRE-NELP Adani Welspun BP Explo. Deep Energy GAIL IOCL BHP Billiton SANTOS PRIZE GEO-GLOBAL ENI NR(V)L NAFTOGAZ PETROGAS JOGPL GSPC RESOURCES COMPANY / COMPANY No. OPERATOR 90 86 87 79 80 81 82 83 84 85 74 76 72 69 71 67 68 65 63 56 57 47 Sl. 88 89 91 92 93 70 73 75 77 66 78 48 54 58 49 50 51 52 53 59 60 61 62 64 55 SUPPLEMENTARY INFORMATION 104 DGH Sl. o OPERATOR No. 112 111 110 109 108 107 106 105 104 103 102 101 100 99 98 96 95 94 97 Grand Total ofPELsawardedinthecountry:933507.26 Sq.km NI yrcro xlrto n rdcinAtvte 2011-12 - Hydrocarbon Exploration andProduction Activities - INDIA COMPANY / Sankalp Oil Pratibha Oil PAN India NIKO JPIL NTPC HCIL ESGPL Bengal Energy BGEPIL Quest Vasundhara Omkar Mercator Petr. Natural PRE-NELP &NELP BLOCKSWITHPVT. /JVCOMPANIES BASIN abyC-N-001 8-122.00 61.00 49.00 24.25 - - - 18 - 136.00 12 165.00 13 30.06.10 CB-ONN-2010/10 N30 71.00 30.06.10 CB-ONN-2010/4 18 CB-ONN-2010/5 15 30.06.10 CB-ONN-2000/2 Cambay 113.00 CB-ONN-2009/8 13 Cambay CB-ONN-2009/5 30.06.10 1362.00 Cambay Cambay 30.06.10 CB-ONN-2009/3 11 223.87 Cambay 133.00 S-19 Cambay 22.12.08 22.12.08 CB-ONN-2009/1 27 Cambay CY-OSN-2009/1 24 48.00 CB-ONN-2005/11 22.12.08 Cambay CB-ONN-2005/8 KG-D Cauvery 19 Krishna-Godavari Cambay Cambay CB-ONN-2005/3 Cambay Cambay LC AERF O EFFECTIVE REF.NO. BLOCK NAME BON20/ 63.61 177.00 30.06.10 144.00 68.00 16 30.06.10 30.06.10 17 CB-ONN-2009/6 12 CB-ONN-2009/7 CB-ONN-2009/2 BON20/ 52.20 170.00 22.12.08 25 CB-ONN-2005/9 BON20/ 22.20 102.00 22.12.08 22 CB-ONN-2005/6 BON20/ 12.20 83.00 22.12.08 21 CB-ONN-2005/5 N20/ -(&)3.61 1800.00 30.06.10 D-6(A&B) WN-2009/1 ON MAP DATE OF PEL (Sq. Km.) (Sq. Km.) (Sq. Km.) (Sq. DATE OFPEL ON MAP RN OA 448042.04 GRAND TOTAL TOTAL AREA TOTAL TOTAL AREA 189594.04 1800.00 1362.00 122.00 136.00 165.00 248.00 133.00 218.00 185.00 325.00 223.87 49.00 24.25 61.00 AREA SUPPLEMENTARY INFORMATION 105 DGH As on 01.04.12 24.25 0.00 61.00 0.01 49.00 0.01 218.00 0.02 223.87 0.02 325.00 0.03 133.00 0.01 165.00 0.02 741.00 0.08 319.00 0.03 185.00 0.02 280.00 0.03 136.00 0.01 122.00 0.01 957.00 0.10 248.00 0.03 PEL AREA 1077.00 0.12 1293.72 0.14 JPIL HCIL NR(V)L QUEST NTPC ESGPL PETROGAS OMKAR NATURAL OMKAR IOCL (Sq. Km.) (%) GAIL CANORO VASUNDHARA SANKALP OIL SANKALP PRATIBHA OIL NIKO PAN INDIA BENGAL ENERGY ADAANI WELSPUN ADAANI MERCATOR PETROLEUM MERCATOR BGEPIL BP EXPLORATION BP NAFTOGAZ ESSAR GGR JOGPL DEEP ENERGY GSPCL FOCUS PRIZE PETROLEUM ENI COMPANY / OPERATOR COMPANY OIL CAIRN SANTOS HOEC INDIA -Activities Hydrocarbon Exploration and Production - 2011-12 ONGC BHP BILLITON BHP PEL AREA RIL GRAND TOTAL : 933,507.26 (100%) : GRAND TOTAL 1362.00 0.15 1800.00 0.19 NIKO 5014.75 0.54 VASUNDHARA 3619.001949.00 0.39 0.21 OIL PRATIBHA INDIA PAN 5896.40 0.63 JPIL 4227.05 0.45 OIL SANKALP 10008.00 1.07 NTPC 13277.00 1.42 QUEST 39704.00 4.25 GAIL 16496.00 1.77 IOCL 10522.80 1.13 OMKAR NATURAL 23586.6418944.20 2.53 2.03 PETROGAS ESGPL 12184.36 1.31 PETROLEUM MERCATOR 14445.00 1.55 CANORO 14826.75 1.59 HCIL (Sq. Km.) (%) 470638.47 50.42 WELSPUN ADAANI 258448.00 27.69 NR(V)L PEL AREAS UNDER OPERATION BY NOC’S AND PVT/JV COMPANIES AND NOC’S BY OPERATION AREAS UNDER PEL COMPANY / OPERATOR COMPANY SANTOS ENI OIL PETROLEUM PRIZE FOCUS ONGC CAIRN GSPCL RIL ENERGY BENGAL BHP BILLITON BHP HOEC NAFTOGAZ EXPLORATION BP BGEPIL DEEP ENERGY DEEP JOGPL GGR ESSAR SUPPLEMENTARY INFORMATION 106 DGH NI yrcro xlrto n rdcinAtvte 2011-12 - Hydrocarbon Exploration andProduction Activities - INDIA GRAND TOTAL TOTAL ONLAND GUJARAT -KUTCH PALAR HIMALAYAN FORELAND KRISHNA -GODAVARI BENGAL CAMBAY SATPURA -S.REWA VINDHYAN PRANHITA -GODAVARI GANGA VALLEY ASSAM -ARAKAN RAJASTHAN ONLAND TOTAL OFFSHORE ANDAMAN -NICOBAR EASTERN WESTERN 242,452.56 OFFSHORE DECCAN SYNECLISE PURNEA MIZORAM CAUVERY OFFSHORE/BASINOFFSHORE/BASIN Eastern Offshore BASIN WISEDISTRIBUTIONOFPEL AREAS naa Nicobar Andaman - (Sq. Km.) 933,507.26 188,518.90 421,868.00 744,988.36 80,667.80 11,733.00 10,041.00 14,066.00 27,083.00 21,850.00 10,581.00 31,822.83 25,536.56 3,341.88 5,014.75 1,807.00 6,185.00 5,627.18 6,222.70 6,832.00 775.00 Rajasthan Western Offshore Assam-Arakan Ganga Valley
Pranhita-Godavari PEL E AREA PEL Vindhyan Satpura-S.Rewa
Cambay AREA Bengal Gujarat-Kutch Krishna-Godavari Palar Himalayan Foreland Cauvery Mizoram Purnea Deccan Synecline 100.00 20.19 25.97 45.19 79.81 As on01.04.12 0.08 0.36 0.54 8.64 1.26 1.08 1.51 2.90 2.34 1.13 3.41 2.74 0.19 0.66 0.60 0.67 0.73 (%) SUPPLEMENTARY INFORMATION 107 DGH (%) 4.14 8.64 4.41 2.74 1.13 3.01 0.36 1.26 0.54 0.80 1.16 0.66 79.81 25.97 45.19 20.19 100.00 As on 01.04.12 Maharashtra Himachal Pradesh Bihar Tamil Nadu West Bengal Gujarat Andhra Pradesh Andhra Uttar Pradesh Madhya Pradesh Rajasthan PEL AREA North East Western Offshore Western 3,341.88 5,014.75 7,434.18 6,185.00 38,654.83 80,667.80 41,149.00 25,536.56 10,581.00 28,072.70 11,733.00 10,816.00 744,988.36 188,518.90 933,507.26 Andaman -Andaman Nicobar (Sq. Km.) INDIA -Activities Hydrocarbon Exploration and Production - 2011-12 STATE WISE DISTRIBUTION OF PEL AREAS OF PEL WISE DISTRIBUTION STATE Eastern Offshore Eastern OFFSHORE 242,452.56 WESTERN EASTERN 421,868.00 ANDAMAN - NICOBAR TOTAL OFFSHORE STATE NORTH-EASTERN STATES OFFSHORE/STATE RAJASTHAN UTTAR PRADESH MADHYA PRADESH ANDHRA PRADESH GUJARAT TOTAL ONLAND GRAND TOTAL WEST BENGAL MAHARASTRA HIMACHAL PRADESH TAMIL NADU BIHAR SUPPLEMENTARY INFORMATION 108 DGH 15 14 13 12 11 10 9 8 18 17 16 7 6 56 36 35 34 33 32 31 30 28 27 26 25 24 23 22 21 20 19 55 54 53 52 51 50 49 48 47 46 45 44 43 41 40 39 38 37 29 3 2 OPERATOR BASIN No. COMPANY / Sl. 42 5 4 ONGC 1 NI yrcro xlrto n rdcinAtvte 2011-12 - Hydrocarbon Exploration andProduction Activities - INDIA ML AREAS UNDER OPERATION BY NOC’s ANDPVT/JVCOMPANIES ML AREASUNDEROPERATIONBYNOC’s abyLanwa Cambay Rajasthan Motera Motera Ext.-II Kalol Ext.-II Geratpur Bechraji Santhal Jotana North Sobhasan Linch Ext.-II Sobhasan Mehsana CityExt.-II Mehsana City West Sobhasan Chanasma Linch Kadi Bechraji Jotana Balol t + MM-29 West North SobhasanExt.-II East Sobhasan N. SobhasanPt.A+B South Patan Jakasna(ML) Jotana Ext.-II Dedana (ML) Nandasan - Mansa Nandasan Ext.-I Linch Ext.-I N. KadiExt.-I Kadi Ext.-II Chinnewala Tibba Kalol Ext.-I Kalol (Main) Halisa Limbodra Ext.-I Limbodra Paliyad-Kalol-Limbodra Kalol North-East Wadu Rajpur Jotana South Charada Mansa Kadi Asjol Chandrora Langhnaj ML Sanganpur ML Lanwa Ext.-I Manherra Tibba LC AERF O EFFECTIVE REF.NO. Ghotaru Ext.- Bakriwala BLOCK NAME Jot Langhnaj-Wadasma ana-W Mewad(ML) Ext.-I Ext.-I arosan Langnaj I xn- MM-39 Extn.-I x.IMM-10 Ext.-I ON MAP DATE OF ML (Sq. Km.) (Sq. Km.) (Sq. Km.) (Sq. DATE OFML ON MAP M3 1 MM-32 MM-34 MM-30 MM-20 MM-15 MM-26 MM-25 MM-24 MM-21 MM-18 MM-16 MM-40 MM-37 MM-35 MM-22 MM-14 MM-28 MM-13 MM-12 M3 17.1 MM-31 MM-27 MM-23 MM-19 MM-17 MM-38 MM-36 MM-33 MM-11 RJ AM-12 RJ J- 00.1564.60 10.01.01 RJM-3 AM-10 J- 00.11.00 10.01.01 RJM-2 AM-1 MM-9 MM-8 MM-7 MM-6 MM-5 MM-4 MM-3 MM-2 MM-1 AM-9 AM-8 AM-7 AM-6 AM-5 AM-4 AM-3 AM-2 AM-1 - 51.3114.86 15.10.03 M-4 - 10.424.00 01.05.94 M-1 50.826.02 25.03.98 1 40.713.35 18.31 35.89 7.58 24.03.07 8.85 20.08.00 9.60 20.08.93 18.07.95 08.08.96 23.04.03 20.156.85 12.03.01 60.039.50 26.07.00 90.419.46 09.06.94 40.615.69 14.08.96 50.024.00 30.00 25.05.10 09.12.02 80.222.42 9.80 28.06.02 02.06.01 2.81 26.39 28.09.96 43.73 64.49 18.07.95 16.10.93 41.01 3.06 22.06.09 08.12.95 29.03.04 50.912.05 6.99 0.87 25.01.99 2.15 16.06.97 16.06.97 61.90 16.12.96 58.72 27.04.06 34.25 26.07.95 20.42 18.03.07 03.05.93 40.538.05 24.06.05 00.812.50 1.39 20.09.08 6.97 13.84 16.02.04 05.06.02 05.02.01 40.6159.92 35.84 143.44 14.96 04.08.06 15.75 13.05.04 30.01.98 161.48 9.44 25.03.98 15.41 21.12.05 6.76 26.06.95 23.00 15.03.10 26.05.10 26.06.95 10.03.08 17.92 23.07.02 80.30.72 28.08.03 81.657.70 28.11.06 10.137.11 31.08.11 41.65.44 04.11.96 10.915.50 11.04.09 .00 13.20 1.10.00 1.01 RATOTAL AREA 23.00 As on01.04.2012 704.46 AREA SUPPLEMENTARY INFORMATION 109 DGH AREA 21.00 83.95 81.25 61.00 AREA TOTAL 1.08 16.95 07.11.07 8.58 03.09.9312.04.9118.09.0612.05.94 14.50 14.03.96 8.42 03.02.97 1.25 0.38 6.37 3.58 08.06.0914.12.0412.02.00 12.00 2.60 37.78 13.10.94 39.16 25.03.97 90.18 10.05.09 81.36 24.10.97 87.92 1 26.04.00 7.11 CM-3CM-4 CM-5 20.1 CM-6 CM-7 CM-8 CM-9 CM-2 CM-1 AM-37 26.11.99 14.66 AM-27 11.11.11 34.75 AM-49 13.11.03 5.28 AM-20 11.11.11 19.30 AM-44 03.02.06 27.00 AM-52 20.09.07 20.00 AM-22 25.03.97 81.22 AM-32 19.05.97 55.17 AM-45 21.11.03 14.53 CM-1 AM-30 28.03.07 72.23 AM-35 15.06.98 43.26 AM-13 25.03.97 23.65 AM-43 31.08.00 56.00 AM-42 28.06.02 18.29 AM-48AM-50 29.10.04 13.12.05 14.06 53.71 AM-40AM-41 08.02.02 04.04.01 56.18 116.22 AM-38AM-39 08.05.00 08.02.02 17.75 15.41 AM-36 02.02.99 16.07 AM-31AM-33 21.03.03AM-34 08.10.98 02.02.99 2.77 10.21 8.70 AM-28 26.06.95 20.92 AM-14AM-15AM-16 30.09.95 26.07.00 16.11.04AM-19 19.44 17.49 23.03.99 8.29 10.37 AM-25AM-26 22.02.01 29.07.08 17.29 5.98 AM-18 30.04.93 18.51 AM-24 05.08.09 30.16 CM-12 08.11.00 15.68 AM-51 AM-21 AM-53 AM-23 AM-29 AM-17 CM-13 10.03.04 CM-10 28.01.99 CM-14CM-15 27.07.00 15.02.02 ON MAPON ML OF DATE (Sq. Km.) (Sq. Km.) REF. NO.REF. EFFECTIVE INDIA -Activities Hydrocarbon Exploration and Production - 2011-12 III Extn.-I Ext.-II Ext.-I BLOCK NAME Kadi Extn.-IV Padra Ext.-VIII Padra Ext.-IX Padra Ext.-VII Padra Ext.-II Padra Ext.-I Padra Main Padra Ext.-III Padra Ext.-IV Padra Ext.