DOCSLIB.ORG

Tissue-Specific Regulation and Function of Grb10 During Growth And

Total Page：16

File Type：pdf, Size：1020Kb

Download full-text PDF Read full-text
Tissue-Specific Regulation and Function of Grb10 During Growth And PAPER Tissue-specific regulation and function of Grb10 during COLLOQUIUM growth and neuronal commitment Robert N. Plasschaert and Marisa S. Bartolomei1 Department of Cell & Developmental Biology, Perelman School of Medicine at the University of Pennsylvania, Philadelphia, PA 19104 Edited by Eric B. Keverne, University of Cambridge, Cambridge, United Kingdom, and accepted by the Editorial Board September 23, 2014 (received for review July 29, 2014) Growth-factor receptor bound protein 10 (Grb10) is a signal factor, which is recruited in a DNA methylation-sensitive manner adapter protein encoded by an imprinted gene that has roles in and has been implicated in the regulation of imprinted expression growth control, cellular proliferation, and insulin signaling. Addi- at other loci (Fig. 1A). tionally, Grb10 is critical for the normal behavior of the adult Thus, Grb10 is an imprinted gene with multiple functions and mouse. These functions are paralleled by Grb10’s unique tissue- a complex tissue-specific imprinted expression pattern. Here, we specific imprinted expression; the paternal copy of Grb10 is review work that has illuminated the functional roles of Grb10 in expressed in a subset of neurons whereas the maternal copy is embryonic development, cellular growth, and behavior. We also expressed in most other adult tissues in the mouse. The mecha- review the various regulatory mechanisms that have been implicated nism that underlies this switch between maternal and paternal in the control of Grb10 tissue-specific expression and imprinting. expression is still unclear, as is the role for paternally expressed Additionally, we present data addressing the regulation of Grb10 Grb10 in neurons. Here, we review recent work and present com- expression during neuronal development in vitro. We show that in plementary data that contribute to the understanding of Grb10 vitro differentiation of mouse embryonic stem cells (mESCs) into gene regulation and function, with specific emphasis on growth motor neurons results in the switch of Grb10 promoter use. Spe- and neuronal development. Additionally, we show that in vitro cifically, the maternally expressed major promoter is repressed differentiation of mouse embryonic stem cells into alpha motor whereas the paternally expressed neuron-specific promoter is acti- neurons recapitulates the switch from maternal to paternal ex- vated, concordant with neuronal maturation. We postulate that this BIOLOGY pression observed during neuronal development in vivo. We switch in expression is required for the appropriate function of DEVELOPMENTAL postulate that this switch in allele-specific expression is related Grb10 in the nervous system. to the functional role of Grb10 in motor neurons and other neuronal tissues. Grb10 Binding Partners Define Its Role in Development In mouse and human, Grb10 has five major protein domains: the genomic imprinting | epigenetics | Grb10 | motor neurons | N-terminal proline-rich region (PR), a centrally located pleck- neurodevelopment strin homology domain (PH), a Ras-associating domain (RA), a C-terminal Src homology 2 domain (SH2), and the family- rb10 is an adapter protein that is a member of the Grb7/ specific BPS domain, so named because it is between the PH and GGr10/Grb14 protein family. These proteins interact with SH2 domains (4). Each domain is associated with protein binding numerous receptor tyrosine kinases, impacting a variety of sig- partners that define the functions of Grb10 in development and naling pathways (1). Specifically, Grb10 has been implicated in growth (Fig. 2 and Table S1). the regulation of cell proliferation, apoptosis, and metabolism, The SH2 domain enables Grb10 to interact with phosphory- among other functions (2–4). The first characterized Grb10 lated tyrosine residues of other proteins and acts as the re- knockout mouse exhibited overgrowth in numerous organs and cruitment point for a variety of signaling molecules. Many of tissues, suggesting that Grb10 acts as a potent growth suppressor these proteins are receptors associated with growth, including in vivo (5). Other Grb10 knockout mouse models have addi- the insulin receptor (IR) and the growth hormone receptor tionally shown that Grb10 plays