SALES RENTAL SERVICE CONSULTING ENGINEERING

TORKWORX is a leader in providing equipment and manpower to en- sure competent and safe solutions for the controlled tightening and loosening of complex joints. Our quality product and services are delivered to the Oil & Gas, Power Generation, Petro/ Refining and Heavy Engineering industries.

TORKWORX is committed to offer our customers a complete single source for all their bolting require- ments, providing the best solutions to handle all complex bolting appli- cations. Through a comprehensive and extensive line of torque and tension products, TORKWORX cus- tomers are assured of the most competent and cost effective solu- tion… Done right the first time. s a le s r e n t a l s e r vi ce c o ns ul t i ng engineering

8319 THORA LANE HANGAR E2 SPRING, TX 77379 888.502.WORX ph 713-481-6220 fax www.torkworx.com extreme bolting solutions that WORX

CONNECTING YOUR BUSINESS TO THE BOLTING TECHNOLOGY YOU NEED

TORKWORX is a leader in providing equipment and TORKWORX has introduced new generation ERAD

manpower to insure competent and safe solutions for electrically powered digitally controlled torque systems

the controlled tightening and loosening of complex that increase productivity and reduce downtime ONSITE BOLTING SERVICES Our specialists deliver bolt working joints. Our specialists deliver bolt working solutions by providing the operator with the ability to visually solutions derived using the most ad- derived using the most advanced technology and the confirm torque output as well as record the torque vanced technology and the most effi- highest quality materials along with turnkey bolting data for future reporting. This continuous rotation, cient bolting processes. Through con- tinuous and competent training our services performed by competent specially trained torque control stall tool is faster, more accurate and bolting technicians are equipped with bolting technicians. Our products and services insure costs less to operate than older, less efficient bolting all the knowledge and experience to the fasteners in any bolted connection are systems. increase your productivity, limit your downtime and deliver the worked in a controlled and safe manner. peace of mind that your application was…..DONE RIGHT THE FIRST

extreme solutions for TECHNOLOGY CONSULTING PROVIDES your bolt working needs A TOTAL END TO END SOLUTION. WEB SOLUTIONS PNEUMATIC TORQUE WRENCHES HIGH STRENGTH BOLT TENSIONERS Check out TORKWORX or Face- Continuous Rotation and Stall Type Adjustable Torque Standard Fixed and Multi-schedule models for the standard book, YouTube and the World Wide Output make this tool the perfect substitute for self de- ANSI and API Flanges. As well as Engineered Specialty Web for all the updates on new structive impacts. Ranges from 3/4” to 2-1.2” and up to Designs for Custom Solutions. technologies, services and projects. 50,000 ft/lbs torque. Stay informed on proper torque and tension processes as well as get access to critical bolting related HIGH PRESSURE POWER PACKS SQUARE DRIVE HYDRAULIC WRENCHES information. TORKWORX is always A complete and unique series of hydraulic pumps supplied Made from high Grade Alloys all of our quality square drive there when you need us. with the most recent certifications. Our power packs are systems are built to last. Ranges from 3/4” to 2-1/2” and state-of-the-art and the most innovative range on the market from 150 to 50,000 ft/lbs torque. to date.

LOW PROFILE HYDRAULIC WRENCHES HYDRAULIC FLANGE SPREADERS Built completely flat for accessibility all of our low profile With the Hydraulic Flange Spreader you can open, spread, systems can get in the tightest spots. Ranges from 3/4” to lift and level most all your flanges easily, quickly, quietly and 24 HOUR SUPPORT 6-1/8” Direct Fit and from 200 to 32,000 ft/lbs torque. safely! The Flange Spreader is a universal, “One size fits all” SERVICES solution for opening flanges for gasket changes. TORKWORX professionals are always available either on the web or by phone. If you require immediate re- IMPACT SOCKETS AND HAMMER WRENCHES HYDRAULIC NUT SPLITTERS sponse services, simply go online and Like our other products, we keep the toughest, most complete The Power Splitter is multi-schedule. It works on a large fill out our application form or call 1-888 line of slugging wrenches and back-up wrenches. Foreign -502-WORX. We are always ready to and domestic models available. From 12 PT to Castellated, range of nut sizes. This economical advantage exceeds the other models on the market that are limited to one or two nut help and insure your job is sizes. DONE RIGHT THE FIRST TIME! SALES RENTAL SERVICE CONSULTING ENGINEERING

TORKWORX is a leader in providing equipment and manpower to en- sure competent and safe solutions for the controlled tightening and loosening of complex joints. Our quality product and services are delivered to the Oil & Gas, Power Generation, Petro/ Refining and Heavy Engineering industries.

TORKWORX is committed to offer our customers a complete single source for all their bolting require- ments, providing the best solutions to handle all complex bolting appli- cations. Through a comprehensive and extensive line of torque and tension products, TORKWORX cus- tomers are assured of the most competent and cost effective solu- tion… Done right the first time.

8319 THORA LANE BLDG E2 SPRING, TX 77379 888.502.WORX ph 713-481-6220 fax www.torkworx.com Tomorrow’s technology at work for you today PROVIDING YOUR OPERATION THE MOST ADVANCED SOLUTIONS FOR SUCCESS