-V Padra Ext.-VI Rupal Cambay Siswa Kathana Akholjuni Anklav Ext.-I Valod Balasar Kalol West ML Kalol West Wamaj Viraj Lohar Kalol West Kalol West Nawagam South Ext.-INawagam South Ext.-II AM-46Nawagam South Ext.-III AM-47 21.11.03 Kalol West 21.11.03 30.88 43.94 Nawagam Ext. - South Wamaj South ML Wamaj Nawagam Ext.-II Asmali ML Nandej Gamij Ahmedabad-Bakrol Nandej Ext.-I Gamij Ext. - II Wadu Ext.-I Wadu Gamij Ext.-I Sanand Ahmedabad Ext-V Gamij Ext.-III ML Nawagam Main Kadi Ext-III Sanand Ext.-III Hirapur Ahmedabad Ext.-III Nawagam Ext.-I Ahmedabad Ext.-IV Rajpur Ext.-I Nandej East Sanand Ext.-II Ahmedabad Ext.-I Ahmedabad Ext.-II Sanand Ext.-I ML AREAS UNDER OPERATION BY NOC’s BY UNDER OPERATION ML AREAS PVT/JV COMPANIES AND No. OPERATOR Sl. / COMPANY BASIN 93 94 95 96 88 89 90 91 92 97 109 110 111 108 87 101 102 103 104 105 106 107 85 86 98 99 100 112 82 83 84 81 76 77 78 79 80 73 65 66 74 75 72 59 60 61 64 67 70 71 58 62 63 68 69 57 ONGC Cambay Motera SUPPLEMENTARY INFORMATION 110 DGH 5 GandharExt.- 151 5 Kural(ML) 150 4 GandharExt.-VIII 149 4 GandharExt.-VII(G#155) 152 148 4 DabkaExt.-V(D#38) 147 4 NadaExt.-I 146 4 i(L ANM-30 GandharExt.-VI(G#388) Kim(ML) 145 144 4 la A N-82.10 2.75 24.11.02 ANM-28 DabkaExt.-IV(D#6) Olpad (A) 143 142 3 lvANM-25 ANM-26 ANM-24 Kosamba Kharach Elav Kudara 141 140 139 138 3 ownANM-22 Sanaokhurd Motwan 137 136 3 Ankleshwar(Main) 135 3 aiae ANM-19 AnkleshwarExt.-I Kasiyabet 134 133 3 ae ANM-16 ANM-17 PakhajanExt.-I Pakhajan(ML) Dahej 132 131 130 2 DahejExt.-I 129 2 GandharExt.-V 128 2 GandharExt.-III 127 2 ada N-10.10 11.78 07.01.05 ANM-11 GandharExt.-II(Denwa) Gandhar 126 125 2 GandharExt.-I 124 2 aaANM-8 GandharExt.-IV Nada 123 122 2 Malpur(ML) 121 2 UmeraExt.-I 120 1 Umera 119 1 Dabka 118 1 DabkaExt.-II 117 168 167 166 165 1 1 DabkaExt.-I Chaklasi-Rasnol PadraExt.-X Kathana 116 Cambay 115 114 ONGC 113 156 155 154 163 164 BASIN COMPANY / Sl. o OPERATOR No. 162 161 160 159 158 157 53 NI yrcro xlrto n rdcinAtvte 2011-12 - Hydrocarbon Exploration andProduction Activities - INDIA ML AREAS UNDER OPERATION BY NOC’s ANDPVT/JVCOMPANIES ML AREASUNDEROPERATIONBYNOC’s avr Greater Cauvery Onland Olpad -DandiExt.I Nannilam-I Gandhar Extn.-XI Kamalapuram-I Kamalapuram-II Mattur Pakhajan Extn.-II Gandhar Extn.-X Balol Extn.-I Matar Charada Jambusar-D South Dahej Umra Extn.-II Kosamba Extn.-I Kim Ext.-I BLOCK NAME Bhuvanagiri x.IC-61.30 16.99 15.03.04 CM-16 Ext.-I abka IX E.N.EFFECTIVE REF.NO. ON MAP DATE OF ML (Sq. Km.) (Sq. Km.) (Sq. Km.) (Sq. DATE OFML ON MAP AM3 60.238.50 16.09.02 ANM-39 ANM-37 ANM-36 ANM-35 ANM-34 ANM-33 ANM-32 ANM-31 ANM-29 ANM-27 ANM-23 ANM-21 ANM-20 ANM-18 ANM-15 ANM-14 ANM-44 ANM-13 ANM-12 ANM-10 ANM-38 ANM-49 ANM-48 ANM-47 ANM-46 ANM-45 ANM-42 ANM-41 ANM-40 N-31.10 27.00 12.11.08 ANM-43 CYM-1 ANM-9 ANM-7 ANM-6 CYM-2 ANM-5 ANM-3 ANM-2 ANM-1 CYM-5 CYM-4 CYM-3 M1 06.12.07 15.01.08 CM-18 CM-17 00.240.91 20.08.02 30.183.49 03.04.01 60.07.23 16.08.00 40.925.82 24.04.99 90.92.00 29.06.99 30.86.12 03.09.98 20.744.47 22.01.97 00.718.33 10.03.97 00.71.00 20.02.97 30.819.17 03.01.08 30.50.72 10.37 2.60 23.03.95 30.03.90 28.06.02 01.623.29 30.12.96 40.942.20 04.07.99 50.138.98 15.08.01 60.517.43 26.05.05 20.95.06 12.09.09 00.518.00 10.01.95 10.76.25 18.52 21.08.07 06.02.05 70.490.90 17.04.94 20.629.43 22.03.96 40.7235.38 24.02.07 80.654.30 08.07.06 81.632.75 08.10.06 00.436.75 30.08.94 30.71.00 03.06.07 90.99.85 19.02.09 91.49.93 19.10.94 00.78.44 10.08.87 10.321.67 01.05.93 00.90.56 30.06.09 30.812.85 23.08.08 90.97.20 19.06.09 51.714.00 15.12.07 70.923.50 3.50 4.70 3.00 27.05.99 04.05.94 26.04.93 04.05.94 10.494.40 01.01.04 90.99.00 5.83 36.00 10.60 19.06.09 48.00 26.12.08 01.10.09 34.43 06.10.09 39.00 25.03.08 56.11 13.03.03 01.03.03 04.01.02 RATOTAL AREA 42.00 10.00 4711.57 AREA SUPPLEMENTARY INFORMATION 111 DGH AREA 799.11 530.58 AREA TOTAL 1.081.08 2.00 1.09 14.10 10.00 1.02 2.00 21.02.11 6.00 07.04.11 6.50 23.01.0803.04.12 18.85 21.12.9910.09.0620.04.90 9.60 22.08.95 7.60 01.05.98 9.00 01.06.04 4.00 30.07.96 40.00 31.01.00 6.00 06.07.00 20.00 30.07.02 95.00 30.07.02 55.00 30.07.02 7.00 30.07.02 26.50 19.05.03 56.00 01.07.04 30.00 30.07.02 23.50 7.30 3.20 163.00 12.10.0705.01.09 36.00 38.00 03.04.1230.04.0323.07.1227.06.92 3.00 14.02.94 6.00 18.07.12 6.60 02.06.94 5.50 62.00 3.70 1.56 21.07.10 36.00 27.05.9915.05.0727.05.9915.07.97 17.80 27.05.99 33.61 1.00 75.00 3.70 31.12.0712.02.04 15.18 2.00 27.05.9927.05.9901.06.0112.02.04 1.00 01.06.01 3.60 91.00 26.02.04 12.00 26.02.04 19.00 01.01.0413.10.03 22.00 27.01.06 6.25 01.10.03 1.60 13.04.07 68.00 15.03.08 54.00 10.09.08 9.00 2.30 3.84 2.00 1 08.07.12 16.60 CYM-7 CYM-8 CYM-9 KGM-9 KGM-1 KGM-2 KGM-3 KGM-4 KGM-5 KGM-6 KGM-7 KGM-8 CYM-11 CYM-28 CYM-10 CYM-26 CYM-27 CYM-18 CYM-19 CYM-20 CYM-21 CYM-22 CYM-23 CYM-24 CYM-25 CYM-12 CYM-13 CYM-14 CYM-15 CYM-16CYM-17 03.1 KGM-1 KGM-10 KGM-12 KGM-13 KGM-14 KGM-15 KGM-16 KGM-17 KGM-19 KGM-20 KGM-21 KGM-22 KGM-23 KGM-25 KGM-26 KGM-27 KGM-28 KGM-29KGM-30KGM-31 28.1 KGM-32 28.1 KGM-34 12.1 KGM-18 ON MAPON OF ML DATE (Sq. Km.) (Sq. Km.) INDIA -Activities Hydrocarbon Exploration and Production - 2011-12 est Mangalam CYM-6 Kovilkalappal Elamanchali Medapadu Penumadam-1 Lingala Kaikalur-3 Vadali Mandapeta Mandapeta-19 W Mandepeta Addvipalem-Ponnamanda Nandigama Enugupalli Kesavadasupalem Suryaraopeta Lingala Ext. & Kaikalur-12Lakshmaneswaram KGM-24 Endamuru-7&9 Penumadam-2 Srikatpalli Turputallu Achanta Kavitam Bantumilli Extn. Extn. Manapalli Razole-1 & 2 Endamuru-4 Pasarlapudi-9 Pasarlapudi-8 Tatipaka-Pasarlapudi Kesanapalli-I Mori-5 Mori-1 Endamuru-I BLOCK NAME NO. REF. EFFECTIVE Greater Kali Tiruvarur-19 Kuthanallur Kali-6 Kanjirangudi Greater Narimanam PBS-1-1 Adichapuram Neyveli Karaikal Vadatheru K-G Onland ML AREAS UNDER OPERATION BY NOC’s BY UNDER OPERATION ML AREAS PVT/JV COMPANIES AND 222 223 224 191 192 190 189 201 202 203 204 205 206 207 208 209 210 211 212 213 214 215 216 217 218 219 220 221 200 193 194 195 196 197 198 199 169 ONGC Cauvery Adiyakka 170171172173174 Onland Greater Nannilam-II Perungulam-Periyapattinam Tulsapatnam Pundi 175176177178179180181 182 183 184 Kizhavalur 185 Kuthalam 186 Kuthalam-13 187 Kali 188 #13 Vijayapuram Greater Kamalapuram No. OPERATOR Sl. / COMPANY BASIN SUPPLEMENTARY INFORMATION 112 DGH l OPN BASIN COMPANY / Sl. o OPERATOR No. 276 275 274 235 234 233 232 231 230 229 228 227 226 280 279 278 273 272 271 270 269 268 267 266 265 264 263 237 236 252 251 250 249 248 247 246 245 244 243 242 241 240 239 238 261 260 259 258 257 256 255 254 253 2 2 NCAsm Sonari Assam- ONGC 225 277 6 2 NI yrcro xlrto n rdcinAtvte 2011-12 - Hydrocarbon Exploration andProduction Activities - INDIA ML AREAS UNDER OPERATION BY NOC’s ANDPVT/JVCOMPANIES ML AREASUNDEROPERATIONBYNOC’s rknBanamali Arakan ubiOf Single PML Mumbai Off. LC AERF O EFFECTIVE REF.NO. BLOCK NAME Tulamura Kasomarigaon Titabar Kunjaban Konaban Namti Changmaigaon Charali Ext.-I Charali Rudrasagar North Rudrasagar Panidihing Laipling-Gaon Lakwa C-37 (BOFFI, II & Extn. ofNW-Mumbai High Golaghat Extn.-IIA Gojalia block Tichna block Konaban Field(Rokihia) Manikyanagar-Sonamura Extn-I Konaban Extn.-III Baramura Extn.-IV Agartala DomeExtn.-II Rokhia (RO-19) Rokhia Manikya Nagar Geleki Ext.-I Geleki Badarpur Namber Extn. Namber Khoraghat Ext.-I Khoraghat East LakhibariExtn. East Lakhibari Mekrang Borholla Changpang ML Charaideo-Nahorhabi Changmaigaon East Mekeypore-Santak-Nazira SE Geleki Geleki Ext.-II Agartala Agartala Baramura(BRM-12) Baramura(BRM-1 Baramura(BRM-10) Baramura(BRM-1) Bhubandar Adamtila Banaskandi (RO-2) Dome (AD-4) Dome (AD-1) (RO-4) MH Field R-5 TM-8 (RO-15) 1) III) ON MAP DATE OF ML (Sq. Km.) (Sq. Km.) (Sq. Km.) (Sq. DATE OFML ON MAP UAM-13 UAM-12 UAM-20 UAM-18 UAM-17 UAM-16 UAM-15 A-42.10 5.01 23.11.09 UAM-14 A-10.20 10.00 07.02.04 UAM-11 NGM-1 CHM-1 DHM-7 DHM-2 DHM-8 DHM-6 DHM-5 DHM-4 DHM-3 DHM-1 H- 24.1 CHM-4 CHM-3 CHM-2 UAM-1 UAM-3 UAM-9 UAM-8 UAM-7 UAM-6 UAM-5 UAM-4 UAM-2 TM-21 TM-20 TM-19 TM-18 TM-22 TM-17 TM-16 TM-14 TM-15 TM-13 TM-12 TM-10 TM-11 BM-1 M312. BM-3 M217.1 BM-2 TM-7 TM-9 TM-6 TM-5 TM-4 TM-3 TM-2 TM-1 91.920.00 10.00 288.00 09.12.09 24.12.08 14.07.08 01.01.98 10.930.00 01.08.09 00.845.00 51.64 70.50 20.05.98 149.00 34.00 20.03.99 26.00 30.05.09 30.01.06 172.49 50.00 19.05.04 13.10.03 29.09.08 17.12.02 91.924.00 09.12.09 271.17 195.41 0.81 07.02.06 138.55 16.89 07.02.06 01.08.04 150.25 01.02.06 0.58 01.02.06 01.02.06 26.02.92 41.01953.83 24.10.10 160.86 01.02.06 10.80.80 01.01.98 60.027.94 16.08.10 50.926.00 05.09.99 70.620.00 83.00 3.00 27.01.06 49.00 8.50 17.07.00 27.07.09 32.12 27.01.06 23.07.03 14.00 15.00 17.06.98 77.00 20.50 30.01.06 2.65 30.01.06 30.01.06 30.01.06 14.12.01 90.716.00 19.09.97 40.712.00 14.03.07 10.915.75 2.41 1.41 2.22 01.05.09 4.71 01.10.93 6.00 27.07.91 15.03.07 15.00 18.07.04 2.30 22.12.02 21.07.97 01.08.09 10.832.58 01.01.98 01.945.00 20.11.09 41.85.04 14.11.08 91.735.55 09.11.07 90 292.00 09.07 .8531.00 1.08 .94.00 1.09 RATOTAL AREA 11.11 2510.75 AREA SUPPLEMENTARY INFORMATION 113 11.00 46.00 AREA DGH 797.50 460.00 4456.01 14429.68 AREA TOTAL 3620.00 1567.67 1064.71 1447.31 OIL TOTALOIL 4916.01 ONGC TOTAL ONGC 24540.65 1.09 213.00 1.06 429.42 1.02.01 67.93 26.11.0926.11.09 85.47 10.36 26.11.09 311.96 27.11.03 540.67 19.11.09 94.00 01.04.11 46.00 20.11.04 448.05 26.11.09 98.42 19.05.03 195.00 14.05.03 75.00 17.05.03 185.00 12.06.02 189.00 