an important role in social (GHR) (9, 10). The SH2 domain is critical for the role of Grb10 dominance behavior in mice (6). in the mitogen-activated protein kinase (MAPK) pathway, hav- Interestingly, these phenotypes are dependent on the parental ing direct interactions with numerous critical components in- origin of the Grb10 mutation. The overgrowth phenotype is cluding MEK1 and RAF1 (11). The SH2 domain also interacts exhibited only when the mutation is transmitted through the ma- with many receptor proteins implicated in cell proliferation, ternal lineage whereas the behavior phenotype is revealed upon differentiation, and control of the cell cycle, including RET, paternal transmission of the mutation. These surprising allele- KIT, MET, PDGFR, EGFR, FLT3, and VEGFR-2 (9, 12–16). specific phenotypes can be explained by the tissue-specific genomic Additionally, the SH2 domain has been implicated in Grb10 imprinting of Grb10. Genomic imprinting refers to an infrequent regulatory phenomenon in which a gene is expressed in a parent- – of-origin specific manner. Genomic imprinting is dependent on This paper results from the Arthur M. Sackler Colloquium of the National Academy of cis-regulatory elements called imprinting control regions (ICRs) Sciences, “Epigenetic Changes in the Developing Brain: Effects on Behavior,” held March that are epigenetically modified on a single parental allele to 28–29, 2014, at the National Academy of Sciences in Washington, DC. The complete pro- induce allele-specific expression (7). Grb10 is expressed from gram and video recordings of most presentations are available on the NAS website at www.nasonline.org/Epigenetic_changes. the maternal chromosome in most tissues in the mouse but is Author contributions: R.N.P. and M.S.B. designed research; R.N.P. performed research; R.N.P. expressed from the paternal allele in a subset of neurons. Maternal contributed new reagents/analytic tools; R.N.P. and M.S.B. analyzed data; and R.N.P. and M.S.B. expression occurs from the Grb10 major promoter whereas Grb10 wrote the paper. paternal expression comes from three downstream alternative The authors declare no conflict of interest. promoters (Fig. 1). The region surrounding one of these alternative This article is a PNAS Direct Submission. E.B.K. is a guest editor invited by the Editorial promoters has been identified as an ICR, which exhibits DNA Board. methylation only on the maternal allele in all examined tissues (8). 1To whom correspondence should be addressed. Email: [email protected]. On the paternal allele, the unmethylated Grb10 ICR is bound by This article contains supporting information online at www.pnas.org/lookup/suppl/doi:10. CCCTC-binding factor (CTCF), a multifunctional transcription 1073/pnas.1411254111/-/DCSupplemental. www.pnas.org/cgi/doi/10.1073/pnas.1411254111 PNAS | June 2, 2015 | vol. 112 | no. 22 | 6841–6847 Downloaded by guest on September 29, 2021 A Grb10 (chr11:11930499-12037420; mm10) 1A (Major) A.S. ICR 4R CTCF 1B2 (Neuronal) 1B1 (Neuronal) 1C (Neuronal/Embryonic) B Whole Whole E14 Spinal C Kidney Brain Brain Liver mESC Cord (Cast x B6) (Cast x B6) Cac8I - + - + 1A-4R 311bp 1C-4R 199bp 1B1-4R 1B2-4R 112bp Fig. 1. Grb10 is expressed maternally from most adult tissues and paternally in neuronal tissues. (A) A schematic of the Grb10 locus is shown, with the allelic- specific expression of alternative promoters indicated (maternal and paternal alleles, arrow above the line and below the line, respectively). The imprinting control region (ICR) is designated by a yellow box. Maternal allele-specific DNA methylation, evident in all characterized tissues, is indicated by black lollipops, above the line. The reverse primer location for expression analysis is shown by its name, 4R. The location of the amplicon used for allele-specific (A.S.) analysis is similarly indicated. (B) Expression of transcripts from alternative promoters of Grb10 is shown in adult brain, adult liver, mESCs, and adult spinal cord. (C) Allele-specific expression as measured via SNP-dependent Cac8I restriction enzyme digests is shown in brain and liver from Mus Castaneus/EiJ (Cast) × C57BL/6J (B6) hybrid adult mice. Expression of the maternal allele is indicated by the 199-bp and 112-bp bands after restriction digest whereas the 311-bp band indicates paternal expression. homodimerization, which is hypothesized to enable Grb10 to a variety of metabolic consequences affecting the storage and integrate