TORKWORX is a leader in providing equipment and TORKWORX bolting technicians are fully equipped manpower to insure competent and safe solutions for with the latest in bolt working systems. Our experts XBM THERMAL BOLT the controlled tightening and loosening of complex incorporate the safest most advanced and effective HEATING SYSTEMS joints. Our specialists deliver bolt working solutions techniques available to prevent the failure of bolted New generation XBM thermal bolt heating derived using the most advanced technology and the joints in any plant. When you employ the expertise systems from Xtreme Bolting have many highest quality materials along with turnkey bolting of TORKWORX, you can be confident the job will get advantages over the older induction meth- services performed by competent specially trained done right the first time to insure your outage or turn- ods. The XBM is lightweight, requires less bolting technicians. Our products and services in- around remains on schedule. Our goal is to increase power, requires no water , it’s simple to sure the fasteners in any bolted connection are operational safety and productivity while reducing operate and robust in construction. With worked in a controlled and safe manner. cost and downtime. the added advantage of heating up to 6 bolts, outage schedules are jump started reducing the overall outage schedule. extreme bolt working solutions for INDUSTRY SOLUTIONS TECHNOLOGY CONSULTING PROVIDES • TURNKEY BOLTING SERVICES petrochem/ refining A COMPLETE TURNKEY SOLUTION. ULTRASONIC BOLT LOAD • TECHNICAL DIRECTION ON-SITE BOLTING SERVICES VERIFICATION SERVICES New generation USM3 ultrasonic bolt • COMPLETE BOLTING TOOL PACKAGES TORKWORX takes the customer requirements into consideration when determining the absolute best load verification systems are capable • LONG TERM EQUIPMENT RENTALS methods to perform our specialty services. There is no universal solution. Our services are tailored to of measuring the actual bolt loads your specific requirements and performed with the utmost attention to SAFE, FUNCTIONAL, RELIABLE applied on each bolt for future report- • ULTRASONIC BOLT MEASUREMENT and EFFICIENT execution. ing thru computer based software.

• THERMAL BOLT HEATING SERVICES The solution confirms that each bolt in No matter of the size or type of plant, joint integrity is crucial to the overall plant safety and performance. the joint has been tightened to the • BOLTING CONSULTATION SERVICES Flange leaks cost money and require the careful attention provided by TORKWORX. target load. Eliminating all the guess work incurred with older analogue • 24 HOUR RESPONSE SERVICES We inventory the newest generation and most extensive range of hydraulic torque and tensioning tools, induction machines and related equipment. methods and increasing the traceabil- • EQUIPMENT REPAIR AND CALIBRATION ity of the application.

Turnaround and Outage scopes with a large or small range of bolted joints can benefit from our knowl- edge and experience. Combining our quality range of products and dedicated, highly trained staff provide our customers with the total on-site bolt working service, establishing customer confidence from initial contact forward to the safe completion of the job.

The quality equipment and the skilled experience of TORKWORX insures that your Plant Outages will 24 HOUR SUPPORT realize an immediate jump-start saving you time and money while providing a safer more effective SERVICES method for working critical fasteners. TORKWORX professionals are al- ON-SITE TRAINING SERVICES ways available either on the web or by phone. If you require immediate These technologies are suited for the following applications….. TORKWORX was built with a devotion to safety. As a response services, simply go online

leader in mechanical joint integrity solutions, the safe and and fill out our application form or call xHeat Exchangers proper operation of our technologies is priority to the mu- 1-888-502-WORX. We’ll are always xReactors ready to help and insure your job is tual success of TORKWORX and it’s customers. xPipe Flanges Done Right the First Time. On-site Training Services are a critical part of the safety xCompressors philosophy and further insures that our solutions are pro- xTurbines viding the absolute most effective results. xVessels SALES RENTAL SERVICE CONSULTING ENGINEERING

TORKWORX is a leader in providing equipment and manpower to en- sure competent and safe solutions for the controlled tightening and loosening of complex joints. Our quality product and services are delivered to the Oil & Gas, Power Generation, Petro/ Refining and Heavy Engineering industries.

TORKWORX is committed to offer our customers a complete single source for all their bolting require- ments, providing the best solutions to handle all complex bolting appli- cations. Through a comprehensive and extensive line of torque and tension products, TORKWORX cus- tomers are assured of the most competent and cost effective solu- ƚŝŽŶ͙Done right the first time.

8319 THORA LANE BLDG E2 SPRING, TX 77379 888.502.WORX ph 713-481-6220 fax www.torkworx.com 7RPRUURZ¶VWHFKQRORJ\DWZRUNIRU\RXWRGD\ PROVIDING YOUR OPERATION THE MOST ADVANCED SOLUTIONS FOR SUCCESS

TORKWORX is a leader in providing equipment and TORKWORX has introduced new generation ERAD manpower to insure competent and safe solutions for electrically powered digitally controlled torque sys- the controlled tightening and loosening of complex tems that increase productivity and reduce downtime joints. Our specialists deliver bolt working solutions by providing the operator with the ability to visually New generation ERAD systems are engi- derived using the most advanced technology and the confirm torque output as well as record the torque neered and designed to deliver the high- highest quality materials along with turnkey bolting data for future reporting. This continuous rotation, est power-to-weight ratio of any bolting services performed by competent specially trained torque control stall tool is faster, more accurate and tool on the market today, saving you time bolting technicians. Our products and services in- costs less to operate than older, less efficient bolting and money in maintenance or production sure the fasteners in any bolted connection are systems. costs. The extremely high torque and worked in a controlled and safe manner. constant rotation make our tools ideal for virtually any bolting application you will encounter. extreme bolt working solutions for WIND ENERGY SOLUTIONS wind energy TECHNOLOGY CONSULTING PROVIDES ‡(5$'',*,7$/72548(&21752/6<67(06 A COMPLETE TURNKEY SOLUTION. ‡(/(&75,&*($57851,1*6<67(06 New generation ERAD systems are ‡%$6( %/$'(%2/77(16,21,1*6<67(06 ON-SITE BOLTING SERVICES capable of recording the final torque output on each bolt for future reporting ‡7,7$1+<'5$8/,&:5(1&+6<67(06 HYDRAULIC TENSIONING SYSTEMS thru computer based software. The Our specialists deliver bolt working solutions derived solution confirms that each bolt in the ‡&203/(7(2(0%2/7,1*3$&.$*(6 using the most advanced technology and the most effi- TORKWORX Hydraulic Bolt Tensioning tools provide a quick, simple, accurate joint has been tightened to the target cient bolting processes. Through continuous and com- ‡7851.(<%2/7,1*6(59,&(6 and reliable solution for tightening critical bolted joints on today's modern wind load. Eliminating all the guess work petent training our bolting technicians are equipped with turbine, tower erection and maintenance applications. Standard & special designs incurred with older analogue bolting ‡72548(5(&+(&.6(59,&(6 all the knowledge and experience to increase your pro- are available to suit each particular bolting operation. systems and increasing the traceability ductivity, limit your downtime and deliver the peace of ‡%2/7,1*&2168/7$7,216(59,&(6 Finite Element Analysis, 3D solid model- of the application. PLQGWKDW\RXUDSSOLFDWLRQZDV« ing, combined with extensive testing and ‡+2855(63216(6(59,&(6 DONE RIGHT THE FIRST TIME! an engineering staff with hundreds of years ‡(48,30(175(3$,5$1'&$/,%5$7,21 2XUVHUYLFHVDUHFULWLFDOIRU« of combined experience in hydraulic bolt- ‡1HZ&RQVWUXFWLRQ3URMHFWV ing enables TORKWORX to provide ad- ‡%UHDN-In Maintenance Schedules vanced state-of-the- art tensioning solu- ‡6HPL-annual Maintenance Schedules tions giving superior performance and reli- ‡$QQXDO0DLQWHQDQFH6FKHGXOHV ability. ‡)RUFHG0DLQWHQDQFH2XWDJHV These technologies are suited for the fol- ORZLQJDSSOLFDWLRQ« TORKWORX professionals are al- ON-SITE TRAINING SERVICES ways available either on the web or x Blade Bolting by phone. If you require immediate TORKWORX was built with a devotion to safety. As a x Bearing to Hub Bolting response services, simply go online leader in mechanical joint integrity solutions, the safe x Tower Bolting and fill out our application form or call and proper operation of our technologies is priority to the x Foundation Bolting x Nacelle Frame Bolting 1-888-502-:25;:H¶OODUHDOZD\V mutual success of TORKWORX DQGLW¶VFXVWRPHUV x Hub to Spindle Bolting ready to help and insure your job is On-site Training Services are a critical part of the safety Done Right the First Time. philosophy and further insures that our solutions are providing the absolute most effective results. SALES RENTAL SERVICE CONSULTING ENGINEERING