04.06.03 75.00 02.08.01 131.00 07.08.01 87.00 06.08.01 186.00 14.10.01 49.33 02.08.01 250.00 24.01.08 111.50 10.01.01 725.20 22.10.09 32.00 30.10.09 35.00 20.09.08 221.00 10.01.91 165.76 24.12.07 105.00 01.01.86 250.00 05.09.03 105.00 15.02.0810.04.09 119.00 11.00 30.05.03 210.00 04.02.04 1.42 01.10.0715.05.9701.06.98 743.00 113.40 51.95 30.06.99 135.85 04.09.98 80.00 10.01.91 560.00 KM-2 BM-5 BM-6 BM-8 14.1 BM-7 BM-9 BM-11 15.06.05 22.55 BM-10 31.07.05 25.60 BM-19 01.04.06 835.00 BM-13 09.01.06 68.14 BM-20 10.04.06 103.69 BM-14 01.04.06 BM-12 01.01.05 194.00 BM-16 01.04.06 BM-15 14.09.09 384.00 BM-17 01.04.06 BM-21 01.04.06 BM-18 09.01.06 331.00 BM-23 1 BM-22 04.12.07 82.00 OAM-8 OAM-6 OAM-5 OAM-4 OAM-1OAM-2 01.1 OAM-9 OAM-7 OAM-3 CYM-29 OAM-11 OAM-19 OAM-18 OAM-17 OAM-16 OAM-15 OAM-14 OAM-13 OAM-12 KGM-35 OAM-21 KGM-33 KGM-40 ORJM-2 KGM-32 OAM-20 OAM-10 KGM-37 KGM-36 KGM-38 KGM-39 ON MAPON OF ML DATE (Sq. Km.) (Sq. Km.) SWBH) BM-24 05.09.06 134.00 Field INDIA -Activities Hydrocarbon Exploration and Production - 2011-12 Extn. & 23 Mechaki Baghjan Tinsukia Extension Tinsukia Chabua Ningru Extension Dholiya Borhapjan Dum-Duma BK-C Dum-Duma BK-D Ningru Dibrugarh Dum-Duma BK-B Digboi Tinsukia Yanam Godavari GS-49 GS-29 Hugrijan Dandewala (Jaisalmer) ORJM-1 Vainateyam Nahorkatiya Extn. BLOCK NAME NO. REF. EFFECTIVE North Tapti North Tapti C-Series Fields B-119 / B-121 B-119 B-173A Neelam (SB-II) Bassein Field Extn. D-18 Sapkaint South Bassein Heera D-1 Field B-55 BM-4 G-1 Field Vasistha Baghewala D-33 (BOFF I, III, Dum-Duma BK-A Nahorkatiya Mumbai High NW Around D-1 Field Moran Extn. Mumbai High-SW Vasai East Vasai S&E of Bassein Bassein of West Mumbai High-South Ratna (R-12) field North Heera Rajasthan Cauvery Off.Gujarat-Kutch PBS-1-1 KD Field K-G Off. GS-15 Assam-Arakan Moran ML AREAS UNDER OPERATION BY NOC’s BY UNDER OPERATION ML AREAS PVT/JV COMPANIES AND 333 332 331 330 313 311 329 309 310 301 328 327 322 323 324 326 320 321 325 307 308 306 305 319 304 318 290 291 283 284 285 288 289 312 OIL 334 282 286 287 281 ONGC Mumbai Off. 302 303 314 316 317 293 292 315 294 297 298 296 295 300 299 No. OPERATOR Sl. / COMPANY BASIN SUPPLEMENTARY INFORMATION 114 362 361 7 SC abyUnawa Cambay GSPCL 372 HYDROCARBON- 368 Lohar Hazira Cambay Cambay SELAN 360 359 NIKO 357 356 350 Mid& MumbaiOff. BG-RIL-ONGC 344 343 7 AD avr f.CY CauveryOff. Rajasthan RIL 377 376 HARDY 375 FOCUS 374 373 371 Kanawara Cambay 367 366 Heramec 365 364 363 358 Asjol JTI 355 Cambay 354 INTERLINK 353 Cambay 352 351 HOEC 349 348 CANORO 347 GEOENPRO 346 345 Ravva 342 341 340 K-GOff. 339 337 CAIRN 336 335 6 IE Cambay OILEX 370 369 338 DGH l OPN BASIN OPERATOR No. COMPANY / Sl. Grand Total ofMLsawarded inthecountry:37292.06Sq.km NI yrcro xlrto n rdcinAtvte 2011-12 - Hydrocarbon Exploration andProduction Activities - INDIA RES. DEV.-PPC ML AREAS UNDER OPERATION BY NOC’s ANDPVT/JVCOMPANIES ML AREASUNDEROPERATIONBYNOC’s ufo abyLak Gulf ofCambay GOf GDN9/(-&)—0.30 339.40 02.03.05 — KG-DWN-98/3(D-1&3) KG Off. abyW Cambay abySanganpur Cambay sa-rknAgr 11.352.75 10.00 01.11.03 21.10.97 — — PY Cauvery Off. Amguri Assam-Arakan Kharsang Assam-Arakan Rajasthan BLOCK NAME Karjisan Bakrol Bhagyam-Shakti Indrora Modhera Panna Bhandut Allora Dholasan Ognaj Bheema Gauri Sabarmati Dholka Ambe CBX NS-A Promoda &Palej KG-DWN-98/3 (D-26) Ingoli Field N. Kathana N. Balol Mukta Kaameshwari West RJ-ON/6 (SGL) Baola — Mangala (RJ-ON-90/1) Cambay avel -1 -OS-90/1 (PY-3) shmi South Tapti C-N-011 — (CB-ONN-2001/1) E.N.EFFECTIVE REF.NO. ON MAP DATE OF ML (Sq. Km.) (Sq. Km.) (Sq. Km.) (Sq. DATE OFML ON MAP 31.55.00 23.11.05 — 21.4430.00 22.12.94 — 00.548.00 20.02.95 — 70.38.80 27.02.03 — 21.64.00 12.12.96 — 30.46.00 23.09.94 — 4.03 29.09.04 — 121.06 07.07.98 — 30.536.00 13.03.95 — 30.5130.00 13.03.95 — — 70.24.40 27.02.02 — 30.45.80 23.09.94 — 60.36.85 16.05.03 — — 30.55.00 13.03.95 50.00 — 23.09.94 — 1471.00 22.12.94 — 10.57.64 21.09.05 — 50.813.65 05.08.08 — 00.881.00 20.07.98 — 6.30 04.02.03 — 15.00 09.04.96 — 70.849.72 17.04.08 — 75.00 06.10.95 — — 51.6430.17 15.11.06 — — 30.4161.00 23.09.94 — 90.712.70 19.05.07 — 10.420.22 01.05.04 — 90.35.65 19.05.03 — 777.00 22.12.94 — 10.227.30 21.03.02 — 10.312.20 11.06.03 — 81.4331.26 28.10.94 — — - 71.9822.00 27.10.09 10.51859.00 21.06.05 00.59.00 20.02.95 — 107.47 — — — 7.0176.00 176.00 — RN OA 37292.06 GRAND TOTAL Pvt./JV TOTA RATOTAL AREA 33.30 14.03 50.70 7835.40 L 3754.96 2678.00 172.80 189.65 389.12 124.94 AREA 57.00 34.15 19.68 74.25 81.00 16.70 52.75 10.00 4.40 SUPPLEMENTARY INFORMATION 115 DGH As on 01.04.12 (%) 0.51 0.01 0.15 0.46 7.18 0.47 0.34 0.20 0.09 0.05 1.04 0.22 0.14 0.03 0.04 JTI 13.18 65.81 10.07 CANORO HERAMEC LTD. GSPCL HYDRO.RES.DEV. - PPCL GEOENPRO INTERLINK NIKO HARDY HOEC OILEX 4.40 57.00 74.25 19.68 34.15 10.00 52.75 81.00 16.70 189.65 172.80 124.94 389.12 176.00 ML AREA ML 4,916.01 2,678.00 3,754.96 24,540.65 FOCUS (Sq. Km.) (Sq. SELAN RIL INDIA -Activities Hydrocarbon Exploration and Production - 2011-12 ONGC CAIRN BG-RIL-ONGC OIL COMPANY / OPERATOR ML AREAS UNDER OPERATION BY NOC’S AND PVT/JV COMPANIES AND NOC’S BY OPERATION AREAS UNDER ML ONGC OIL CAIRN SELAN FOCUS JTI NIKO BG-RIL-ONGC RIL OILEX CANORO HOEC HARDY HERAMEC LTD. GSPCL INTERLINK GEOENPRO - PPCL HYDRO.RES.DEV. SUPPLEMENTARY INFORMATION 116 DGH TOTAL ONLAND TAMIL NADU ANDHRA PRADESH GRAND TOTAL RAJASTHAN GUJARAT STATES -NORTH EASTERN ONLAND TOTAL OFFSHORE EASTERN 17,466.21 WESTERN OFFSHORE GRAND TOTAL TOTAL ONLAND ASSAM - ARAKAN ONLAND TOTAL OFFSHORE EASTERN 17,466.21 WESTERN OFFSHORE CAMBAY KRISHNA-GODAVARI RAJASTHAN CAUVERY NI yrcro xlrto n rdcinAtvte 2011-12 - Hydrocarbon Exploration andProduction Activities - INDIA OFFSHORE/BASIN OFFSHORE/BASIN BASIN /STATE WISEDISTRIBUTIONOFML AREAS STATE WISE DISTRIBUTION OF ML AREAS OFML STATE WISEDISTRIBUTION ANDHRA PRADESH KRISHNA-GODAVARI GUJARAT CAMBAY ASSAM-ARAKAN OT EAST NORTH - RAJASTHAN RAJASTHAN (Sq.km) (Sq.km) 18,140.97 18,140.97 37,292.06 19,151.09 37,292.06 19,151.09 7,029.51 7,029.51 4,451.63 1,684.88 1,684.88 4,451.63 5,330.14 5,330.14 799.11 799.11 530.58 530.58 ML AREA ML AREA TAMIL NADU TAMIL CAUVERY OFFSHORE OFFSHORE WESTERN WESTERN EASTERN OFFSHORE EASTERN OFFSHORE (%) (%) 100.00 100.00 18.85 18.85 11.94 46.84 11.94 14.29 46.84 48.65 14.29 48.65 51.35 51.35 2.14 4.52 2.14 4.52 1.42 1.42 a MSM Oil (MMT) Gas (MMSCM) a MSM Oil (MMT) Gas (MMSCM) PRODUCTION (2011-12) PRODUCTION (2011-12) 38,474.84 38,474.84 16423.04 22051.80 16423.04 22051.80 47474.77 47474.77 3588.00 3588.00 1364.00 1364.00 999 18.0266 8999.93 1285.00 2172.91 2172.91 8999.93 1285.00 590.03 590.03 As on01.04.12 17.946 18.027 20.060 17.946 5.145 5.145 6.553 20.06 0.305 0.305 0.246 38.09 5.778 2.114 38.09 2.114 6.553 0.246 5.778 SUPPLEMENTARY INFORMATION 117 DGH 12 - 35 258.71 11 2011 - 33 229.26 10 2010 - 28 550.18 09 2009 - 39 337.62 06 . 08 2008 - 67 363363 06 07 2007 - 25 392.25 06 2006 - 26 222.79 05 2005 - 15 INDIA -Activities Hydrocarbon Exploration and Production - 2011-12 337.15 04 2004 - 348.32 03 2003 - 14 14 OIL & & OIL GAS DISCOVERYTREND 329.61 02 2002 - INPLACE RESERVEINPLACE TREND ACCRETION 10 226.6 01 2001 - 9 166.11 2000 2000-01 2001-02 2002-03 2003-04 2004-05 2005-06 2006-07 2007-08 2008-09 2009-10 2010-11 2011-12
0.00
0.00 30.00 20.00 10.00 60.00 50.00 40.00 70.00
NO. NO. 300.00 200.00 DISCOVERIES OF 400.00 400.00 600.00 500.00 100.00
ACE RESERVE ACCRETION IN IN ACCRETION RESERVE ACE L L IN-P MT (O+OEG) MT M M Note : Trends include Nomination and PSC regime Trends Note : SUPPLEMENTARY INFORMATION 118 Note: Trends includeNominationand PSCregime DGH NI yrcro xlrto n rdcinAtvte 2011-12 - Hydrocarbon Exploration andProduction Activities - INDIA 29000 30000 31000 32000 33000 34000 35000 36000 37000 38000 39000 10000 20000 30000 40000 50000 60000 0 2003 2003 OIL &GASPRODUCTIONTREND 2004 2004 Gas Production YearwiseMCM in Oil ProductionYearwise in '000 Tonnes 2005 2005 Calendar Year 2006 2006 aedrYear Calendar 2007
Year 2007
2008 2008 Source : http://petroleum.nic.in/psbody.htm Source:http://petroleum.nic.in/psbody.htm 2009 2009 2010 2010 2011 2011 SUPPLEMENTARY INFORMATION 119 DGH - 1 - 2 - 1 - 1 - 1 - 1 - 3 - 1 - 2 - 1 - 2 - 1 - 7 - 1 - 2 - 8 - 1 - 5 1 1 1 1 1 1 2 2 1 1 1 1 1 1 1 1 1 1 22 2 2 11 1 3 1 3 8 8 3 3 3 3 31 15 2 2 3 8 9 3 3 12 1 2 7 7 1 1 1 1 2 5 1 1 2 2 72 110 13 39 18 19 ------1 2 1 2 2 1 1 1 1 1 1 3 1 2 1 2 1 1 7 3 1 2 8 1 5 - as on 31.03.2012 26 12 38 OIL GAS TOTAL / Pre-NELP NELP I NELP I NELP I NELP I NELP I NELP I Round NELP II NELP II NELP II NELP V NELP V NELP V NELP V NELPVI NELP-V NELP III NELP III NELP III NELP III NELP III NELP III NELP III NELP-III NELP IV NELP VI NELP VI NELP IV NELP VI NELP VI NELP IV NELP IV NELP IV NELP-III NELP IV NELP IV NELP VI Pre-NELP Pre-NELP Pre-NELP Pre-NELP Pre-NELP Pre-NELP Pre-NELP Pre-NELP Pre-NELP Pre-NELP Pre-NELP Pre-NELP Pre-NELP INDIA -Activities Hydrocarbon Exploration and Production - 2011-12 CB-ONN-2004/3 CY-OS/2 NEC-DWN-2002/1 AA-ONN-2001/2 KG-OSN-2004/1 AN-DWN-2002/1 Baola CB-OS/1 CB-ONN-2001/1 CB-ONN-2004/1 CB-ONN-2004/2 AA-ONN-2001/1 CB-ONN-2002/1 NEC-OSN-97/2 CB-ON/7 RJ-ON-90/1 MN-OSN-2000/2 CB-OSN-2003/1 CY-ONN-2002/1 GS-OSN-2000/1 KG-OSN-2001/1 AAP-ON-94/1 RJ-ON/6 CB-ONN-2002/3 KG-OSN-2001/3 KG-DWN-98/2 CB-ONN-2002/2 AA-ONN-2002/1 MN-DWN-98/3 GS-OSN-2004/1 KG-ONN-2003/1 CB-ONN-2003/2 KG-DWN-2001/1 KG-DWN-98/1 CY-DWN-2001/2 KG-OSN-2001/2 