signals from multiple pathways through the formation synthesis of glucose and fatty acids, in addition to promoting of larger protein complexes (17). cellular growth through regulating proteins important for the cell The BPS domain, specific to the Grb7/10/14 protein family, cycle and other mitogenic factors. Additionally, both pathways has also been shown to be important for Grb10’s role in insulin can activate mTORC1, a protein complex that integrates growth signaling through its binding to IR and additionally binds IGF1R signals and acts positively upon cell proliferation (24). (14). The BPS domain interacts with the 14-3-3 protein, another Grb10 potently inhibits cellular growth by acting at multiple protein scaffold with numerous protein partners, and BCL2L11, levels in these pathways, among others. Grb10 inhibits insulin
Load more

Recommended publications
  • SRC Antibody - N-Terminal Region (ARP32476 P050) Data Sheet
    SRC antibody - N-terminal region (ARP32476_P050) Data Sheet Product Number ARP32476_P050 Product Name SRC antibody - N-terminal region (ARP32476_P050) Size 50ug Gene Symbol SRC Alias Symbols ASV; SRC1; c-SRC; p60-Src Nucleotide Accession# NM_005417 Protein Size (# AA) 536 amino acids Molecular Weight 60kDa Product Format Lyophilized powder NCBI Gene Id 6714 Host Rabbit Clonality Polyclonal Official Gene Full Name V-src sarcoma (Schmidt-Ruppin A-2) viral oncogene homolog (avian) Gene Family SH2D This is a rabbit polyclonal antibody against SRC. It was validated on Western Blot by Aviva Systems Biology. At Aviva Systems Biology we manufacture rabbit polyclonal antibodies on a large scale (200-1000 Description products/month) of high throughput manner. Our antibodies are peptide based and protein family oriented. We usually provide antibodies covering each member of a whole protein family of your interest. We also use our best efforts to provide you antibodies recognize various epitopes of a target protein. For availability of antibody needed for your experiment, please inquire (). Peptide Sequence Synthetic peptide located within the following region: QTPSKPASADGHRGPSAAFAPAAAEPKLFGGFNSSDTVTSPQRAGPLAGG This gene is highly similar to the v-src gene of Rous sarcoma virus. This proto-oncogene may play a role in the Description of Target regulation of embryonic development and cell growth. SRC protein is a tyrosine-protein kinase whose activity can be inhibited by phosphorylation by c-SRC kinase. Mutations in this gene could be involved in the
    [Show full text]
  • Chemoresistance in Human Ovarian Cancer: the Role of Apoptotic
    Reproductive Biology and Endocrinology BioMed Central Review Open Access Chemoresistance in human ovarian cancer: the role of apoptotic regulators Michael Fraser1, Brendan Leung1, Arezu Jahani-Asl1, Xiaojuan Yan1, Winston E Thompson2 and Benjamin K Tsang*1 Address: 1Department of Obstetrics & Gynecology and Cellular & Molecular Medicine, University of Ottawa, Ottawa Health Research Institute, Ottawa, Canada K1Y 4E9, Canada and 2Department of Obstetrics & Gynecology and Cooperative Reproductive Science Research Center, Morehouse School of Medicine, Atlanta, GA 30310, USA Email: Michael Fraser - [email protected]; Brendan Leung - [email protected]; Arezu Jahani-Asl - [email protected]; Xiaojuan Yan - [email protected]; Winston E Thompson - [email protected]; Benjamin K Tsang* - [email protected] * Corresponding author Published: 07 October 2003 Received: 26 June 2003 Accepted: 07 October 2003 Reproductive Biology and Endocrinology 2003, 1:66 This article is available from: http://www.RBEj.com/content/1/1/66 © 2003 Fraser et al; licensee BioMed Central Ltd. This is an Open Access article: verbatim copying and redistribution of this article are permitted in all media for any purpose, provided this notice is preserved along with the article's original URL. Abstract Ovarian cancer is among the most lethal of all malignancies in women. While chemotherapy is the preferred treatment modality, chemoresistance severely limits treatment success. Recent evidence suggests that deregulation of key pro- and anti-apoptotic pathways is a key factor in the onset and maintenance of chemoresistance. Furthermore, the discovery of novel interactions between these pathways suggests that chemoresistance may be multi-factorial. Ultimately, the decision of the cancer cell to live or die in response to a chemotherapeutic agent is a consequence of the overall apoptotic capacity of that cell.