TORKWORX is a leader in providing equipment and manpower to en- sure competent and safe solutions for the controlled tightening and loosening of complex joints. Our quality product and services are delivered to the Oil & Gas, Power Generation, Petro/ Refining and Heavy Engineering industries.

TORKWORX is committed to offer our customers a complete single source for all their bolting require- ments, providing the best solutions to handle all complex bolting appli- cations. Through a comprehensive and extensive line of torque and tension products, TORKWORX cus- tomers are assured of the most competent and cost effective solu- ƚŝŽŶ͙Done right the first time.

8319 THORA LANE BLDG E2 SPRING, TX 77379 888.502.WORX ph 713-481-6220 fax www.torkworx.com 7RPRUURZ¶VWHFKQRORJ\DWZRUNIRU\RXWRGD\ PROVIDING YOUR OPERATION THE MOST ADVANCED SOLUTIONS FOR SUCCESS

TORKWORX is a leader in providing equipment and Through years of on-site experience, TORKWORX manpower to insure competent and safe solutions for has identified and preassembled torque tooling pack- the controlled tightening and loosening of complex ages for your turbine outage. Gas or steam pack- joints. Our specialists deliver bolt working solutions ages for all turbine models and makes are complete New generation XBM thermal bolt heat- derived using the most advanced technology and the with every hydraulic wrench, power pack, heavy duty ing systems from Xtreme Bolting have highest quality materials along with turnkey bolting socket and hammer wrench to needed to success- many advantages over the older induc- services performed by competent specially trained fully complete. We inventory an extensive fleet of tion methods. The XBM is lightweight, bolting technicians. Our products and services in- both specialty and standard tooling for all critical requires less power, requires no water , sure the fasteners in any bolted connection are bolting applications insuring increased productivity LW¶VVLPSOHWRRSHUDWHDQGUREXVWLQFRQ worked in a controlled and safe manner. accelerating your outage schedule. struction. With the added advantage of heating up to 6 bolts, outage schedules are jump started reducing the overall outage schedule.

POWER GENERATION SOLUTIONS extreme bolt working solutions for ‡&203/(7(2(0%2/7,1*3$&.$*(6 power generation TECHNOLOGY CONSULTING PROVIDES A COMPLETE TURNKEY SOLUTION. ‡7,7$1+<'5$8/,&:5(1&+6<67(06

‡$'9$1&('%2/77(16,21,1*6<67(06 New generation USM3 ultrasonic bolt ON-SITE BOLTING SERVICES load verification systems are capable ‡5$'31(80$7,&:5(1&+6<67(06 HYDRAULIC TENSIONING SYSTEMS of measuring the actual bolt loads

‡+<'5$8/,&:5(1&+62&.(7.,76 Our specialists deliver bolt working solutions derived TORKWORX Hydraulic Bolt Tensioning tools provide a quick, simple, accurate applied on each bolt for future report- using the most advanced technology and the most effi- and reliable solution for tightening critical bolted joints on today's modern wind ing thru computer based software. ‡7+(50$/%2/7+($7,1*6(59,&(6 cient bolting processes. Through continuous and com- turbine, tower erection and maintenance applications. Standard & special designs The solution confirms that each bolt in ‡7851.(<%2/7,1*6(59,&(6 petent training our bolting technicians are equipped with are available to suit each particular bolting operation. the joint has been tightened to the all the knowledge and experience to increase your pro- target load. Eliminating all the guess ‡785%,1(&$6,1*&/2685(6<67(06 Finite Element Analysis, 3D solid modeling, ductivity, limit your downtime and deliver the peace of work incurred with older analogue combined with extensive testing and an PLQGWKDW\RXUDSSOLFDWLRQZDV« methods and increasing the traceabil- ‡8/75$621,&%2/7/2$D VERIFICATION engineering staff with hundreds of years of DONE RIGHT THE FIRST TIME! ity of the application. ‡+2855(63216(6(59,&(6 combined experience in hydraulic bolting enables TORKWORX to provide advanced 2XUVHUYLFHVDUHFULWLFDOIRU« ‡(48,30(175(3$,5$1'&$/,%5$7,21 state-of-the- art tensioning solutions giving ‡1HZ&RQVWUXFWLRQ3URMHFWV superior performance and reliability. ‡7RSV2Q7RSV2II$OLJQPHQW ‡6FKHGXOHG0DLQWHQDQFH2XWDJHV ‡)RUFHG0DLQWHQDQFH2XWDJHV These technologies provide the following YDOXDEOHEHQHILWV«« ON-SITE TRAINING SERVICES x Reduction of outage schedule TORKWORX professionals are al- Easy to use²quick setup and removal ways available either on the web or TORKWORX was built with a devotion to safety. As a x x Improvement in safety by phone. If you require immediate leader in mechanical joint integrity solutions, the safe x Improvement in accuracy and precision response services, simply go online and proper operation of our technologies is priority to the x Delivers leak free start-up and fill out our application form or call mutual success of TORKWORX DQGLW¶VFXVWRPHUV x Reduction in physical effort 1-888-502-:25;:H¶OODUHDOZD\V On-site Training Services are a critical part of the safety ready to help and insure your job is philosophy and further insures that our solutions are Done Right the First Time. providing the absolute most effective results. titan lp-series hydraulic wrench systems