CB-OS/2 Ravva CB-ONN-2000/2CB-ONN-2000/1 NELP II - 2 2 KG-DWN-98/2 KG-DWN-2003/1 CY-PR-DWN-2001/3 CB-ONN-2003/1 KG-DWN-98/3 Panna-Mukta SR-OS-94/1 CB-ON/3 CB-ON/2 CB-ONN-2004/5 Block Name / FieldBlock Name ails of oil & gas discoveries under NELP under & gas discoveries ails of oil CEIL (5) JUBILANT (5) Pre-NELP/Field Total Pre-NELP/Field GSPC (22) NELP Total NIKO (2) NIKO ONGC (27) RIL(48) Det The above status is indicative only and may not be a comprehensive list of all discoveries, as notified by the operators. is indicative only and may The above status 25 23 24 22 21 18 19 20 17 16 5 4 14 15 27 34 35 6 3 32 31 30 36 33 28 29 13 26 11 12 7 8 9 2 1 10 13 (1) Interlink 10 ONGC (1) 9 78 (1) HARDY (2) HOEC 1 CAIRN (22) 37 (1) NAFTOGAZ Sl. No.Sl. Name Company 1112 RIL (1) BGEPIL (1) 2 3 456 OIL (5) ESSAR (2) FOCUS GSPC (3) Note: SUPPLEMENTARY INFORMATION 120 DGH For the12 environment friendlymanner. Hydrate andUndergroundCoalGasification(UCG), and(iv)tocarryoutE&Poperationinsafe Bed Methane(CBM)andShaleGas,(iii)Research &DevelopmentfornewsourcessuchasGas ration LicensingPolicy(NELP),(ii)development ofalternatesourceshydrocarbonsuchasCoal supply ofgasare:(i)offering ofexplorationblocksinIndian sedimentary basinsthroughNewExplo- The majorsteps taken tobridgethegrowinggapindemandandsupply oilandtheshortfall in Exploration &Production is givenin Table 1. has increasedby10.5%from1847milliontonnesason1.4.2007. The reservepositionason1.4.2011 on 1.4.2011, thebalancerecoverablereservepositionofO+OEG isabout2041milliontonnes,which The total prognosticatedresourcesofthecountryhavebeenestimatedatabout28billiontonnes. As Hydrocarbon ReservePosition would helptobridgetheshortfall inavailabilityofoilandgasthecountry. sition &processingtechniques arelikelytobeadoptedduring12 areas ofIndiansedimentary basinsincludingfrontier areas. The newgenerationrigsandbetteracqui- In viewoftheabove,anumberprogrammesareproposedtobetaken upduringthe12 tion ofpetroleumproducts inthefastdevelopingeconomylikeIndia. ments. The growthindomesticoil&gasproductionisnotcommensuratewiththegrowingconsump- needs. The countrydependsonimports tomeetmorethan75%ofits hydrocarbonenergyrequire- Energy securityremainsaconcernforIndiaasthecountryfaceschallengesinmeetingits energy Energy IssuesinIndia&Way Ahead disruptions thatcanbereasonablyexpected”. at competitiveprices,alltimesandwithaprescribedconfidencelevelconsideringshocks it aswellmeettheireffective demandforsafeandconvenientenergytosatisfytheirvariousneeds ergy securewhenwecansupplylifelineenergytoallourcitizensirrespectiveoftheirabilitypay for The IntegratedEnergyPolicyofthePlanningCommissiondefinesSecurityas,“We areen- Energy Security Year Plan(2012-17) Extracts from“ReportofWorking Group on Petroleum&NaturalGasSectorforthe12 onland andoffshore areas, thefollowingexplorationstrategieshavebeen identified: EXTRACTS FROMXII NI yrcro xlrto n rdcinAtvte 2011-12 - Hydrocarbon Exploration andProduction Activities - INDIA I 7.9370 031 3.6108 0.98.9108 182.6 647.215 100.81 524.22 81.79 122.995 2041.805 1211.99 400.89 1284.41 835.56 757.395 659.38 170.83 3831.37 640.67 2003.17 552.61 230.06 1828.20 194.89 2594.92 10499.31 hydrocarbons of reserves 1093.15 3941.89 recoverable 1191.67 balance 2029.37 denote 6557.42 Reserves *Note: 1403.25 317.06 1208.70 Total 776.09 820.67 7376.79 Pvt./JV 2416.13 OIL 4960.66 ONGC th PlanPeriod,itisproposed toacceleratetheexplorationactivitiesinnew non-producing i a +E i a +E i a O+OEG Gas Oil O+OEG Gas Oil O+OEG Gas Oil Initial
In
Place Table
1 TH
Position FIVE YEAR PLAN(2012-2017) Ultimate
of
Hydrocarbon
Reserves
Reserves th Planperiodinthecountry. Inthe Reserves* (Figs.
in
MMT) th Planthat th Five SUPPLEMENTARY INFORMATION 121 DGH BCM) (P)
MMT) in
12 ‐ in
194 (Fig. figs ( 12 XI Plan ‐ Source: GAIL Plan th 11
11 2011 ‐ 11 2011 the
‐ 179.0 during
Plan th 10 2010 ‐ Gas
11
10 2010 in ‐
147.7 Natural
09 2009 ‐ of
production
plan period will be as under: oil
th 09 2009 ‐ 08 2008 INDIA -Activities Hydrocarbon Exploration and Production - 2011-12 ‐ 117.7 Crude ‐ sales/consumption Table
08 2008 ‐ wise ‐ 94.0 2007 Year ‐ Actual129.0 Proj.15.49 140.0622.08 Actual 18.99 25.94 Actual 47.71 3.10 Actual 25.37 5.09 Actual 3.47 24.67 Proj. 4.67 24.42 3.57 Likely 5.26 23.74 3.59 9.68 124.14 3.76 10.69 17.49 35.40 X Plan XI Plan 2007 Table R&D efforts and feasibility to understand the potential of Oil Shale and feasibility to understand R&D efforts Intensifying exploration in non producing basins Intensifying exploration in non producing companies Level playing field to E&P Faster development of hydrocarbon discoveries Optimize recovery from ageing oil & gas fields Reserve characterization studies for better understanding of lithology and fluid distribution. of lithology for better understanding Reserve characterization studies Shale gas exploration of OALP NDR & Implementation Development of tight sands is being evaluated as part of the step out region of Hazira block. of the step evaluated as part Development of tight sands is being 3D Seismic to preserve amplitudes. Better processing techniques in techniques to increase reserves locked in these stratigraphic Enhanced thick bed evaluation domains. New generation rigs deployed for better drilling efficiencies in deepwater, which is crucial for in deepwater, better drilling efficiencies New generation rigs deployed for success. increasing commercial chance of methods. various artificial lifting Enhancement of oil production through like, gas injection and water injection to restore or maintain Pressure maintenance schemes the reservoir pressure. Acquiring deep imaging seismic data for enhanced understanding of crustal architecture of of crustal understanding for enhanced imaging seismic data Acquiring deep east coast basins. before firming up drilling locations. area with 3D seismic Covering the prospective play of KG & Cauvery basins. Exploring for Liquids in deeper Mesozoic Substantial exploration activity is being carried out in frontier basins such as Vindhyan, Ganga as Vindhyan, basins such out in frontier is being carried exploration activity Substantial in case of success. value to the nation add significant etc., which will Pennar, Palar, and Valley deep targets in deep-waters. Exploration in east coast India and more so Major focus is on deepwater frontiers. for better geo- from DGH and multi-client data data both vintage datasets Acquiring regional of portfolio. logical understanding Intensive exploration in proven hydrocarbon basins. proven hydrocarbon exploration in Intensive new plays. to establish producing basins new areas within exploration to Extending ONGC OIL Pvt./JV Total 166.57 206.76 34.13 33.51 33.51 37.69 38.19 177.02 Product Natural Gas Note: Figs. For 2011‐12 are provisional • • • • • • • • • • • • • • • • • • • • • • In addition, the major thrust areas during 12 In addition, the major thrust areas SUPPLEMENTARY INFORMATION 122 DGH tion, about5000sq.kmareaislikelytobeoffered during12 given byotherMinistries/Departments suchasDefence,Home,Environment &Forests etc.Inaddi- E& Pprogramin12 70.5% area,outof26000sq.km.areaavailableforthesaidpurposeincountry. of CoalforexplorationandproductionCBMgas.GovernmentIndiahasalreadyawardedabout Table below. The offering ofplannedexplorationareaunderthe12 route. The annualbreak-upofexplorationarealikelytobeoffered during12 ough competitivebiddingprocesseitherthroughNELP orOpen Acreages LicensingPolicy(OALP) tary basins)isplannedtobebroughtunderexploration. The offering ofexplorationareawillbethor- During 12 The round–wisebreak-upinvariousroundsofawardedareaunderNELP isgivenin Table above. Crude OilandGasProduction: NI yrcro xlrto n rdcinAtvte 2011-12 - Hydrocarbon Exploration andProduction Activities - INDIA oa 5.5252 24 28 75 22 16 216.65 51.67 52.22 47.51 32.85 32.40 MD) 255.27 (MMSC 159.05 Total Total Pvt./Jv OIL ONGC v.J 33 33 27 21 15 62.94 11.50 133.059 12.10 25.456 12.70 26.286 Total 13.30 28.002 2016-17 13.34 2015-16 28.27 Total 2014-15 25.045 Pvt./JV 2013-14 OIL 2012-13 ONGC Company aaee NELP ‐ Parameter Area Awarded ot/erApril Month/Year (Sq. km) ra .%84 .%61 .%98 .%1.7% 3.6% 9.8% 3.6% 6.1% 6.5% 8.4% 7.3% % area* th Pretg raaaddi ahrudwrttotal sedimentary a *Percentage area awarded in each round w.r.t Five Year Planperiod,about4lakhssq.km.explorationarea(12.6%ofIndiansedimen- 0007,0 0008,0 8003,96,000 88,000 88,000 Total 2016-17 80,000 2015-16 70,000 2014-15 70,000 2013-14 2012-13 lnX ln2007‐ Plan XI Plan X culPo.Ata culAta culPo.Likely Proj. Actual Actual Actual Actual Proj. Actual 711998. 00102131116118.7 12.01 90.16 141.6 2.63 25.58 143.1 114.48 26.77 2.35 130.2 23.46 21.99 90.0 2.42 23.10 8.09 88.8 2.27 23.11 139.9 7.73 22.49 2.34 87.1 126.45 22.33 16.43 33.07 112.39 10.17 115.81 Table -Explorationareastobeofferedin12 242235 058121 167363 19852603 112988 306331 113687 192810 204588 263050 228472 2000 Table A- Projectionof Crudeoilproductionin12 th 2354.74.6 2564.5 216.339 41.156 42.546 44.762 45.57 42.305 Plan INELP .240 .641 .020.34 4.20 4.16 4.06 4.00 3.92 Table Table 2011 July ‐ ‐ INELP II Exploration ‐ Natural 2003 Feb 82008 08 ‐ I NELP III
gas
areas
production 2004 Feb ‐ 92009 09
‐ awarded VNELP IV th Planwoulddependontimelyclearancestobe
th in 2005 Planperiodinconsultation withMinistry Dec
‐ 11 ‐ under 02010 10 VNELP th th Plan Plan rea (3.14 million sq. km.)