    [Show full text]
  • Mitochondrial Membrane Binding and Protein Complexing of the Anti-Apoptotic Adaptor Protein Grblo
    Mitochondrial membrane binding and protein complexing of the anti-apoptotic adaptor protein GrblO. by Jennifer Hassard Department of Biology McGill University, Montreal A thesis submitted to the Faculty of Graduate Studies and Research in partial fulfillment of the requirements for the degree of Master's of Science August 2001 Supervisor: Dr. David Thomas, Department of Biochemistry © Jennifer Hassard, 2001 .....--. National Library Bibliothèque nationale 1+1 of Canada du Canada Acquisitions and Acquisitions et Bibliographie Services services bibliographiques 395 Wellington Street 395. rue Wellington OttawaON K1A0N4 Ottawa ON K1 A ON4 canada canada Your liIe VoIJ8 rrlfénJnce Our liIe Notre rtifénlncs The author has granted a non­ L'auteur a accordé une licence non exclusive licence al10wing the exclusive permettant à la National Library ofCanada to Bibliothèque nationale du Canada de reproduce, loan, distribute or sell reproduire, prêter, distribuer ou copies ofthis thesis in microform, vendre des copies de cette thèse sous paper or electronic formats. la forme de microfiche/film, de reproduction sur papier ou sur format électronique. The author retains ownership ofthe L'auteur conserve la propriété du copyright in this thesis. Neither the droit d'auteur qui protège cette thèse. thesis nor substantial extracts from it Ni la thèse ni des extraits substantiels may be printed or otherwise de celle-ci ne doivent être imprimés reproduced without the autbor's ou autrement reproduits sans son penmsslon. autorisation. 0-612-78889-X Canada ABSTRACT GrblO is a member of the Grb7 family of adaptor proteins that also includes Grb7 and Grb14. These three members contain multiple protein binding domains and lack enzymatic activity.
    [Show full text]
  • CRKL As a Lung Cancer Oncogene and Mediator Of
    views in The spotliGhT CRKL as a Lung Cancer Oncogene and Mediator of Acquired Resistance to eGFR inhibitors: is it All That it is Cracked Up to Be? Marc Ladanyi summary: Cheung and colleagues demonstrate that amplified CRKL can function as a driver oncogene in lung adeno- carcinoma, activating both RAS and RAP1 to induce mitogen-activated protein kinase signaling. In addition, they show that CRKL amplification may be another mechanism for primary or acquired resistance to epidermal growth factor re- ceptor kinase inhibitors. Cancer Discovery; 1(7); 560–1. ©2011 AACR. Commentary on Cheung et al., p. 608 (1). In this issue of Cancer Discovery, Cheung and colleagues (1) mutual exclusivity. Cheung and colleagues (1) report that present extensive genomic and functional data supporting focal CRKL amplification is mutually exclusive with EGFR focal amplification of the CRKL gene at 22q11.21 as a driver mutation and EGFR amplification. However, of the 6 lung oncogene in lung adenocarcinoma. The report expands on cancer cell lines found in this study to have focal gains of data previously presented by Kim and colleagues (2). CRKL CRKL, 2 contain other major driver oncogenes (KRAS G13D is a signaling adaptor protein that contains SH2 and SH3 in HCC515, BRAF G469A in H1755; refs. 7, 8). Interestingly, domains that mediate protein–protein interactions linking both cell lines demonstrated clear dependence on CRKL in tyrosine-phosphorylated upstream signaling molecules (e.g., functional assays. Perhaps CRKL amplification is more akin BCAR1, paxillin, GAB1) to downstream effectors (e.g., C3G, to PIK3CA mutations, which often, but not always, are con- SOS) (3).