TITAN LP-SERIES Hydraulic Torque Wrenches are engineered and manufactured for maximum compatibility with competitive systems. This fea- ture gives the customer freedom of choice when upgrading their system. ALL similarities end there.

Every component has been engineered to out perform our competitors. The Titan LP-Series Hydraulic Torque Wrench Systems provide accu- rate and versatile torque loading of bolts and extreme bolt working solutions studs whilst being fast, simple and safe to use. Produced from high strength, lightweight alloys, TORKWORX delivers the quality tooling required to shorten Titan Hydraulic Wrenches are made in standard outages and save millions in downtime. TORKWORX customers configurations to accommodate ANSI and API DUHDVVXUHGRIWKHPRVWFRPSHWHQWDQGFRVWHIIHFWLYHVROXWLRQ« standard flanges. Done right the first time.. Titan Hydraulic Wrenches use high pressure hy- draulics to torque the bolt to the exact load re- quired. Any number of Titan Hydraulic Wrenches can be ported to the same hydraulic power pack to provide even amounts of simultaneous torque over multiple studs or bolts as required. patented advancements

200% Stronger than the major competitor: Tougher materials with superior technology SALES designs shaped for strength instead of hype make RENTAL TITAN tools twice as durable. ‡8QLTXH5DWFKHW7RRWK'HVLJQIRUVXSHULRUGXUDELOLW\DQGDFFXUDF\ SERVICE ‡)LQHO\&UDIWHGRIWKHKLJKHVWTXDOLW\$LUFUDIW*UDGH0DWHULDOV CONSULTING Tite-/RFNUHDFWLRQDUPVŒ$XWRPDWLFV\VWHPWRVHFXUHWKHWRUTXH ‡5DWFKHWLQJ$VVXUDQFH0HFKDQLVPIRUKDQGVIUHHVDIHW\ DUPWRWKHFKDVVLVRIWKHPDFKLQH‡0XOWL-position ‡6OHHN'HVLJQDIIRUGV(DV\)LWRQWKHWLJKWHVWEROWSDWWHUQV ENGINEERING torque arm. ‡8QLTXH³:LGH7UDFN´5DWFKHW3DZO0HFKDQLVPGLVWULEXWHVVWUHVV better than other designs for longer tool life and reduced repair costs (QHUJ\GLVSHUVLRQV\VWHPŒ$SDWHQWHGV\VWHPDOORZLQJWKHGLV ‡&RPSDUDEOHZLGWKOLQNDQGF\OLQGHUGXHWRRYDOSLVWRQGHVLJQ persion of kinetic energy from the ratchet Piston-Assembly ‡$OXPLQXP-bronze drive bushings to reduce friction XQLWGXULQJFRPSOH[XQWLJKWHQLQJ‡(OLPLQDWHVWKHGHVWUXFWLRQRI ‡7LJKW5DGLXV/LQNFDVVHWWHVHQJLQHHUHGIURP)($ caps, piston rods and of ratchet assembly interface ‡³6HW%DFN´&\OLQGHU'HVLJQJLYHVWKHDFFHVVLELOLW\RIQRQ-holding with the piston rod. pawl tools with the advantages of a holding pawl. 8319 THORA LANE ‡³+DQGV-IUHH´RSHUDWLRQZLWKDVLQJOHRSHUDWRU BLDG E2 ‡5DWFKHWZLWKODUJHWHHWKWRDYRLGWKHFODVVLFUROOLQJRIVPDOOWHHWK SPRING, TX 77379 Tru-6ZLYHOŒ8QLTXHSDWHQWHGK\GUDXOLFWXUUHWSUHYHQWLQJDQ\ 888.502.WORX ph breakage of flexible hoses under pressure as well as any ‡'LVHQJDJHPHQWV\VWHPLQWHJUDWHGLQWKHPHFKDQLVP 713-481-6220 fax twisting of hydraulic hose during operations. ‡7LJKWHQLQJSUHFLVLRQRI- 3% www.torkworx.com ‡ƒPD[LPXPURWDWLRQSHUF\FOH

extreme low profile hydraulic wrench solutions

TITAN delivers a higher value to the customer through superior products, outstanding service, along with innovative engineering support and leading edge customer driven technologies CUSTOM SOLUTIONS Titan LP-series wrenches are highly extreme bolt working solutions adaptable for all critical bolting appli- for extreme applications cations. Reaction extensions, direct hex drives and custom solutions are always available for our extensive fleet of quality hydraulic wrench systems

ONLINE SUPPORT All of our products come complete with operations manuals and sup- port documentation. If ever mis- placed,, this important information

data may change without notice as engineering requirements dictate. can be found electronically on our TITAN MODEL NUMBER LP2 LP4 LP8 LP16 LP32 website. Just go to torkworx.com DQG FOLFN RQ WKH ³'RFXPHQWDWLRQ´ 3/4" to 2-3/8" 7/8" to 3-3/8" 1-1/2" to 4-1/8" 1-7/8" to 4-5/8" 2-1/2" to 6-1/8" RANGE OF HEX SIZES A/F 19 to 65 mm 22 to 85 mm 35 to 110 mm 20 to 40 mm 55 to 70 mm tab.