NELP 2007 Mar ‐ INELP VI ‐ th 12011 11 Plan th Planperiodisgivenin 2008 Dec ‐ I NELP VII ‐ (Fig. 2X Plan XI 12 (Figs. inMMT)
in 2010 June
BCM) ‐ VIII SUPPLEMENTARY INFORMATION 123 Plan” DGH th 727 1310 82488 138974 1886.14 (Figs. in BCM) (Figs. in 341 Plan th plan are as revised vide MoPNG OM no Q-26012/ vide revised as are plan th 4.0 4.1 4.2 19.2 Nos. 611 174 525 UNIT ONGC OIL Private/JV Total Sq. Km 24163 8364 49961 MMTOE 1080 78.14 728 Kilometer 28170 6850 103954 INDIA -Activities Hydrocarbon Exploration and Production - 2011-12 TABLE - SUMMARYOF 12TH FIVE YEAR PLAN 3.1 3.8 15.0 14.5 16.5 18.5 21.0 85.5 43.0 43.8 47.2 50.8 63.9 248.6 24.9 25.5 26.7 28.2 38.7 143.9 Table B- Projection of Natural Gas production in 12 production of Natural Gas B- Projection Table 3/2010-ED (Vol II) dated 4 May, 2012- “Revised Estimates of Domestic Natural Gas Production- 12 Production- Gas Estimates of Domestic Natural 2012- “Revised 4 May, II) dated 3/2010-ED (Vol The above projections of natural gas production in 12 production gas projections of natural The above Pvt./JV Total Total MMSCMDTotal 118 120 129 139 175 — CompanyONGC 2012-13OIL 2013-14 2014-15 2015-16 2016-17 Total liaeyrcro eevsAccretion Reserves UltimateHydrocarbon MMTOE 360 26 Reserves Accretion IIH Seismic Surveys 2D ACTIVITY Seismic Surveys 3D Exploration Wells SUPPLEMENTARY INFORMATION 124 DGH BP STATISTICAL REVIEW2012 Other Africa Tunisia Vietnam Sudan Nigeria Other Europe&Eurasia Other Asia Thailand Malaysia Indonesia India China Libya Gabon Equatorial Guinea Egypt Uzbekistan United Kingdom Turkmenistan Canada Brunei Note : Total World TotalPacific Asia Australia Total Africa Rep. ofCongo(Brazzaville) Chad Angola Algeria Total MiddleEast Iraq Iran Total Europe&Eurasia Russian Federation Romania Norway Kazakhstan Italy Denmark Azerbaijan Total S.&Cent. Brazil Argentina Total North America 1981to1991 US barrels million Thousand Mexico Ecuador Colombia Oman Kuwait Trinidad & Tobago Peru Qatar Syria Saudi Arabia Other S.&Cent. America Venezuela Other MiddleEast Yemen Emirates United Arab NI yrcro xlrto n rdcinAtvte 2011-12 - Hydrocarbon Exploration andProduction Activities - INDIA Pacific indicate Lessthan 0.05% mrc 609.6 America 9697.3 7186774.0 5751.8 1546.4 1432.6 2221.0 641.2 410.3 851.8 693.8 385.4 184.2 858.0 843.4 174.3 961.3 246.1 750.1 599.3 507.0 447.9 OIL PROVEDRESERVES 47.7 43.1 20.3 14.6 10.9 10.1 70.7 31.5 98.8 15.6 43.2 19.0 93.9 13.7 60.7 43.8 29.0 35.0 15.1 23.3 20.1 0.6 5.1 7.0 8.1 6.4 NA 9.4 3.3 0.3 8.0 0.8 8.0 NA NA NA 6.5 1.6 NA NA 1991 to2001 11254.5 1077.0 2618.2 761.6 898.9 396.7 877.0 109.1 237.5 272.7 379.0 160.8 287.9 105.6 300.2 965.0 979.2 388.9 944.3 714.1 867.2 55.4 12.3 53.6 10.9 12.0 47.5 21.6 14.0 20.3 41.4 10.6 49.1 38.5 89.9 26.4 67.8 50.8 38.6 37.0 19.7 25.8 25.2 11.6 2.2 9.2 6.7 3.8 5.6 7.8 2.4 3.3 3.6 1.8 8.5 4.7 1.3 7.1 01t 012011 shareofTotal 2001 to2011 40. 100.0% 14402.5 1214.7 1728.3 7570.5 2216.2 1262.4 1007.5 1387.8 1782.5 2641.1 1477.5 1178.1 410.3 364.9 425.7 152.4 191.4 133.6 266.3 821.4 123.2 120.5 300.2 978.0 112.3 57.1 36.7 10.9 13.0 53.7 70.0 13.2 55.6 16.2 84.9 35.1 18.6 27.8 59.9 38.9 13.2 15.7 42.6 39.6 29.1 53.7 22.1 25.4 26.3 11.0 11.0 5.8 5.4 5.2 9.3 5.9 4.9 9.7 2.1 8.6 19.7% 48.1% 13.2% 10.6% 16.1% 17.9% 8.5% 8.0% 2.5% 0.1% 0.4% 0.7% 0.3% 0.1% 0.4% 0.1% 0.2% 0.4% 0.1% 0.1% 0.3% 0.3% 0.4% 0.1% 2.3% 2.9% 1.8% 0.9% 0.2% 0.8% 0.2% 0.1% 0.2% 0.1% 0.1% 0.2% 0.1% 0.3% 0.1% 6.1% 0.4% 5.3% 0.2% 1.9% 1.5% 0.9% 0.7% 9.1% 8.7% 0.2% 5.9% 0.1% SUPPLEMENTARY INFORMATION 125 1.1% 0.1% 2.1% 2.9% 0.1% 5.1% 1.8% 0.1% 0.3% 1.1% 0.7% 0.8% 2.9% 1.2% 0.7% 0.2% 5.2% 3.4% 3.5% 1.1% 0.1% 0.1% 0.4% 3.8% 0.3% 0.1% 1.9% 0.3% 8.8% 2.1% 2.3% 0.4% 3.5% 0.2% 0.3% 0.4% 4.3% 3.6% 0.3% 1.3% 0.9% 0.3% 0.3% 0.6% 0.6% 0.1% 0.3% 0.5% 0.2% 0.5% 1.0% 9.7% 9.5% DGH 12.8% 13.2% 10.4% 21.0% 32.6% 16.8% 12403 50.571 336.0741 54.53191 1132.87337 69.9919217 130.321601 116.6630156 186.4967611 155.2976372 60.01438849 1340.653652 99.19440001 810.3502031 94.44718604 215.1975006 0 16 2034.18059 66.74 50.023 56.178 41.605 37.04959196 66.871 53.169308 12.6469 328.524 722.8591191 604.189 805.8513556 269.969 672.564186 105.474 172.2385038 435.937 350.852209 165.935 121.3596785 1547.67 1849.5284 1 3272.783 4700.873757 1221.477 260.0007 153.31024 1531.023893 1186.981311 86.11913787 741.5492921323.1965503 516.0304282 316.8275474 384.0967931324.4071226 356.6205491 204.457275960.04612473 333.9909234 265.1945236 56.57295214 670.1963914 1061.349739 288.6104655 529.31 166.3178388 170.3891672 27.10515604 152.5070967 683.0812841 725.0707167 80.01433669 79.16440405 0 0 0 23.9634278 9.12 42.38 1.307 18.25 65.231 111.4661623 96.361 33.595 172.77 51.482 91.3637 161.014 1266.52 423.703 519.999 102.801 111 2161.232 40.076502 116.175968 268.857076 296.4748694 256.6309833 24.28295749 23.33822429 18.41302848 55.30421873 104.4445673 122.8779893 INDIA -Activities Hydrocarbon Exploration and Production - 2011-12 OIL PRODUCTION 0 3771.809 0 0 0 0 0 0 0 0 0 36.52228047 50.24 204.11 22.871 878.77 80.166 14.946 355.136 100.748 549.717 154.066 104.857 299.025 334.032 364.3867 5862.452 38.826622 40.18301239 52.48236617 71.33640365 909.128358 872.3437442 1 874.75438733.6521241 794.9988907 4552.24388 2763.85294 4419.403175 4910.481519 86.7815445 237.0489092 5370.67792 4635.762845 3765.733742 3273.474886 103.141267 278.011802 479.6875714 951.3052394 2.97423231 261.1177265 176.0948986 1173.557178 838.5918192 112.1856431 79.02227193 629.3101268 1455.961851 1629.890357 1698.396835 3100.079382 2715.067056 3535.417019 4504.420292 1024.495803 543.5809615 32.41662407 16.74921429 100.339189 85.06562074 127.2211078 282.8333492 218.1602207 1314.466941 512.8674199 998.5028442 1251.975368 105.3175034 79.08700753 65.78319609 169.9750168 270.9912165 430.5791016 386.4707642 1554.479054 1048.147964 1576.420412 1469.238624 128.2688973 532.8180011 1420.389398 1260.699284 1050.830364 753.3569051 1033.596652 0.066961494 17.60246124 48.46597349 2498.656846 1273.603214 1853.3091 65.58654656 83.66203333 247.7628621 245.2485172 98.48967631 142.1823712 784.3597123 713.0530824 93.01694979 158.1129701 228.8729072 6517.84313 8078.402203 6913.253966 8408.523286 1971 to 1981 1991 1981 to 1991 to 2001 2001 to 2011 share of Total 2011 6909.116405 6964.06844 6548.934338 6502.895615 2228.310393 2945.55302 3587.426391 3809.630754 10963.48972 6819.026745 10320.07182 11921.38529 2306.620482 2074.635678 3147.380862 3574.251137 32025.45951 29596.75314 34052.48439 38721.10637 100.0% Denmark Italy Total Asia Asia Pacific Total World Total Indonesia India Malaysia Thailand Algeria Total Middle East Total Total Europe & Eurasia Europe & Total Iran Total S. & Cent. America S. & Cent. Total Azerbaijan Chad US Total North America North Total Argentina Million tonnes Brazil Colombia Ecuador Peru Tobago & Trinidad Kazakhstan Iraq Kuwait Oman Qatar Rep. of Congo (Brazzaville) Saudi Arabia Venezuela Syria United Arab Emirates Yemen Other Middle East Angola Vietnam Canada Norway Romania Egypt Russian Federation Turkmenistan Other S. & Cent. America Other S. & Cent. Gabon Other Asia Pacific Mexico United Kingdom Uzbekistan Equatorial Guinea Libya Nigeria Sudan Tunisia Other Europe & Eurasia Other Africa Africa Total Australia Brunei China SUPPLEMENTARY INFORMATION 126 DGH Note : Total World Total Asia Malaysia Indonesia India Brunei Bangladesh Australia Total Africa Algeria Total MiddleEast Bahrain Total Europe& Eurasia Azerbaijan Total S.&Cent. Brazil Bolivia Argentina Total North America Canada US Metres TrillionCubic Netherlands Kazakhstan Italy Germany Iran Mexico Myanmar China Libya Egypt Denmark Other S.&Cent. America Venezuela Trinidad & Tobago Peru Colombia Poland Norway Syria Kuwait Iraq Other Asia Pacific Other Asia Vietnam Thailand Papua NewGuinea Pakistan Other Africa Nigeria Russian Federation Romania United Arab Emirates United Arab Saudi Arabia Qatar Oman Turkmenistan Yemen Ukraine Other MiddleEast United Kingdom Uzbekistan Other Europe&Eurasia NI yrcro xlrto n rdcinAtvte 2011-12 - Hydrocarbon Exploration andProduction Activities - INDIA indicate Lessthan 0.05% Pacific mrc 44.242041 America 12955 43704 81675100.0% 1811.67735 1443.760044 1142.975558 NATURAL GAS:PROVEDRESERVES 86.41209008 143.3230344 107.5632004 79.88199012 474.8606363 6.060000002 346.8173002 1.650 17715 86.79660487 81.72751451 110.7615006 1981 to1991 8.960899949 0.984000012 2.562000014 21.14309031 2.767799988 4.901000023 7.479000032 37.44499969 1.125000004 1.893999996 18.75173342 2.212999985 166.0809994 17.88237017 2.676999986 1.458999984 3.164000005 1.040159997 57.89850044 1.453000009 2.629999995 3.028000005 16.44199991 3.300999999 22.95199037 10.16489998 46.50943017 2.801999997 0.029999999 6.558999985 13.37530005 2.764666662 1.444000013 48.63420057 29.63800001 9.898099899 428.5175362 6.895000041 9.229000032 47.25899982 0.092000001 1.145000016 7.228000026 23.22500014 1.732631067 26.11925006 2.19500003 1.217 36.471772.10902018 61.64573197 13 0 0 0 0 0 109.9542602 7.010160029 516.1482452 1991 to2001 566.721092 1.880999967 1.978199989 21.69799984 3.871000022 3.036000013 6.496000051 1.390000001 3.869000047 1.826032415 2.817000009 2.585999981 22.32600009 2.666999981 1.446000017 31.91399956 9.315999985 4.986425459 8.099547625 16.25600016 4.369000018 37.04420018 8.945086122 13.95359993 1.254999995 40.22035003 3.692000005 1.537000015 6.396000087 2.378749996 228.7140026 15.03728318 19.32600009 14.20809996 57.84795952 4.407999992 5.318959355 5.421000019 12.88745713 0.155000004 4.585999995 8.686000051 8.442000031 262.6064178 108.6360002 1.450349502 214.3891373 2.851000011 16.16351 60.11600018 14.76000011 39.4230001 47.6415143 13.0940001 2.331 128 147.3040273 615.1718125 10.35345984 746.972851 01t 012011 shareofTotal 2001 to2011 1.228331998 12.30608881 0.996259458 28.72540665 18.58023524 22.30999994 3.773999989 73.01071882 6.509000003 4.621417552 65.92915106 28.14959359 0.925000001 47.59497023 3.974298284 1.445280328 17.02317214 3.271237522 20.00380003 45.14140081 24.43903899 12.50539637 4.769766748 3.204772025 20.63562715 32.13923264 4.025633186 4.060758308 3.398568749 8.146727026 14.84000003 51.73599958 4.722092032 1.134999983 3.844281673 2.818999976 16.97300029 0.745780359 0.894902857 4.836478442 9.791067481 4.916999996 4.047468294 289.7200012 69.35033369 435.7456894 11.60183396 16.61184978 253.9114838 4.34967801 3.39726083 1.26605244 9.68599999 61.5367527 38.4% 37.8% 15.9% 12.0% 21.4% 11.7% 0.6% 3.6% 7.0% 8.0% 5.2% 1.8% 0.2% 0.1% 0.2% 4.1% 1.4% 0.9% 0.2% 0.2% 1.0% 0.1% 0.2% 1.1% 2.2% 2.7% 1.2% 0.6% 0.2% 0.2% 0.1% 1.5% 0.5% 1.0% 1.7% 3.9% 0.1% 0.6% 0.2% 0.2% 0.3% 0.1% 0.4% 0.7% 2.5% 0.1% 0.1% 0.1% 0.9% 0.5% 2.9% 0.1% 0.2% 0.4% 0.1% 0.8% 0.1% SUPPLEMENTARY INFORMATION 127 0.4% 1.1% 1.8% 0.3% 0.4% 1.4% 2.3% 0.5% 2.4% 4.9% 1.6% 1.2% 0.5% 4.6% 0.5% 0.3% 0.3% 1.2% 1.9% 0.6% 1.9% 0.2% 0.4% 0.1% 0.9% 0.1% 0.1% 0.3% 3.1% 1.2% 0.4% 0.8% 1.2% 0.2% 4.5% 3.0% 0.3% 0.6% 0.3% 0.6% 0.6% 2.0% 3.1% 0.1% 1.6% 0.1% 0.3% 0.6% 1.4% 1.7% 0.3% 6.2% 5.1% 1.4% DGH 20.0% 18.5% 31.6% 14.6% 16.0% 26.5% 1 26.241 52.388915 34.0982734 1.39092824 1.55038295 11.11766058 11.03859068 11.19939299 11.64025372 11.75163157 0 3.174247468 0 2.292935592 0 1.592110875 17 7.894466308 13 61.4506097 12 17.7444224 14.15 65.851045 79.92103818 16.11350646 1 59.75006588 69.76723034 5.494019442 9.126465565 27.44615439 40.89428306 157.3573618 171.6808729 42.32249891 107.420457 7.521618649 15.12870043 33.49861305 57.64948301 6.275207461 8.669487521 6.021672045 10.82414099 15.88988218 13.78936143 20.96738758 62.77914855 16.32329423 9.587215695 0.612127866 6.082663076 43.52876202 72.27236477 5.988281605 14.65519967 3.492816355 6.018126333 4.381845502 12.12182276 79.36853274 74.91228735 44.44421933 54.58940052 880.0174027 986.3691506 0 0 0 15.08222938 28.06025727 37.53365274 8.612260091 8.050549622 14.32460536 15.07234764 32.12881677 46.77415148 53.06491504 33.26454931 159.0898656 13.32945324 10.19367198 INDIA -Activities Hydrocarbon Exploration and Production - 2011-12 0 350.9627793 522.6477093 557.5826059 0 7.148082271 0 0.533850863 0 11.55204024 0 0 4.246335354 0 0.798731539 2.129905832 0 0 0 20.47050657 16.266831 0 0 24.21552076 0 1.740609179 0 4.05752852 NATURAL GAS PRODUCTION GAS NATURAL 10.7588965 13.27193483 1.30928896 2.43555914 2.850941942 1.495901504 6.32933677 3.787308172 3.395279026 4.048351898 84.31129862 87.2442087 18.62029708 26.48162329 32.33597671 47.84594625 4.572057594 4.906797746 0.288336107 1.043889028 8.392872239 4.192648276 4.446360119 7.743325798 1 2.358105593 4.422492446 9.205209957 32.98757451 4.154666899 12.77484145 18.00990481 26.58092885 28.09570509 5.637659493 9.828800967 16.9026168 661.3558947 466.6869998 514.0070724 540.9550046 0.996927009 1.287374489 2.627747348 3.250739828 0.626379914 5.659064294 14.46347834 47.14543391 0.1965488562.469869562 1.878279133 5.713128499 5.337602498 17.06843102 21.27207495 66.6882731 0.779319064 3.181451595 6.530182506 26.9127777 0.394190551 2.563016319 5.608232184 5.030606874 23.24109953 35.15584856 39.80839959 5.918865905 8.448466183 10.65831649 2.207797175 4.603356176 7.54371605 1.795412408 2.618664274 3.002466162 18.27773946 16.30361572 8.465554425 25.28997382 36.92614614 86.08077302 0.441062749 0.41538104 9.959275268 37.6010104 8.456180535 15.05411799 0.856969554 3.44204949 7.727373091 33.31969063 20.55905943 16.49000733 14.93861545 13.61358977 75.98565084 60.93197227 64.290491 7.730700684 2.409772572 3.87997821 4.9250171 35.49221858 31.77618534 1.39684316 6.920583557 20.35721993 33.08479901 546.3034118 812.4696503 48.82503287 115.6306027 222.7690605 379.5588481 16.76143218 52.39221306 97.2482234 176.9252135 37.96708913 74.50584954 162.2572197 348.3065878 30.03522429 48.37950289 79.76042952 139.1794491 764.2874904 580.4128318 703.7004109 760.4818237 1444.179681 1683.79065 2145.752747 2790.821073 100.0% Total Asia Asia Pacific Total World Total India Indonesia Australia Total Africa Total Algeria Total Middle East Middle Total Total Europe & Eurasia Total Bahrain Total S. & Cent. America S. & Cent. Total Azerbaijan Total North America North Total Argentina Billion Cubic Feet Per DayUS 1971 to 1981 1991 1981 to 1991 to 2001 2001 to 2011 share of Total 2011 Canada Iran Bangladesh Malaysia Denmark Egypt Mexico Bolivia Brazil Iraq Colombia Peru Tobago & Trinidad Venezuela Libya Brunei Myanmar Pakistan Germany China Kuwait Other S. & Cent. America Other S. & Cent. Nigeria Italy Thailand Vietnam Oman Qatar Saudi Arabia Other Africa Kazakhstan Syria Other Asia Pacific Netherlands United Arab Emirates