    [Show full text]
  • Evidence for an Interaction Between the Insulin Receptor and Grb7. a Role for Two of Its Binding Domains, PIR and SH2
    Oncogene (2000) 19, 2052 ± 2059 ã 2000 Macmillan Publishers Ltd All rights reserved 0950 ± 9232/00 $15.00 www.nature.com/onc Evidence for an interaction between the insulin receptor and Grb7. A role for two of its binding domains, PIR and SH2 Anne Kasus-Jacobi1,2,3,Ve ronique Be re ziat1,3, Dominique Perdereau1, Jean Girard1 and Anne-FrancËoise Burnol*,1 1Endocrinologie MeÂtabolisme et DeÂveloppement, CNRS, UPR 1524, 9 rue Jules Hetzel, 92190 Meudon, France The molecular adapter Grb7 is likely to be implicated in new family of adapters has recently emerged, the Grb7 the development of certain cancer types. In this study we family of proteins, comprising Grb7, Grb10 and show that Grb7 binds the insulin receptors, when they Grb14. The members of this family were originally are activated and tyrosine phosphorylated. This interac- cloned by interaction with EGF receptor, using the tion is documented by two-hybrid experiments, GST CORT (cloning of receptor target) system (Daly et al., pull-down assays and in vivo coimmunoprecipitations. In 1996; Margolis, 1994; Ooi et al., 1995), and the use of addition, our results argue in favor of a preferential the yeast two-hybrid technology has emphasized their association between Grb7 and the insulin receptors when implication in signal transduction (Daly, 1998). These compared to other tyrosine kinase receptors like the adapters bind also other tyrosine kinase receptors, like EGF receptor, the FGF receptor and Ret. Interestingly, erbB2, Ret, Elk, PDGF receptors, insulin receptors and Grb7 is not a substrate of the insulin receptor tyrosine IGF-1 receptors (Daly et al., 1996; Dey et al., 1996; kinase activity.
    [Show full text]
  • Stimulation of Endogenous GH and Interleukin-6 Receptors Selectively Activates Different Jaks and Stats, with a Stat5 Specific Synergistic Effect of Dexamethasone
    301 Stimulation of endogenous GH and interleukin-6 receptors selectively activates different Jaks and Stats, with a Stat5 specific synergistic effect of dexamethasone S von Laue1, J Finidori3, M Maamra1, X-Y Shen1, S Justice1, P R M Dobson2 and R J M Ross1 1Division of Clinical Sciences, University of Sheffield, UK 2Institute for Cancer Studies, University of Sheffield, UK 3INSERM, Unité 344, Faculté de Médecine Necker, Paris, France (Requests for offprints should be addressed to S von Laue, INSERM U344, Laboratoire d’Endocrinologie Moléculaire, Faculté de Médecine Necker-Enfants Malades, 156, rue de Vaugirard, 75 730 Paris cedex 15, France; Email: [email protected]) Abstract The interaction of GH, interleukin (IL)-6 and glucocorti- Stat3 activation. In contrast, the reporter gene containing coids is likely to be important in regulating the GH- the Stat3 responsive element (SIE) was IL-6 specific. The insulin-like growth factor (IGF)-I axis. The signalling levels of gene induction by GH and IL-6 were not altered cascades activated by GH and IL-6 appear to be very by the co-stimulation with GH and IL-6, suggesting that similar, as demonstrated by studies using overexpression of there is little cross-talk at the Jak–Stat activation level the receptor and other components of the Jak-Stat and between the two cytokines. Neither GH nor IL-6 acti- mitogen-activated protein (MAP) kinase pathways. Here vated the MAP-kinase responsive serum response element we show that the human embryonic kidney cell line 293 (SRE), unless GH receptors or gp130 were overexpressed. (HEK293) expresses GH and IL-6 receptors endogenously.