MIN FT-LBS 200 400 800 1600 3500

MAX FT-LBS 2000 4000 8000 16000 35000 24 HOUR SUPPORT SERVICES CERTIFIED TORQUE ACCURACY +/-3% +/-3% +/-3% +/-3% +/-3% TORKWORX professionals are al- CYLINDER WEIGHT 3.45 5.80 10.20 15.5 25 ways available either on the web or RANGE OF LINK WEIGHT (lbs) 2.20 to 3.50 5.25 to 7.5 11.4 to 14.1 19.7 to 27.6 27 to 39.4 by phone. If you require immediate response services, simply go online TITAN TRU-6:,9(/Œ DUAL AXIS DUAL AXIS DUAL AXIS DUAL AXIS DUAL AXIS and fill out our application form or (1(5*<',63(56(0(176<67(0Œ call 1-888-502-:25;  :H¶OO DUH MAXIMUM REACTION REACH [L1] 7.0" 8.413" 11.312" 14" 16" always ready to help and insure OVERALL LENGTH [L2] 8.9" 10.7" 14.275" 17.95 19.25" your job is Done Right the First Time. BOLT CENTER TO TOP [H1] 3.865" 4.775" 6.168" 7.25" 10.5"

BACK END HEIGHT [H2] 3.45" 3.785" 6.05" 2.35" 2.55" 8319 THORA LANE BLDG E2 TOOL WIDTH AT LINK [W1] 1.25" 1.625" 2.1" 2.35" 2.55" SPRING, TX 77379 888.502.WORX ph TOOL WIDTH AT CYLINDER [W2] 1.25" 1.625" 2.1" 2.45" 2.8" 713-481-6220 fax www.torkworx.com BOLT CENTER TO END OF LINK [R] 1.030" to 1.751" 1.312" to 2.302" 1.725 to 2.952" 1.95" to 3.5" 2.5" to 4.75" titan t-series hydraulic wrench systems

TITAN T-SERIES Hydraulic Torque Wrenches are engineered and manufactured for maximum com- patibility with competitive systems. This feature gives the customer freedom of choice when up- grading their system. ALL similarities end there.

Every component has been engineered to out perform our competitors. The Titan T-Series Hy- draulic Torque Wrench Systems provide accurate and versatile torque loading of bolts and studs extreme bolt working solutions whilst being fast, simple and safe to use. Pro- duced from high strength, lightweight alloys, Titan TORKWORX delivers the quality tooling required to shorten Hydraulic Wrenches are made in standard con- outages and save millions in downtime. TORKWORX customers figurations to accommodate ANSI and API stan- DUHDVVXUHGRIWKHPRVWFRPSHWHQWDQGFRVWHIIHFWLYHVROXWLRQ« dard flanges. Done right the first time.. Titan Hydraulic Wrenches use high pressure hy- draulics to torque the bolt to the exact load re- quired. Any number of Titan Hydraulic Wrenches can be ported to the same hydraulic power pack to provide even amounts of simultaneous torque over multiple studs or bolts as required. patented advancements

200% Stronger than the major competitor: Tougher materials with superior technology SALES designs shaped for strength instead of hype make RENTAL TITAN tools twice as durable. ‡0XOWL-D[LVƒ[ƒ SERVICE ‡6TXDUHGULYHRIWR CONSULTING Tite-/RFNUHDFWLRQDUPVŒ$XWRPDWLFV\VWHPWRVHFXUHWKHWRUTXH ‡5DQJHIURP)7/%6WR)7/%6 DUPWRWKHFKDVVLVRIWKHPDFKLQH‡0XOWL-position ‡2QH-piece chassis without welds and a steel piston chamber ENGINEERING torque arm. ‡)RXUPHFKDQLFDOPRYLQJSDUWV GHFLVLYHVDIHW\DGYDQWDJH ‡³+DQGV-IUHH´RSHUDWLRQZLWKDVLQJOHRSHUDWRU (QHUJ\GLVSHUVLRQV\VWHPŒ$SDWHQWHGV\VWHPDOORZLQJWKHGLV ‡5DWFKHWZLWKODUJHWHHWKWRDYRLGWKHFODVVLFUROOLQJRIVPDOOWHHWK persion of kinetic energy from the ratchet Piston-Assembly ‡'LVHQJDJHPHQWV\VWHPLQWHJUDWHGLQWKHPHFKDQLVP XQLWGXULQJFRPSOH[XQWLJKWHQLQJ‡(OLPLQDWHVWKHGHVWUXFWLRQRI ‡6TXDUHGULYHZLWKVSOLQHVIRUDEHWWHUVWUHVVGLVWULEXWLRQ caps, piston rods and of ratchet assembly interface ‡$ELOLW\WRXVHWKHWRROZLWKRXWDUHDFWLRQDUP with the piston rod. ‡7LJKWHQLQJSUHFLVLRQRI- 3% 8319 THORA LANE ‡ƒPD[LPXPURWDWLRQSHUF\FOH BLDG E2 ‡7RWDOWUDFHDELOLW\RIFRQVWLWXHQWPDWHULDOVRIWKHPDFKLQH )0( SPRING, TX 77379 Tru-6ZLYHOŒ8QLTXHSDWHQWHGK\GUDXOLFWXUUHWSUHYHQWLQJDQ\ 888.502.WORX ph breakage of flexible hoses under pressure as well as any ‡3URGXFWZLWK$OXPLQXP$4DHURQDXWLFTXDOLW\FKDVVLV 713-481-6220 fax twisting of hydraulic hose during operations. ‡,QVWRFNRQWKHVKHOI www.torkworx.com extreme square drive hydraulic wrench solutions

TITAN delivers a higher value to the customer through superior products, outstanding service, along with innovative engineering support and leading edge customer driven technologies CUSTOM SOLUTIONS Titan T-series wrenches are highly extreme bolt working solutions adaptable for all critical bolting appli- for extreme applications cations. Reaction extensions, direct hex drives and custom solutions are always available for our extensive fleet of quality hydraulic wrench systems