Norway Poland Romania Yemen Other Middle East Russian Federation Turkmenistan Ukraine United Kingdom Uzbekistan Other Europe & Eurasia 349.3771278 SUPPLEMENTARY INFORMATION 128 DGH where SGis thespecificgravityof fluid. gravity. The arbitrary formulausedtoobtain thiseffect is: API gravity=(141.5/SGat60°F)-131.5, hydrometer instrumentand wasdesignedsothatmostvalueswouldfall between10°and70° API density ofvariouspetroleum liquids,expressedindegrees. API gravityisgradatedindegreeson a A specificgravityscaledeveloped bythe American PetroleumInstitute(API)formeasuring therelative API gravity soap, whichisoneofthesurfactants. chemicals suchassodiumcarbonatereactwith acidicoilcomponents insitutocreatepetroleum A chemicalenhancedoilrecovery flood thatusestwosourcesofsurfactant andapolymer. Alkaline Alkaline-Surfactant-Polymer flooding represent changesinrocktypeorthicknessof rockunits. actual measurements andtheoreticalvaluesindicate anomaliesinthemagneticfield,whichturn airplane orhelicoptercanmeasuretheintensityof theEarth’s magneticfield. The differences between Measurements oftheEarth’s magneticfieldgathered fromaircraft. Magnetometerstowedbyan Aeromagnetic survey coefficient. symbolized byZ. The difference inacousticimpedancebetweenrocklayersaffects thereflection The productofdensityandseismicvelocity, whichvariesamongdifferent rocklayers,commonly Acoustic impedance is k,whichmeasuredinunits ofdarciesormillidarcies. when asinglefluid,orphase,ispresentintherock. The symbolmostcommonlyusedforpermeability The measurementofthepermeability, orabilitytoflowtransmit fluidsthrougharock,conducted Absolute permeability the well. to aspecifieddepth,casingpointorgeologicalobjective,andtheneithercompletingabandoning A budgetary document,usuallyprepared bytheoperator, tolistestimatedexpensesofdrillingawell Approval ForExpenditure(AFE) data. Suchdata canbeacquiredonthesurfaceorinaborehole saturation, pressureandtemperature.4Dseismicdata isoneofseveralformstime-lapse seismic in aproducinghydrocarbonreservoirwithtime.Changesmaybeobservedfluidlocationand Three-dimensional (3D)seismicdata acquiredatdifferent timesoverthesameareatoassesschanges 4D seismicdata in-lines arecalledcrosslines. subsurface reflectivity. The originalseismiclinesarecalledin-lines.Linesdisplayedperpendicularto A setofnumerousclosely-spaced seismiclinesthatprovideahighspatially sampledmeasureof 3D seismicdata A verticalsectionofseismicdata consistingofnumerousadjacenttracesacquiredsequentially. 2D seismicdata GLOSSARY OFCOMMONOILFIELDTERMS NI yrcro xlrto n rdcinAtvte 2011-12 - Hydrocarbon Exploration andProduction Activities - INDIA source: http://www .glossary .oilfield.slb.com/Search.cfm SUPPLEMENTARY INFORMATION 129 DGH ]. 3 INDIA -Activities Hydrocarbon Exploration and Production - 2011-12 An abbreviation for oilfield barrel, a volume of 42 US gallons [0.16 m An abbreviation for oilfield barrel, a volume of 42 US gallons [0.16 BBL or bbl A measure of heat energy required to raise the temperature of one pound of water by one degree A measure of heat energy required to raise the temperature of Fahrenheit. British thermal unit is abbreviated as BTU. British thermal unit A seismic amplitude anomaly or high amplitude that can indicate the presence of hydrocarbons. Bright A seismic amplitude anomaly or such as when a gas sand tuning effect, result from large changes in acoustic impedance and spots caused by phenomena other than the presence of hydrocarbons, underlies a shale, but can also be such as a change in lithology. Bright spot The lower portion of the drill string, consisting of (from the bottom up in a vertical well) the bit, bit sub, consisting of (from the bottom up in a vertical well) the bit, bit The lower portion of the drill string, pipe, jarring devices (“jars”) heavy-weight drill drill collar, cases), stabilizers, a mud motor (in certain must provide force for the bit to The bottom hole assembly forms. and crossovers for various thread with a hostile mechanical environment and provide the driller break the rock (weight on bit), survive directional control of the well. Bottom Hole Assembly (BHA) Assembly Bottom Hole A measurable property of seismic data, such as amplitude, dip, frequency, phase and polarity. Attributes phase and polarity. as amplitude, dip, frequency, such measurable property of seismic data, A and may be measured on a single in time or over a time window, can be measured at one instant Attribute analysis includes a surface interpreted from seismic data. trace, on a set of traces or on by techniques such indicator, including a hydrocarbon parameters, assessment of various reservoir analysis. (AVO) as amplitude variation with offset Attribute The relatively plastic layer of the upper mantle of the Earth on which the tectonic plates of the lithosphere Earth on which the tectonic plates layer of the upper mantle of the The relatively plastic km thick warm but not molten. is approximately 200 The asthenosphere move. Asthenosphere The phase of petroleum operations that immediately follows successful exploratory drilling. During follows successful exploratory operations that immediately The phase of petroleum gas field and how to the size of the oil or wells might be drilled to determine appraisal, delineation efficiently. develop it most Appraisal A drilling technique whereby gases (typically compressed air or nitrogen) are used to cool the drill bit are used to cool air or nitrogen) compressed gases (typically technique whereby A drilling use of liquids. more conventional instead of the of the wellbore, cuttings out and lift Air drilling A low-density, high-API gravity liquid hydrocarbon phase that generally occurs in association with low-density, A and pressure conditions in the presence as a liquid phase depends on temperature natural gas. Its reservoir allowing condensation of liquid from vapour. Condensate The set of valves, spools and fittings connected to the top of a well to direct and control the flow of The set of valves, spools and fittings connected to the top of a formation fluids from the well. Christmas tree The pressure and temperature conditions at which the first bubble of gas comes out of solution in oil. The pressure and temperature conditions at which the first bubble some natural gas in solution. all petroleum reservoir oils contain At discovery, Bubble point SUPPLEMENTARY INFORMATION 130 DGH of its producinglife.Estimatedultimate recoverycanbereferencedtoawell,field, orabasin. The amountofoilandgas expectedtobeeconomicallyrecoveredfrom a reservoirorfieldbytheend Estimated ultimaterecovery saturations, porosityandfluidpropertiessuchas oil API gravityandviscosity. type dependsonreservoirtemperature,pressure, depth,netpay, permeability, residualoilandwater injection), andthermalrecovery(steam-floodor in-situcombustion). The optimalapplicationofeach micellar-polymer flooding),miscibledisplacement (carbondioxide[CO The threemajortypesofenhancedoilrecovery operations arechemicalflooding(alkalineor improve oildisplacementorfluidflowinthereservoir. productive lifeofanoilreservoir. Its purposeisnotonlytorestoreformation pressure,butalsoto techniques employedduringenhancedoilrecoverycanactuallybeinitiatedatanytime the of oil.Oncerankedasathirdstage ofoilrecoverythatwascarriedoutafter secondaryrecovery, the An oilrecoveryenhancementmethodusingsophisticatedtechniquesthataltertheoriginalproperties Enhanced OilRecovery the casing,therebyforcinganyproducedfluidstoenteronlydrillstring. a surface-actuatedpacker thatcanisolatetheformationfromannulusbetweendrillstringand mounted intotheDST tool andarereadinterpretedafter thetestiscompleted. The toolincludes bottom oftheholewithasurface-actuatedvalve.Oneormorepressuregaugesarecustomarily usually conductedwithadownholeshut-intoolthatallowsthewelltobeopenedandclosedat the Well tests conductedwiththedrillstringstillinhole.Often referredtoasDST, thesetests are Drill Stem Test The difference betweentheaveragereservoirpressureandflowingbottomhole Draw Down temperatures andpressuresthatcanresultinchangestotherock’s originalmineralogyandtexture. The physical,chemicalorbiologicalalterationofsediments intosedimentary rockatrelativelylow Diagenesis deltaic, marine,lacustrineandeoliansystems. environments inwhichtheyaredeposited. The dominantdepositionalsystemsarealluvial,fluvial, according tothetypesofsediments availablefordepositionaswellthedepositional processesand The three-dimensionalarrayofsediments orlithofaciesthatfillsabasin.Depositional systemsvary Depositional System sample andextracts theoil. This givesthevolumeofwaterinsample. The solventisalsocondensed,thenflowsbackoverthe water inthesampleisvaporizedbyboilingsolvent,thencondensedandcollectedacalibratedtrap. A methodforthemeasurementoffluidsaturationsinacoresamplebydistillationextraction. The Dean-Stark Extraction after aholehasbeendrilled. the timeofdrillingzone,orsidewallcores(generallylessthan1in.[2.5cm]indiameter)taken Cores canbefull-diametercores(thatis,theyarenearlyaslargeindiameterthedrillbit)taken at A cylindricalsampleofgeologicformation,usuallyreservoirrock,taken duringorafter drillingawell. Core NI yrcro xlrto n rdcinAtvte 2011-12 - Hydrocarbon Exploration andProduction Activities - INDIA 2 ] injectionorhydrocarbon SUPPLEMENTARY INFORMATION 131 DGH INDIA -Activities Hydrocarbon Exploration and Production - 2011-12 A sand-control method used to prevent production of formation sand. In gravel pack operations, a sand-control method used to prevent production of formation sand. In gravel pack A gravel of a with prepared packed steel screen is placed in the wellbore and the surrounding annulus The primary objective is to stabilize of formation sand. specific size designed to prevent the passage to well productivity. the formation while causing minimal impairment Gravel pack A step in seismic processing in which reflections in seismic data are moved to their correct locations step in seismic processing in which reflections in seismic data A including two-way traveltime and position relative to shotpoints. data, of seismic in the x-y-time space Geophysical migration The study of the chemistry of the Earth and within solid bodies of the solar system, including the The study of the chemistry of the Earth and within solid bodies (and their ions and isotopes), molecules, minerals, distribution, circulation and abundance of elements rocks and fluids. Geochemistry The flowline network and process facilities that transport and control the flow of oil or gas from the facilities that transport and control the flow of oil or gas from The flowline network and process pumps, gathering system includes A processing plant or shipping point. wells to a main storage facility, regulators, compressors, dehydrators, valves and emulsion treaters, tanks, headers, separators, associated equipment. Gathering system An artificial-lift method in which gas is injected into the production tubing to reduce the hydrostatic method in which gas is injected into the production An artificial-lift the reservoir The resulting reduction in bottomhole pressure allows pressure of the fluid column. higher flow rate. liquids to enter the wellbore at a Gas lift A common and inexpensive measurement of the natural emission of gamma rays by a formation. A common and inexpensive measurement gamma different because shales and sandstones typically have helpful Gamma ray logs are particularly readily between wells. ray signatures that can be correlated Gamma ray log The application of tools, equipment and techniques for the removal of junk, debris or fish from a and techniques for the removal of junk, debris or fish from The application of tools, equipment wellbore. Fishing F has been related to porosity (phi) by several formulae (Archie, Humble and others) that have the formulae (Archie, Humble and to porosity (phi) by several F has been related and m the porosity F = a / phim, where a is a constant general expression The ratio of the resistivity of a rock filled with water (Ro) to the resistivity of that water (Rw). G.E. Archie (Rw). G.E. (Ro) to the resistivity of that water of a rock filled with water The ratio of the resistivity solely a function of independent of Rw and the formation factor (F) was a constant postulated that of Rw only for a been shown that F is independent Archie equation I). It has since pore geometry (the rocks). simple rocks (Archie class of petrophysically certain Formation factor The act of modelling a reservoir using knowledge of the facies that make up the reservoir and the up the reservoir facies that make knowledge of the reservoir using of modelling a The act rules will suggest characteristics The depositional facies represent. that the environments depositional especially between facies, relationships and the possible of the facies the geometries concerning or a cyclothem. within a stratigraphic sequence have been related to each other where the facies Facies modelling SUPPLEMENTARY INFORMATION 132 DGH is attached tothebargeanddrillingpackage. Inthismanner, theentirebargeanddrilling structureare the seafloorfurther, thisjackingdown ofthelegshaseffect ofraising thejackingmechanism,which then allthreelegsarejacked furtherdown.Sincethelegshavebeenpreloaded andwillnotpenetrate the legsarejackeddown ontotheseafloor, preloadedtosecurelydrivetheminto the seabottom,and location withits legsupandthebargesectionfloatingon water. Uponarrivalatthedrilling location, raised orloweredindependentlyofeachother. The jackup,asitisknowninformally, istowedonto A self-contained combinationdrillingrigandfloatingbarge,fittedwithlongsupportlegsthatcanbe Jackup rig layers andtheirthickness,densityP-S-wave velocities. profiles andwelllogdata canbeusedtoperform inversion,theresultofwhichisamodelEarth the processofsolvinginverseproblem.In seismology, surfaceseismicdata, verticalseismic A mathematicalprocessbywhich data areusedtogenerateamodelthatisconsistentwiththedata, Inversion are obtained bymeasuringtheproductionratesundervariousdrawdownpressures. production rateagainsttheflowingbottomholepressure(BHP). The data requiredtocreatetheIPR A mathematicaltoolusedinproductionengineeringtoassesswellperformancebyplottingthe well Inflow PerformanceRelationship drainage, pressuredeclineandnaturalwater-driveorgas-drive. A methodforrecoveringadditionaloilbeyondfluidexpansion,rockcompressibility, gravitational Improved OilRecovery causing averticalfracturetoopen. engineered fluidsarepumpedathighpressureandrateintothereservoirintervaltobetreated, A