    [Show full text]
  • Increased in Vivo Phosphorylation of Ret Tyrosine 1062 Is a Potential Pathogenetic Mechanism of Multiple Endocrine Neoplasia Type 2B1
    [CANCER RESEARCH 61, 1426–1431, February 15, 2001] Increased in Vivo Phosphorylation of Ret Tyrosine 1062 Is a Potential Pathogenetic Mechanism of Multiple Endocrine Neoplasia Type 2B1 Domenico Salvatore, Rosa Marina Melillo, Carmen Monaco, Roberta Visconti, Gianfranco Fenzi, Giancarlo Vecchio, Alfredo Fusco, and Massimo Santoro2 Centro di Endocrinologia ed Oncologia Sperimentale del CNR, c/o Dipartimento di Biologia e Patologia Cellulare e Molecolare [D. S., R. M. M., C. M., R. V., G. V., M. S.], and Dipartimento di Endocrinologia ed Oncologia Molecolare e Clinica, Facolta` di Medicina e Chirurgia [G. F.], Universita` di Napoli “Federico II,” Naples, Italy; and Dipartimento di Medicina Sperimentale e Clinica, Facolta`di Medicina e Chirurgia di Catanzaro, Universita`di Catanzaro, Catanzaro [A. F], Italy ABSTRACT are responsible for the inheritance of MEN2A and MEN2B and FMTC. Each disease has a distinct phenotype: MEN2A is associated Mutations of the Ret receptor tyrosine kinase are responsible for with MTC, pheochromocytoma, and parathyroid hyperplasia. The inheritance of multiple endocrine neoplasia (MEN2A and MEN2B) and MEN2B phenotype is more severe, being characterized by an earlier familial medullary thyroid carcinoma syndromes. Although several famil- ial medullary thyroid carcinoma and most MEN2A mutations involve occurrence of more aggressive MTC. Unlike MEN2A patients, substitutions of extracellular cysteine residues, in most MEN2B cases MEN2B patients develop multiple mucosal neuromas and several there is a methionine-to-threonine substitution at position 918 (M918T) of skeletal abnormalities. Finally, FMTC consists only of an inherited the Ret kinase domain. The mechanism by which the MEN2B mutation predisposition to MTC (3). Involvement of different tissues corre- converts Ret into a potent oncogene is poorly understood.
    [Show full text]
  • Supplementary Table S4. FGA Co-Expressed Gene List in LUAD
    Supplementary Table S4. FGA co-expressed gene list in LUAD tumors Symbol R Locus Description FGG 0.919 4q28 fibrinogen gamma chain FGL1 0.635 8p22 fibrinogen-like 1 SLC7A2 0.536 8p22 solute carrier family 7 (cationic amino acid transporter, y+ system), member 2 DUSP4 0.521 8p12-p11 dual specificity phosphatase 4 HAL 0.51 12q22-q24.1histidine ammonia-lyase PDE4D 0.499 5q12 phosphodiesterase 4D, cAMP-specific FURIN 0.497 15q26.1 furin (paired basic amino acid cleaving enzyme) CPS1 0.49 2q35 carbamoyl-phosphate synthase 1, mitochondrial TESC 0.478 12q24.22 tescalcin INHA 0.465 2q35 inhibin, alpha S100P 0.461 4p16 S100 calcium binding protein P VPS37A 0.447 8p22 vacuolar protein sorting 37 homolog A (S. cerevisiae) SLC16A14 0.447 2q36.3 solute carrier family 16, member 14 PPARGC1A 0.443 4p15.1 peroxisome proliferator-activated receptor gamma, coactivator 1 alpha SIK1 0.435 21q22.3 salt-inducible kinase 1 IRS2 0.434 13q34 insulin receptor substrate 2 RND1 0.433 12q12 Rho family GTPase 1 HGD 0.433 3q13.33 homogentisate 1,2-dioxygenase PTP4A1 0.432 6q12 protein tyrosine phosphatase type IVA, member 1 C8orf4 0.428 8p11.2 chromosome 8 open reading frame 4 DDC 0.427 7p12.2 dopa decarboxylase (aromatic L-amino acid decarboxylase) TACC2 0.427 10q26 transforming, acidic coiled-coil containing protein 2 MUC13 0.422 3q21.2 mucin 13, cell surface associated C5 0.412 9q33-q34 complement component 5 NR4A2 0.412 2q22-q23 nuclear receptor subfamily 4, group A, member 2 EYS 0.411 6q12 eyes shut homolog (Drosophila) GPX2 0.406 14q24.1 glutathione peroxidase
    [Show full text]
  • And Sepsis-Induced Lung Inflammation and Mediates Myd88