ONLINE SUPPORT All of our products come complete with operations manuals and sup- port documentation. If ever mis- data may change without notice as engineering requirements dictate. placed,, this important information TITAN MODEL NUMBER T .5 T 1 T 3 T 5 T 8 T 10 T 20 T 25 T 50 can be found electronically on our SQUARE DRIVE SIZE 1/2" 3/4" 1" 1-1/2" 1-1/2" 1-1/2" 2-1/2" 2-1/2" 2-1/2" website. Just go to torkworx.com MIN FT-LBS 55 140 300 565 800 1,150 2,000 2,550 5,500 DQG FOLFN RQ WKH ³'RFXPHQWDWLRQ´ tab. MAX FT-LBS 410 1,400 3,100 5,675 8,800 11,500 20,000 25,500 57,750 CERTIFIED TORQUE ACCURACY 3% 3% 3% 3% 3% 3% 3% 3% 3% 24 HOUR SUPPORT HOUSING DESIGN =(52'()/(&7,21Œ!!!!!!!!!! SERVICES TITE-/2&.Œ5($&7,21$50 <<<<<<<<<< INTERCHANGEABLE UNIVERSAL 360 DEGREES >>>>>>>>>> TORKWORX professionals are al- ways available either on the web or TITAN TRU-6:,9(/Œ DUAL AXIS DUAL AXIS DUAL AXIS DUAL AXIS DUAL AXIS DUAL AXIS DUAL AXIS DUAL AXIS DUAL AXIS by phone. If you require immediate (1(5*<',63(560(176<67(0Œ response services, simply go online WEIGHT LBS 1.8 4.5 10.0 16.8 24.7 29.9 52.0 67.8 119 and fill out our application form or call 1-888-502- Drive Radius [R1] 0.65 0.98 1.13 1.56 1.76 1.95 2.32 2.6 3.18 :25;  :H¶OO DUH always ready to help and insure Drive to R/Arm [R2] 2.59 3.85 5.33 6.15 6.69 7.69 9.23 10.25 12.7 your job is Done Right the First Length [L1] 3.03 4.81 6.29 7.1 7.7 8.8 10.1 11.8 13.88 Time. Overall Length [L2] 4.95 6.95 9.59 11.22 12.57 13.89 16.67 18.52 23 Height [H1] 3.02 3.63 4.93 5.75 6.5 7.84 8.9 9.6 11.5 8319 THORA LANE BLDG E2 Overall Height [H2] 4.25 7.95 6.75 7.71 8.49 9.11 10.22 11.55 12.75 SPRING, TX 77379 Width (Tool Head) [W1] 1.98 2.63 3.15 3.57 3.95 4.73 5.25 6.56 888.502.WORX ph 1.32 713-481-6220 fax Width + Sq. Drive [W2] 1.88 2.86 3.89 4.65 5.09 5.61 6.74 7.48 9.2 www.torkworx.com extreme hydraulic bolt tensioning systems

TORKWORX is a leader in providing equipment and manpower to insure competent and safe solu- tions for the controlled tightening and loosening of complex joints. Our quality product and services are delivered to the Oil & Gas, Power Generation, Wind Energy and Heavy Engineering industries.

TORKWORX hydraulic bolt tensioning tools pro- vide a quick, simple, accurate and reliable solu- tion for tightening critical bolted joints on to- day's modern wind turbine, tower erection and maintenance applications. Standard & special TORKWORX delivers the quality tooling required to shorten designs are available to suit each particular bolt- outages and save millions in downtime. TORKWORX customers ing operation. DUHDVVXUHGRIWKHPRVWFRPSHWHQWDQGFRVWHIIHFWLYHVROXWLRQ« Done right the first time.. Hydraulic bolt tensioners use high pressure hy- draulics to stretch the bolt to the exact load re- quired. Any number of hydraulic bolt tensioners can be ported to the same hydraulic power pack to provide even amounts of simultaneous load over multiple studs or bolts as required.

Finite Element Analysis, 3D solid modeling, combined with exten- sive testing and an engineering staff with hundreds of years of combined experience in hydraulic bolting enables TORKWORX to x Optimal size, weight and load capacity for ease of use provide advanced state-of-the- art tensioning solutions giving su- x Durable Ǧ minimum 10,000 pressure cycles on all designs perior performance and reliability. x CE marked. Conforms to international standards. x Comprehensive health and safety operations and maintenance Multi-stage tensioner systems provide increased output forces in a manuals smaller diameter load cell. This advancement makes the solution x Safe and ideal ± for use in confined spaces much more effective in tighter, confined bolt patterns. x Lower total cost of ownership x Fast and easy to use Gear drive nut rotation feature delivers an easy, effective method x Pressure tested and certified for turning the nut while the tensioner is actuated while decreasing x Standard & custom tooling available the outside diameter of the tooling allowing it to fit on more critical 8319 THORA LANE x Highly visible maximum stroke indicator BLDG E2 applications x Captive socket and quick release bridge options SPRING, TX 77379 x Optional robust gear drive for fast nut run down 888.502.WORX ph High pressure electric powered tensioner pumps are now available 713-481-6220 fax for remote areas short on air supply. Requires 20 amp service x Optional stud puller rotator www.torkworx.com and can provide up to 30,000 PSI of hydraulic pressure in the sys- x Electric tensioner pumps, plus a full range of 1500 bar and flexible tem. hoses and fittings extreme bolt tensioning solutions