stimulationtreatmentroutinelyperformedonoilandgaswellsinlow-permeabilityreservoirs.Specially Hydraulic fracturing seismic data bycreatingareflectionormultiple. contain quantitiesofhydrocarbonsthatcouldbegreateconomicsignificance.Hydratescanaffect To date,economicliberationofhydrocarbongasesfromhydrateshasnotoccurred,but hydrates within acrystal structure.Hydratesformincoldclimates,suchaspermafrostzonesanddeepwater. trapped inicemolecules.Moregenerally, hydratesarecompoundsinwhichgas moleculesaretrapped An unusualoccurrenceofhydrocarboninwhichmoleculesnaturalgas,typicallymethane,are Hydrate world fordecades. relatively recently, wellsmeetingthedefinitionhavebeensafelydrilledandcompletedaround or requiringaBOP witharatinginexcessof10,000psi [68.95MPa]. Although thetermwascoined temperature ofgreaterthan300oF[149oC]andaporepressureatleast0.8psi/ft (~15.3lbm/gal) jurisdictional waters.IntheUK,HPHTisformallydefinedasawellhavinganundisturbedbottomhole along withthecontemporaneouslossofOceanOdysseysemisubmersibledrillingvesselinScottish release oftheCullenreportonPiper Alpha platform disasterintheUKsectorofNorthSea, Pertaining towellsthatarehotterorhigherpressurethanmost. The termcameintouseuponthe High PressureTemperature (HPHT) the reservoir, itcanoffer significantproductionimprovementoveraverticalwell. vertical exceedsabout80degrees.Becauseahorizontal welltypicallypenetrates agreaterlengthof A subsetofthemoregeneralterm“directionaldrilling,”usedwheredeparture of the wellborefrom Horizontal drilling NI yrcro xlrto n rdcinAtvte 2011-12 - Hydrocarbon Exploration andProduction Activities - INDIA SUPPLEMENTARY INFORMATION 133 DGH . o INDIA -Activities Hydrocarbon Exploration and Production - 2011-12 Crude oil that has a high API gravity, usually more than 40 API gravity, Crude oil that has a high Light crude oil A test to determine the strength or fracture pressure of the open formation, usually conducted usually of the open formation, pressure strength or fracture determine the A test to shut in and fluid is During the test, the well is drilling below a new casing shoe. immediately after At some pressure that the formation experiences. wellbore to gradually increase the pumped into the in the rock moving through permeable paths either enter the formation, or leak off, pressure, fluid will maximum the test dictate of the leak-off The results by fracturing the rock. space or by creating a a small maintain To well during drilling operations. weight that may be applied to the pressure or mud is usually slightly the maximum operating pressure safe well control operations, safety factor to permit result. test below the leak-off Leak-off test Leak-off slowly raised above the water to a predetermined height above the water, so that wave, tidal and current wave, tidal and so that the water, height above to a predetermined above the water slowly raised and drilling package. the bulky barge legs and not the relatively small only on loading acts A fluid that has a constant viscosity at all shear rates at a constant temperature and pressure, and viscosity at all shear rates at a constant fluid that has a constant A rheological model. can be described by a one-parameter Newtonian fluid The evaluation of physical properties, usually including pressure, temperature and wellbore trajectory The evaluation of physical properties, usually including pressure, practice in offshore while extending a wellbore. MWD is now standard in three-dimensional space, considerations if other by rig time and wellbore stability directional wells, where the tool cost is offset tools are used. Measurements-while-drilling A treatment designed to treat the near-wellbore reservoir formation rather than other areas of the A treatment designed to treat the near-wellbore reservoir formation interval, production tubulars or the production conduit, such as the casing across the production to improve include acid, solvent and chemical treatments perforations. Matrix stimulation treatments of a well. the permeability of the near-wellbore formation, enhancing the productivity Matrix stimulation A specific document that shows important physical and chemical characteristics of a chemical or specific document that shows important A to potential safety hazards that may be transporter or other interested party product to alert a user, associated with the material. Material Safety Data Sheet Material Safety Data Timely LWD data can also be used to guide well placement so that the wellbore remains within the can also be used to guide well placement data LWD Timely as in highly variable shale such productive portion of a reservoir, zone of interest or in the most reservoirs. The measurement of formation properties during the excavation of the hole, or shortly thereafter, The measurement of formation into the bottom hole assembly. through the use of tools integrated Logging while drilling The brittle outer layer of the Earth that includes the crust and uppermost mantle. It is made up of six that includes the crust and uppermost mantle. It is made up of The brittle outer layer of the Earth asthenosphere. plates that move around on the softer major and several minor tectonic Lithosphere A carbonate sedimentary rock predominantly composed of calcite of organic, chemical or detrital rock predominantly composed of carbonate sedimentary A in limestones. Chalk is a form of fine- of dolomite, chert and clay are common origin. Minor amounts grained limestone. Limestone SUPPLEMENTARY INFORMATION 134 DGH given trend. A play (oragroupofinterrelatedplays)generallyoccurs inasinglepetroleumsystem. prospects inabasin,region ortrendandusedbydevelopmentpersonnel tocontinueexploitinga A conceptualmodel forastyleofhydrocarbonaccumulationused byexplorationists todevelop Play characteristics, groundelevation,densityanddelivery pressure. volume passing throughapipelineinspecifictimeperiod willdependoninitialpressure,flow pipeline isusuallyexpressedasavolumeperunit length(forexample,bbl/ft). Nevertheless,thefluid The quantity(volume)ofoilandgasrequired to maintain afullpipeline. The static capacity ofa Pipeline capacity a seal,andtheappropriaterelativetimingofformation ofthese. components necessarytoformpetroleum:apetroleum sourcerock,areservoir, atrapping mechanism, A technique used torepresentthehistoryofasedimentarybasin,includingprocessesand Petroleum systemsmodelling of eachother, sincethe presence ofmorethanonefluidgenerallyinhibits flow. of relativepermeabilityallowsforcomparison ofthedifferent abilitiesoffluidstoflowinthepresence fluid attotal saturation.Ifasinglefluidispresentinrock,its relativepermeabilityis1.0.Calculation of effective permeabilityofaparticular fluidataparticular saturationtoabsolutepermeabilityofthat as wellthenatureofreservoiraffect theeffective permeability. Relativepermeabilityistheratio example, effective permeabilityofgasinagas-waterreservoir). The relativesaturationsofthefluids transmit aparticular fluidthrougharockwhenotherimmisciblefluidsarepresentinthereservoir(for fluid, orphase,ispresentintherock.Effective permeabilityistheabilitytopreferentiallyflowor millidarcies. Absolute permeability isthemeasurementofpermeabilityconductedwhenasingle The ability, ormeasurementofarock’s ability, totransmitfluids, typicallymeasuredindarciesor Permeability which oilorgasisproduced. The communicationtunnelcreatedfromthecasingorlinerintoreservoirformation,through Perforation fluids toflowdirectlyintothewellbore. A wellcompletionthathasnocasingorlinersetacrossthereservoirformation,allowingproduced Open-hole completion the productioncapability ofthewell. may bequalifiedasrelatingtoaspecificzone,suchperforatedintervalorusedinreferring The calculatedmaximumflowratethatasystemmayprovideintheabsenceofrestrictions. The term Open-flow potential analyze andpredictfluidbehaviourinthereservoirovertime. petro-physicalcharacteristicsto The mathematicalsimulationofanumericalmodelreservoir’s Numerical reservoirsimulation Schlumberger. any meansofimprovingproductionefficiency.NODAL (productionsystemanalysis)isamarkof the reservoirdeliverability, identifyrestrictionsorlimits presentinthe productionsystemandidentify completion andproductionsystem.NODALanalysisisusedtooptimizethedesignsuit An analyticaltoolusedinforecastingtheperformanceofvariouselements comprisingthe NODAL analysis NI yrcro xlrto n rdcinAtvte 2011-12 - Hydrocarbon Exploration andProduction Activities - INDIA SUPPLEMENTARY INFORMATION 135 ugs l DGH INDIA -Activities Hydrocarbon Exploration and Production - 2011-12 Natural forces in the reservoir that displace hydrocarbons out of the reservoir into the wellbore and up Natural forces in the reservoir that displace hydrocarbons out of to surface. Reservoir-drive mechanisms An unmanned submersible vehicle controlled from surface. In deepwater operations, remotely operated An unmanned submersible vehicle controlled from surface. In deepwater and to control or manipulate valves. vehicles are used to inspect subsea structures and equipment, This term is commonly abbreviated m]. [457 to 3048 They can operate at depths from 1500 to 10,000 ft as ROV. Remotely Operated Vehicle (ROV) Remotely Operated Vehicle The recoverable amount of hydrocarbon initially in place, normally expressed as a percentage. The expressed as a percentage. The recoverable amount of hydrocarbon initially in place, normally objective of enhanced oil An important recovery factor is a function of the displacement mechanism. recovery is to increase the recovery factor. Recovery Factor An area of exploration in which hydrocarbons have been predicted to exist in economic quantity. A to exist in economic quantity. An area of exploration in which hydrocarbons have been predicted that such as a geologic structure or a seismic amplitude anomaly, prospect is commonly an anomaly, for drilling a well. is recommended by explorationists Prospect A mathematical means of expressing the ability of a reservoir to deliver fluids to the wellbore. The PI the ability of a reservoir to deliver fluids to the wellbore. mathematical means of expressing A of drawdown at the sand face (bbl/d/psi). as the volume delivered per psi is usually stated Productivity Index (PI) An analysis of data obtained from measurements of the bottom hole pressure in a well that is shut-in of from measurements obtained An analysis of data time is used with mathematical The profile created on a plot of pressure against a flow period. after area. and characteristics of the reservoir and the near-wellbore reservoir models to assess the extent Pressure build-up analysis The lowest temperature (in °F or °C) at which a liquid remains pourable (meaning it still behaves as a °C) at which a liquid remains pourable (meaning it still behaves The lowest temperature (in °F or from poor screening and excessive suffer may high pour points fluid). Oil or synthetic muds with pour or other operations subject to low temperatures. In oils, the pressure, surges in deepwater wells content. high paraffin point is generally increased by a Pour point To prepare a wellbore to be shut in and permanently isolated. In most cases, a series of cement p of cement most cases, a series isolated. In in and permanently to be shut a wellbore prepare To grains such as but the alignment of platy relatively high porosity, Shale gas reservoirs tend to have low. clays makes their permeability very Plug and Abandon Plug and fracture porosity. fractures, in which case it is called generated by the development of Porosity can be in a reservoir. a rock that contributes to fluid flow interconnected pore volume in porosity is the Effective whether or not it contributes in the rock void space is the total porosity Total pores. It excludes isolated porosity. is typically less than total porosity Thus, effective to fluid flow. The percentage of pore volume or void space, or that volume within rock that can contain fluids. can contain or that volume within rock that of pore volume or void space, The percentage grains that were not between such as space a relic of deposition (primary porosity, Porosity can be (secondary porosity, through alteration of the rock completely) or can develop together compacted sandstones). preferentially dissolved from grains or fossils are such as when feldspar Porosity is set in the wellbore, with an inflow or integrity test made at each stage to confirm hydraulic isolation. to confirm at each stage test made an inflow or integrity the wellbore, with is set in SUPPLEMENTARY INFORMATION 136 DGH wellbores tobeplacedin themostproductiveareasofreservoir. production orpotentialproduction. Geoscientists andengineersattemptto mapsweetspots enable Colloquial expressionfor atarget locationorareawithinaplayreservoir thatrepresents thebest Sweet spot acoustic anddensitylogswiththewaveletderived fromseismicdata. Earth. The syntheticseismogramisgeneratedby convolvingthereflectivityderivedfromdigitized a synthetic,isdirectone-dimensionalmodelof acousticenergytravelingthroughthelayersof more narrowdefinitionusedbyseismicinterpreters isthatasyntheticseismogram,commonlycalled The resultofonemanyformsforwardmodeling topredicttheseismicresponseofEarth. A Synthetic seismogram A techniqueforutilizingfractal geometrytoproducereservoirdescriptions. Spectral densityanalysis aids production. conditions causethegastobreakfromsolutioncreateacommingledflowofandliquid that is derivedfromthegasdissolvedinfluid. As reservoirfluidsenterthewellbore,changingpressure A typeofreservoir-drivesysteminwhichtheenergyfortransportandproductionreservoir fluids Solution gasdrive the originalvariableofinterest. the modeltonormality, simulatingthenormallydistributedtransform,andthenback-transforming to iterating fromafirstguessandrefiningthroughreductionoferrors,theproceduregenerallytransforms A procedureforestimatingthereservoircharacteristicsbetweendata points. Based ontheideaof Sequential Gaussiansimulation horizontal, orextended-reachwells. slide asteerablemotor.Rotary steerablesystemstypicallyaredeployedwhendrillingdirectional, A tooldesignedtodrilldirectionallywithcontinuousrotation fromthesurface,eliminating need to Rotary steerablesystem decreased. into aliquidunderisothermalconditionsinsteadofexpanding orvaporizingwhenpressureis below dewpointpressureduringproduction.Itiscalledretrogradebecausesomeofthegascondenses The formationofliquidhydrocarbonsinagasreservoirasthepressuredecreases Retrograde condensation the