    The Journal of Immunology Caveolin-1 Tyr14 Phosphorylation Induces Interaction with TLR4 in Endothelial Cells and Mediates MyD88-Dependent Signaling and Sepsis-Induced Lung Inflammation Hao Jiao,*,†,1 Yang Zhang,*,†,1 Zhibo Yan,* Zhen-Guo Wang,* Gongjian Liu,† Richard D. Minshall,*,‡ Asrar B. Malik,‡ and Guochang Hu*,‡ Activation of TLR4 by the endotoxin LPS is a critical event in the pathogenesis of Gram-negative sepsis. Caveolin-1, the signaling protein associated with caveolae, is implicated in regulating the lung inflammatory response to LPS; however, the mechanism is not understood. In this study, we investigated the role of caveolin-1 in regulating TLR4 signaling in endothelial cells. We observed that LPS interaction with CD14 in endothelial cells induced Src-dependent caveolin-1 phosphorylation at Tyr14. Using a TLR4-MD2- CD14–transfected HEK-293 cell line and caveolin-1–deficient (cav-12/2) mouse lung microvascular endothelial cells, we demon- strated that caveolin-1 phosphorylation at Tyr14 following LPS exposure induced caveolin-1 and TLR4 interaction and, thereby, TLR4 activation of MyD88, leading to NF-kB activation and generation of proinflammatory cytokines. Exogenous expression of phosphorylation-deficient Y14F caveolin-1 mutant in cav-12/2 mouse pulmonary vasculature rendered the mice resistant to LPS compared with reintroduction of wild-type caveolin-1. Thus, caveolin-1 Y14 phosphorylation was required for the interaction with TLR4 and activation of TLR4-MyD88 signaling and sepsis-induced lung inflammation. Inhibiting caveolin-1 Tyr14 phosphoryla- tion and resultant inactivation of TLR4 signaling in pulmonary vascular endothelial cells represent a novel strategy for preventing sepsis-induced lung inflammation and injury.
    [Show full text]
  • ITRAQ-Based Quantitative Proteomic Analysis of Processed Euphorbia Lathyris L
    Zhang et al. Proteome Science (2018) 16:8 https://doi.org/10.1186/s12953-018-0136-6 RESEARCH Open Access ITRAQ-based quantitative proteomic analysis of processed Euphorbia lathyris L. for reducing the intestinal toxicity Yu Zhang1, Yingzi Wang1*, Shaojing Li2*, Xiuting Zhang1, Wenhua Li1, Shengxiu Luo1, Zhenyang Sun1 and Ruijie Nie1 Abstract Background: Euphorbia lathyris L., a Traditional Chinese medicine (TCM), is commonly used for the treatment of hydropsy, ascites, constipation, amenorrhea, and scabies. Semen Euphorbiae Pulveratum, which is another type of Euphorbia lathyris that is commonly used in TCM practice and is obtained by removing the oil from the seed that is called paozhi, has been known to ease diarrhea. Whereas, the mechanisms of reducing intestinal toxicity have not been clearly investigated yet. Methods: In this study, the isobaric tags for relative and absolute quantitation (iTRAQ) in combination with the liquid chromatography-tandem mass spectrometry (LC-MS/MS) proteomic method was applied to investigate the effects of Euphorbia lathyris L. on the protein expression involved in intestinal metabolism, in order to illustrate the potential attenuated mechanism of Euphorbia lathyris L. processing. Differentially expressed proteins (DEPs) in the intestine after treated with Semen Euphorbiae (SE), Semen Euphorbiae Pulveratum (SEP) and Euphorbiae Factor 1 (EFL1) were identified. The bioinformatics analysis including GO analysis, pathway analysis, and network analysis were done to analyze the key metabolic pathways underlying the attenuation mechanism through protein network in diarrhea. Western blot were performed to validate selected protein and the related pathways. Results: A number of differentially expressed proteins that may be associated with intestinal inflammation were identified.