Torkworx delivers a higher value to the customer through superior products, outstanding service, along with innovative engineering support and leading edge customer driven technologies CUSTOM SOLUTIONS extreme bolt working solutions Torkworx provides custom engi- for extreme applications neered solutions for the toughest bolting applications. Using Finite TORKWORX delivers the newest generation in topside tensioning systems. Using modern com- Element Analysis along with 3D puter-aided drafting and engineering, finite element stress analysis along with cyclical testing, guar- modeling insures our systems fit and antees all our tensioners are built with safety, reliability and performance in mind. operate properly while providing the BOLTING SOLUTIONS FOR The piston stroke indicator allows the stroke to be viewed, measured and controlled. An automatic most effective method possible relief valve is built into every tensioner that bleeds the fluid back into the system and prevents over BLADE BOLTING stroke and ultimate seal damage. ONLINE SUPPORT BEARING TO HUB BOLTING The forces generated by tensioners enable them to be used on bolts under considerable con- All of our products come complete straints and are ideal in limited access areas. Although lighter and more compact than our competi- TOWER BOLTING tors, tensioners exert more enormous force and is produced from highly resistant alloys. TORK- with operations manuals and sup- WORX understands the importance of timely execution and rigorously tests every suite prior to port documentation. If ever mis- FOUNDATION BOLTING delivery to insure reliable performance over time. placed,, this important information NACELLE FRAME BOLTING TORKWORX inventories an extensive fleet of tensioners for sale or rent. The tensioner is perfect can be found electronically on our for single size applications and are interconnected for simple and fast joint completion. website. Just go to torkworx.com HUB TO SPINDLE BOLTING DQG FOLFN RQ WKH ³'RFXPHQWDWLRQ´ WIND TURBINE FOUNDATION PETROCHEM REACTOR HEAD tab.

24 HOUR SUPPORT SERVICES TORKWORX professionals are al- ways available either on the web or by phone. If you require immediate response services, simply go online and fill out our application form or call 1-888-502-:25;  :H¶OO DUH always ready to help and insure your job is Done Right the First Time.

8319 THORA LANE BLDG E2 SPRING, TX 77379 :(¶9(:25.(',1$//7<3(62)+($9<,1'8675<0$5.(76+2:&$1:(+(/3<28" 888.502.WORX ph extreme bolt working solutions for all industry types are available from one complete solutions based company...TORKWORX 713-481-6220 fax www.torkworx.com ERAD electronic torque control systems

ERAD electronic torque control systems are engi- neered and manufactured for maximum durability and performance. They are the world’s most ad- vanced electronic pistol grip stall type torque wrench ever produced. Designed to provide con- tinued accuracy and repeatability using the RAD legendary gear box design and the precision of electronic motor. Capable of collecting torque data, measuring torque an angle and accurate to +/- 3%. extreme bolt working solutions All RAD torque guns are designed to deliver the TORKWORX delivers the quality tooling required to shorten highest power-to-weight ratio of any torque tool on outages and save millions in downtime. TORKWORX customers the market today, saving time and money in main- are assured of the most competent and cost effective solution… tenance and production costs. The extremely Done right the first time.. high torque and constant rotation make the RAD model ideal for virtually and bolting application you will encounter. Equal power in both forward and reverse allows more diversity for tough main- tenance jobs. extreme advancements

LIGHTER: Combining the latest advancements in ergonomic de- superior technology S A L E S sign along with an ultra-durable portable carrying case, the ERAD RE N T A L series torque system is a lightweight alternative to older antiquated • Push-button select torque - Fast and convenient error-free digital S E RV I CE bolting systems. single increment torque settings CONSULTING

FASTER: Compared to older conventional torque systems the ERAD • Lightweight and Ergonomic pistol grip design - Advanced low- ENGINEERING series electronic torque control system decreases operation time by profile handle to reduce operator fatigue and increase productiv- up to 60% through the delivery of continuous torque, boosting your ity productivity and increasing the speed of job completion. • Extremely low noise level only 75db - World’s quietest extreme STONGER: Unsurpassed power-to-weight ration and the legen- torque gun, ideal for sensitive environments and standards dary patented gearbox design insure the ERAD series offers the highest dependability and reliability in the industry. • LED Green (Pass) or Red (Fail) indicator lights - Unmistakable 8319 THORA LN visual signal indicates status of torque procedure for maximum BLDG E2 QUIETER: The E-RAD electronic torque system operates at 75 db accuracy and speed SPRING TX 77379 USA reducing the noise level considerably from other traditional torque 888.502.WORX ph systems. Along with exceptionally low vibration levels and its pis- 713-481-6220 fax • Data collection capability - All ERAD Series tools come com- www.torkworx.com tol grip style design, the E-RAD makes ergonomic sense. plete with data collection software allowing traceability of each torque sequence performed extreme electronic torque control solutions ER AD EL EC T R O N I C T O R Q U E W R EN C H SY ST EM S W I T H D A T A C O L LEC T I O N

RAD continues to invest in and employ the latest technologies to achieve the highest level of inno- vation, quality, and performance.

CUSTOM SOLUTIONS extreme bolt working solutions Torkworx provides custom engi- for extreme applications neered solutions for the toughest bolting applications. Using Finite Element Analysis along with 3D modeling insures our systems fit and operate properly while providing the most effective method possible

ONLINE SUPPORT All of our products come complete with operations manuals and sup- port documentation. If ever mis- placed,, this important information can be found electronically on our website. Just go to torkworx.com and click on the “Documentation” tab.

24 HOUR SUPPORT SERVICES TORKWORX professionals are al- ways available either on the web or by phone. If you require immediate response services, simply go online and fill out our application form or PART TOOL DRIVE LOW HIGH WEIGHT DIMENSION A DIMENSION B DIMENSION C DIMENSION D NO. MODEL SIZE RANGE RANGE (LBS) call 1-888-502-WORX. We’ll are 14991 ERAD 700 0.75” 100 700 12 13.25” 2.5” 3.0” 8.25” always ready to help and insure 12313 ERAD1200 1.0” 200 1200 15 13.90” 3.0” 3.0” 8.25” your job is Done Right the First 12314 ERAD2000 1.0” 250 2000 18 14.33” 3.0” 3.5” 8.75” Time. ERAD2500 15710 1.0” 250 2500 18 14.80” 3.0” 3.0” 8.25” COMP 8319 THORA LANE 12703 ERAD3000 1.0” 500 3000 23.5 16.75” 3.4” 3.5” 8.75” BLDG A. SPRING, TX 77379 USA 13992 ERAD4000 1.5” 800 4000 31 17.75” 4.0” 3.5” 8.75” 888.502.WORX ph 15952 ERAD6000 1.5” 1500 6000 29 16.50” 4.0” 3.5” 8.75” 713-481-6220 fax www.torkworx.com data may change without notice as engineering requirements dictate extreme video monitoring system

TORKWORX is a leader in providing equipment and manpower to insure competent and safe solu- tions for the controlled tightening and loosening of complex joints. Our quality product and services are delivered to the Oil & Gas, Power Generation, Wind Energy and Heavy Engineering industries.