resistivityofrocksfilledwithhydrocarbonsandthoseformationwater. do notconductelectricitywhileallformationwatersdo. Therefore alargedifference exists between 0.2 to2000ohm-m. The resistivitylogisfundamental informationevaluationbecausehydrocarbons values, and,therefore,forconvenienceisusuallypresentedonalogarithmicscalefrom,example, A logoftheresistivityformation,expressedinohm-m. The resistivitycantake awiderangeof Resistivity log Reservoir-drive mechanismsarealsocallednaturaldrives. efficient drive mechanism,followedbygasdriveandgravitydrainage. water driveoredgedrive),combinationdrive,andgravitydrainage.Water driveisthemost Reservoir-drive mechanismsincludegasdrive(gascaporsolutiondrive),water(bottom NI yrcro xlrto n rdcinAtvte 2011-12 - Hydrocarbon Exploration andProduction Activities - INDIA SUPPLEMENTARY INFORMATION 137 DGH INDIA -Activities Hydrocarbon Exploration and Production - 2011-12 A measurement of the maturity of organic matter with respect to whether it has generated hydrocarbons A measurement of the maturity of organic matter with respect to whether source rock. or could be an effective Vitrinite reflectance Vitrinite A class of borehole seismic measurements used for correlation with surface seismic data, for obtaining used for correlation with surface seismic data, class of borehole seismic measurements A looking ahead of the drill bit; also images of higher resolution than surface seismic images and for using geophones made in a vertical wellbore refers to measurements Purely defined, VSP called a VSP. inside the wellbore and a source at the surface near the well. Vertical seismic profile Vertical Pooled production from wells or a reservoir. The proceeds of this pooled production are distributed to Pooled production from wells or a reservoir. formula. according to an agreed-upon the participants Unitized production A grade scale for classifying the diameters of sediments. Particles larger than 64 mm in diameter are Particles the diameters of sediments. grade scale for classifying A smaller than Those silt. are pebbles, granules, sand and particles classified as cobbles. Smaller scale size scales are in use, but the Udden-Wentworth Several other grain 0.0039 mm are clay. scale) is the one that is most frequently used in geology (commonly called the Wentworth Udden-Wentworth scale Udden-Wentworth A method for quantifying well and reservoir parameters such as permeability, skin, fracture half-length, as permeability, such and reservoir parameters method for quantifying well A derivative of the the pressure change and its and others, by comparing dual-porosity parameters, curves. When a match is found between to reservoir model curve families, called type acquired data that characterize the behaviour of the model providing a match and a type curve, the parameters data are thereby determined. Type-curve analysis Type-curve The pressure response resulting from changes in a well’s production rate. This includes drawdown, in This includes drawdown, rate. production from changes in a well’s The pressure response resulting in which the pressure rises to the production of fluids; buildups, which the pressure falls in response an injection well is shut in. in which the pressure falls after a well is shut in; and falloffs, after Transient-pressure response Transient-pressure Seismic data from the surface or a borehole acquired at different times over the same area to assess from the surface or a borehole acquired at different Seismic data of secondary recovery. time, such as fluid movement or effects changes in the subsurface with Time-lapse seismic data Time-lapse A formation encountered during drilling into which circulating fluids can be lost. during drilling into which A formation encountered Thief zone The degree of heating of a source rock in the process of transforming kerogen into hydrocarbon. process of transforming kerogen of a source rock in the The degree of heating or by pyrolysis. vitrinite reflectance is commonly evaluated by measuring Thermal maturity Thermal maturity A term used mainly on offshore platforms, or installations with multiple wellheads, where more than where more multiple wellheads, with or installations platforms, on offshore used mainly term A unit may be or coiled tubing rig, slickline unit where a drilling such as is being accessed, one wellbore at the same time. operating Simultaneous operation (SIMOP) operation Simultaneous SUPPLEMENTARY INFORMATION 138 DGH orientation oftheminerals, and samplepreparation. shape ofthediffraction peakarestronglyinfluenced bythegeometryofmeasurement,forexample indicates thequantityofmineral. The techniqueisonlysemi-quantitative becausethesizeand of thedistance betweendiscretecrystallographic diffracting planeswithinminerals,whiletheirintensity diffraction peaksinX-raysdiffracted bythesample. The positionofthediffraction peaks is ameasure A techniqueforthesemi-quantitative mineralogicalanalysisofasamplerockbymeasuringthe X-ray diffraction X-rays ontheothersideasuitable photographicfilm. A techniqueforimagingacorebymovingsourceofX-raysalongandrecordingtheattenuated X-radiography workover rigsorrodunits areroutinelyusedinwellserviceactivities. to assessormonitortheperformanceofwellreservoir. Slickline,coiledtubing,snubbingand or enhancethewellproductivity, althoughsomeslicklineandcoiledtubingapplications are performed production fromthereservoirhasbegun.Well serviceactivitiesaregenerallyconductedtomaintain The maintenanceproceduresperformedonanoilorgaswellafter thewellhasbeencompletedand Well servicing obtained. Modernvariationsonthistoolhavebeendevelopedtoacquireformation-fluidsamples. chosen locationsinaninterval,and,withaccuratequartzgauge,permeabilityestimatesmay be production intoasmallclosedchamber. The toolisprimarilyusedtoobtain formationpressuresat A toolrunonanelectricloggingcablethatpushesaprobeintotheformation,whichthenallows Wireline formationtester invasion causedbythedrillingprocess. reductions innear-wellpermeabilitycausedbyperforatingdebrisorfromthesolidsmudfiltrate Any restrictiontoflowfromnear-wellreductionsincapacity. This damageisthoughttoresultfrom Wellbore damage evaluation. Well plansmightberelativelysimpleforverticalwellbores. The descriptionofaproposedwellbore,includingtheshape,orientation, depth,completion,and Well plan production atonewelltomeasurablyaffect thepressureatanadjacentwell. production orinjectionwells.Incommerciallyviablereservoirs,itusuallytakes considerabletimefor The pressurevariationwithtimerecordedinobservationwellsresultingfromchangesrates Well interferencetesting energy isexpendedorthewelleventuallyproducestoomuchwatertobeviable. the reservoirdepletes,watermovinginfromaquiferbelowdisplacesoiluntil A reservoir-drivemechanismwherebytheoilisdriventhroughreservoirbyanactiveaquifer. As Water drive NI yrcro xlrto n rdcinAtvte 2011-12 - Hydrocarbon Exploration andProduction Activities - INDIA SUPPLEMENTARY INFORMATION 139 DGH Floor th Floor, th Floor, Sector-8, Floor, nd Floor, Gopala Tower, 25 Rajendra Place, Tower, Gopala Floor, North Avenue, Maker Maxity, Avenue, North rd Floor, Tower B, First India Place, Tower Floor, Plaza, Vipul Floor, Floor, Abhijeet Fllisbridge Floor, Floor, Astron Tower, Astron Floor, Floor, Astron Tower, Astron Floor, th th rd nd rd th Ahmedabad - 380 006 Focus Energy Ltd., 23 New Delhi - 110008 Gurgaon-122 002 Deep Energy LLC, 6 Opposite: Fun Republic cinema, Ahmedabad-380015 S G Highway, Petroleum East West Pender Street 1210-1095 West BC V6E 2M6 Vancouver, ENI India Ltd. 14 Tower- Eros Corporate Nehru Place, New Delhi – 110019 EnSearch Petroleum Pvt. Ltd. F-15, 2 Noida – 201 301 Essar Oil Limited, Box 7913, 11, Essar House, P.O. Keshavrao Khadye Marg, Mahalaxmi, Mumbai-400034 (Gujarat) Pvt. Ltd. Esveegee Steel 7 BP India Services Pvt. Ltd. (CBM) Pvt. Ltd. India Services BP 3 Gurgaon Road, Sushant Lok-1, Mehrauli Gurgaon, Haryana Limited BP Exploration (Alpha) Floor, Unit No 71 & 73, 7th 2 Bandra (E), Bandra Kurla Complex, India Mumbai – 400051, Pty Ltd. Cairn Energy India 3 Suncity Sector 54, Gurgaon – 122 002 (CBM) CoalGas / Deep Industries Ltd. 6 Opp. Fun-Republic Cinema, Highway, S.G. Ahmedabad- 380 015 (CBM) Ltd. Dart Energy (India) Pty. DLF Cyber City, Phase-III, Building No. 9 B, 16 Tower INDIA -Activities Hydrocarbon Exploration and Production - 2011-12 Floor, th Floor, th Avenue Avenue SW, Floor, th th Floor, 22 Community Centre Floor, Floor, Tower B, First India Place Tower Floor, Floor, Tower-1 Floor, rd th nd LIST OF SOME COMPANIES IN INDIAN E& P SECTOR E& P IN INDIAN COMPANIES OF SOME LIST Sushant Lok-I, Mehrauli Gurgaon Road Gurgaon - 122002 BP India Services 3 Bharat PetroResources Ltd, E Wing, 9 Towers, Maker Jeevan Bharti Building, Cannaught Place New Delhi – 110001 Bharat Petroleum Corpn. Ltd. ECE House, 28A, Kasturba Gandhi Marg New Delhi-110001 BG Exploration and Production India Ltd, BG Exploration and Production India BG House, Lake Boulevard Road Hira Nandani Busiiness Park, Powai, Mumbai-400076 Calgary, Alberta, Alberta, Canada, Calgary, T2P 2X6 BHP Billiton – India 8 Cuffe Parade, Mumbai-400 005 Cuffe Bengal Energy International Inc. 715 - 5 1140 Arrow Energy(India) Pty. Ltd. Arrow Energy(India) Pty. Phase-III, Building No. 9, DLF Cyber City, B, 16 Tower India Ltd. Assam Company Oil & Gas Division 2 Vihar Basant Lok, Vasant New Delhi –110057 # 5-9-58/B, Fateh Maiden Road Basheerbagh Hyderabad - 500 004 Gurgaon – 122 002 Andhra Pradesh Gas Infrastructure Corp. Pvt. Ltd. Andhra Pradesh Parisrama Bhawan, 5 Adani Welspun Exploration Ltd. Adani Welspun Building, Sambhaav Press Nr Judges Bunglow, Ahmedabad – 380 015 Bodakdev, Adani Enterprises Ltd Adani Enterprises Adani House, Nr Mithakhali Circle Navrangpura Gujarat Ahmedabad 380 009, SUPPLEMENTARY INFORMATION 140 DGH Mumbai –400072 (East), Chandvali, Andheri Off SakiVihar Road, 4123/DWing,OberoiGarden Estate Hydrocarbon ResourcesDevelopment Co.Pvt.Ltd. Chennai-600 018 St. Mary’s Road, ALWARPET, Lakshmi Chambers,192, Hindustan OilExploration CoLtd. P.B. No.11041, Mumbai–400020 Petroleum House,17,JRD Tata Road Hindustan Petroleum Corpn. Ltd. Somajiguda, Hyderabad–500082 2nd Floor, VMansion,#6-3-885/7/B/4, Heramec Ltd Delhi -110 007 113-A, KamalaNagar Harish Chandra(India)Ltd. Chennai -600004,India 108, Dr. RadhakrishnanSalai V Floor,Westminster Building Hardy Exploration&Production(India)Inc. Gandhinagar -382010 Udyog Bhawan,Sector-11, Block 15,2ndfloor, GSPCBhawan Gujarat State PetroleumCorpn.Ltd. South City,NH-8, Gurgaon122 001 Signature Towers.A,14’Floor, Great EasternEnergyCorporationLtd. (CBM) Sainik Farms,NewDelhi-62 Lane W-4D/6, Western Avenue, Gepetrol InternationalInc.(CBM) New Delhi–110055 1& 2IshwarNagar, MathuraRoad, The MiraCorporateSuites,BlockD-1, Geopetrol InternationalInc. Info city,Gandhinagar, Gujarat 304 -305,I T Tower -2 Geo-Global Resources(Barbados)Ltd. Noida -201301 Sector-16A, FilmCity Express Trade Tower-I Geo EnproPetroleumLtd. New Delhi-110066 R.K. Puram,RingRoad, GAIL Bldg.,16,BhikajiCamaPlace GAIL IndiaLtd. New Delhi–110017 E-9, 2ndFloor, Saket, Foresight OilLimited NI yrcro xlrto n rdcinAtvte 2011-12 - Hydrocarbon Exploration andProduction Activities - INDIA New Delhi-110 001 124 IndiraChowk,Connaught Circus, Jeevan Bharti Tower II,6thFloor, Oil &NaturalGasCorpn. Ltd. Sector-25, Gandhinagar-382044 X-22-24, GIDC,ElectronicState Cambay Square,2ndFloor Oilex NL Ltd. New Delhi–110001 Tolstoy House15-17, Tolstoy Marg, Flat No.1012,10thFloor, OAO Gazprom Lodhi Road,NewDelhi–110003 5th Floor, 7,Institutional Area Scope Complex,Core-7 NTPC Bhawan NTPC Ltd., New Delhi–110019 F-63, Kalkaji, Norwest India Baroda- 390007 “Landmark” 4thFloor, RaceCourse Niko ResourcesLtd. Noida- 201301(U.P.) India C-125A,, Sector-2, NaftoGaz IndiaPrivateLimited Nariman Point,Mumbai 3rd Floor, BWing,Mittal Tower, Mercator PetroleumPvt.Ltd. Church Gate,Mumbai-400020 Opp. KCCollege,Dinsha-Vacha Road 4th Floor, 23Vaswani Mansions KGN IndustriesLtd. NOIDA- (U.P)201301 A-80, Sector-2 Jubilant Oil&GasPvt.Ltd. New Delhi-110066 12 BikajiCamaPalace Jindal Center JSPL Oil And NaturalGasLtd. Road, Ahmedabad Off Ashram Near GujaratVidapith, Usmanpura 402, HERITAGE, BehindVisnagar Co-opBank Joshi Technologies internationalInc, Noida-201301 H-20,Sector-27 Interlink PetroleumLimited JB Tito Marg,NewDelhi-110 049 3079/3 SadiqNagar Indian OilCorpn.Ltd. SUPPLEMENTARY INFORMATION 141 DGH Floor, st Thane - Belapur Road, Ghansoli, Thane - Belapur – 400 071. Navi Mumbai Resources Limited (CBM) Reliance Natural City Ambani Knowledge H Block, Dhirubhai Navi Mumbai – 400710 Natural Resources Ltd, Sankalp Oil and Kailash Part-II, Greater W-120, New Delhi Operations Pvt. Ltd., Santos International & 1402, 14th Floor, Narain Manzil 1401 23, Barakhamba Road, 001 New Delhi – 110 Limited Selan Exploration Technology 25, Sukh Chan Marg, DLF-Phase-I Gurgaon (Haryana) Suntera Energy India Area, Plot 39, Institutional Sector 32, Gurgaon - 122 001 Petrodyne Ltd, Tata Wing, A 10G, Knowledge Park Technopolish Andheri (East), Mahakali Caves Road Mumbai – 400 003 Resources Limited Vasundhara Towers Lansdowne 6th Floor, 2/1A, Sarat Bose Road - 700020 Kolkata Petroleum Ltd. Videocon 1601, Maker Chambers V, Nariman Point 16th Floor, Mumbai - 400021 Reliance Industries Ltd., Reliance Corporate Park Reliance No. 8, B Wing, 1 Building INDIA -Activities Hydrocarbon Exploration and Production - 2011-12 Floor, Arcadia Building, Floor, th Quest Petroleum Pvt. Ltd. Block-B 2nd Floor, Atrium Vatika Sector Road, DLF Phase-V Gurgaon - 1220 02 Prize Petroleum Co. Ltd. UCo Bank Building C/o HPCL, 3rd Floor, 001 New Delhi-110 Parliament Street, NCPA road, Nariman Point, Mumbai-400021 NCPA Pratibha oil & Natural Gas Private Limited Pratibha oil & Natural Gas Private 1201/1202, 12 Petrogas, No. 801A, 8th Floor, A, Signature Tower, Tower South City-1, NH-8, Gurgaon – 122 001 Petrocon Indla Limited Jhandewalan Tower, Videocon New Delhi Pan India Consultants Private Limited Private Pan India Consultants Udyog Vihar, 105, Phase-IV, Haryana Gurgaon-122015, ONGC CBM- Development Project, ONGC CBM- Development Building, HSCL First Floor, Near- Naya More, City-827001 Bokaro Steel Omkar Natural Resources Pvt. Ltd. Resources Omkar Natural Highway Express Sai CHS, Off Om Shiv Bhathi Signal, Opposite Sion Chunna Mumbai-400022 Oil India Limited Oil India Sector 16A Film City, Plot No. 19, Noida - 201301 SUPPLEMENTARY INFORMATION 142 DGH ...... NI yrcro xlrto n rdcinAtvte 2011-12 - Hydrocarbon Exploration andProduction Activities - INDIA NOTES