    [Show full text]
  • Metabolic Imaging Allows Early Prediction of Response to Vandetanib
    Metabolic Imaging Allows Early Prediction of Response to Vandetanib Martin A. Walter1,2,MatthiasR.Benz2,IsabelJ.Hildebrandt2, Rachel E. Laing2, Verena Hartung3, Robert D. Damoiseaux4, Andreas Bockisch3, Michael E. Phelps2,JohannesCzernin2, and Wolfgang A. Weber2,5 1Institute of Nuclear Medicine, University Hospital, Bern, Switzerland; 2Department of Molecular and Medical Pharmacology, David Geffen School of Medicine, UCLA, Los Angeles, California; 3Institute of Nuclear Medicine, University Hospital, Essen, Germany; 4Molecular Shared Screening Resources, UCLA, Los Angeles, California; and 5Department of Nuclear Medicine, University Hospital, Freiburg, Germany The RET (rearranged-during-transfection protein) protoonco- The RET (rearranged-during-transfection protein) proto- gene triggers multiple intracellular signaling cascades regulat- oncogene, located on chromosome 10q11.2, encodes for ing cell cycle progression and cellular metabolism. We therefore a tyrosine kinase of the cadherin superfamily that activates hypothesized that metabolic imaging could allow noninvasive detection of response to the RET inhibitor vandetanib in vivo. multiple intracellular signaling cascades regulating cell sur- Methods: The effects of vandetanib treatment on the full- vival, differentiation, proliferation, migration, and chemo- genome expression and the metabolic profile were analyzed taxis (1). Gain-of-function mutations in the RET gene result in the human medullary thyroid cancer cell line TT. In vitro, tran- in uncontrolled growth and cause human cancers and scriptional changes of pathways regulating cell cycle progres- cancer syndromes, such as Hu¨rthle cell cancer, sporadic sion and glucose, dopa, and thymidine metabolism were papillary thyroid carcinoma, familial medullary thyroid correlated to the results of cell cycle analysis and the uptake of 3H-deoxyglucose, 3H-3,4-dihydroxy-L-phenylalanine, and carcinoma, and multiple endocrine neoplasia types 2A 3H-thymidine under vandetanib treatment.
    [Show full text]
  • SUPPLEMENTARY METHODS Cell Culture.-Human Peripheral Blood
    SUPPLEMENTARY METHODS Cell culture.-Human peripheral blood mononuclear cells (PBMC) were isolated from buffy coats from normal donors over a Lymphoprep (Nycomed Pharma) gradient. Monocytes were purified from PBMC by magnetic cell sorting using CD14 microbeads (Miltenyi Biotech). Monocytes were cultured at 0.5 x 106 cells/ml for 7 days in RPMI 1640 (standard RPMI, which contains 1 mg/L folic acid) supplemented with 10% fetal calf serum, at 37ºC in a humidified atmosphere with 5% CO2, and containing GM-CSF (1000U/ml) or M-CSF (10 ng/ml, ImmunoTools) to generate GM-CSF- polarized macrophages (GM-MØ) or M-CSF-polarized macrophages (M-MØ). MTX pharmacokinetic studies in RA patients administered 25 mg MTX showed peak plasma levels of 1-2 µM MTX two hours after drug administration, but plasma levels decline to 10-50 nM MTX within 24-48 hours [1, 2]. MTX (50 nM), pemetrexed (PMX, 50 nM), folic acid (FA, 50 nM) [3], thymidine (dT, 10 µM), pifithrin-α (PFT, 25-50 µM), nutlin-3 (10 µM, Sigma-Aldrich) was added once on monocytes together with the indicated cytokine, or on monocytes and 7-day differentiated macrophages for 48h. Gene expression profiling.-For long-term MTX treatment, RNA was isolated from three independent preparations of monocytes either unexposed or exposed to MTX (50 nM) and differentiated to GM-MØ or M-MØ for 7-days. For short-term schedule, RNA was isolated from three independent samples of fully differentiated GM-MØ either unexposed or exposed to MTX (50 nM) for 48h, by using RNeasy Mini kit (QIAGEN).
    [Show full text]