TORKWORX has further expanded its product offerings at the request of its valued customers to include application driven measuring and monitor- extreme monitoring solutions ing equipment.

TORKWORX delivers the quality tooling required to shorten The Hawkeye Video Borescope System is an ad- outages and save millions in downtime. TORKWORX customers vanced monitoring system proven to withstand the are assured of the most competent and cost effective solution… rugged environments as seen in our specialty in- Done right the first time.. dustries while maintain quality and competent benefits and features.

Through rigorous testing on real life applications the Hawkeye Video Borescope System has b come the preferred system of customers with the most critical applications.

The new Hawkeye Flexible Video Borescopes are the perfect Optimal size and weight for ease of use choice when portability, and easy image capture, are key factors. Large 2GB SD Card slot for data transport These high-quality, affordably priced video borescopes are much Holds 1000 images or 2 hours of video more durable than fiber optic borescopes, low cost, and com- CE marked. Conforms to international standards. pletely portable. Comprehensive health and safety operations and maintenance manuals They are 0-, 2- or 4-way articulating, and come complete with Safe and ideal – for use in confined spaces video monitor and light source, all in one easy-to-use device. The Lower total cost of ownership Hawkeye Pro and Classic Flexible Video Borescopes are 4 mm, 6 mm or 8 mm in diameter, with either tungsten or gooseneck Fast and easy to use sheaths, and available in lengths of 1.5 and 3.0 meters. Custom Standard & custom systems available 8319 THORA LANE lengths up to 6.0 meters available upon request Highly visible 3.5” LCD Screen BLDG E2 Capture photo with one touch button SPRING, TX 77379 888.502.WORX ph 713-481-6220 fax www.torkworx.com extreme video monitoring solutions

Our patented endoGRINS® gradient-index lens tech- nology is built into our exclusive line of Hawkeye® Precision Borescopes. This innovative optical design allows Hawkeye borescopes to deliver excellent image quality at prices one-third that of comparable visual inspection instruments. CUSTOM SOLUTIONS extreme video monitoring solutions Torkworx provides custom engi- for extreme applications neered solutions for the toughest bolting applications. Using Finite TORKWORX delivers the newest generation in video monitoring sys- tems. Exceptional value and versatility are the hallmarks of the Hawk- Element Analysis along with 3D eye and Luxxor Lighting and Video visual inspection products. leading modeling insures our systems fit and edge companies are using Hawkeyes to improve their products and quality, streamline their processes, and gain a competitive advantage. operate properly while providing the most effective method possible Hawkeye Video Borescope Specifications: Diameter ...... 4, 6 or 8 mm ONLINE SUPPORT Lengths ...... 1.5, 3, and 6 meters All of our products come complete Articulation ...... 130º Up/Down, 110º Right/Left with operations manuals and sup- Field-of-View …...... 50º port documentation. If ever mis- Direction-of-View (4mm scopes) …...... 0º placed,, this important information can be found electronically on our Direction-of-View ( 6 & 8mm ) ...... 0º, 90º with mirror tip website. Just go to torkworx.com Sheath - Pro ( 4 & 6mm ) ...... Tungsten and click on the “Documentation” Sheath - Clasic ( 8 mm ) ...... Gooseneck tab. Illumination Micro ...... LED with intensity adjustment Display ...... 3.5” TFT LCD 24 HOUR SUPPORT SERVICES Interfaces ...... Mini USB 1.1 and AV/out TORKWORX professionals are al- Power ...... DC 5V ways available either on the web or Battery ...... 2.5 hr. run time, Rechargeable Lithium by phone. If you require immediate Recording Media ……. SD card (1GB incl, up to 8GB avail) response services, simply go online and fill out our application form or Digital Photo Format ...... JPEG (640 X 480) call 1-888-502-WORX. We’ll are Video Format: ASF (320 X 240) ...... Playback with always ready to help and insure Windows Media Player your job is Done Right the First Time.

8319 THORA LANE BLDG E2 SPRING, TX 77379 WE’VE WORKED IN ALL TYPES OF HEAVY INDUSTRY MARKETS. HOW CAN WE HELP YOU? 888.502.WORX ph 713-481-6220 fax extreme bolt working solutions for all industry types are available from one complete solutions based company...TORKWORX www.torkworx.com superior repair and calibration services

TORKWORX is a leader in providing equipment and manpower to insure competent and safe solu- tions for the controlled tightening and loosening of complex joints. Our quality product and services are delivered to the Oil & Gas, Power Generation, Wind Energy and Heavy Engineering industries.

TORKWORX provides accurate and affordable NIST traceable (National Institute of Standards and Technology) calibration services for all hy- extreme calibration services draulic, pneumatic and manual torque wrenches TORKWORX delivers the quality certified calibration services to up to 50,000 ft/lbs as well as pressure gauges up insure precision torque tooling is performing properly. to 30,000 PSI.

TORKWORX customers are assured of the most competent and Our professionally trained staff works with the cost effective solution… Done right the first time.. most advanced calibration equipment so you can count on precise results and timely turnarounds. Our repair technicians can perform any required repairs on any make and model torque tooling on the market.

extreme advancements superior technology S A L E S RE N T A L Overtime the alloys which tools and gauges are produced from  State-of-the-art Digitally Controlled Calibration Systems S E RV I CE  Hydraulic wrench calibrations to 50,000 ft/lbs can become distorted or worn. These changes can affect the CONSULTING  Pneumatic wrench calibration to 10,000 ft/lbs torque output of precision torque tooling and the readings of preci- ENGINEERING sion gauges. TORKWORX understands the importance of tooling  Electric wrench calibration to 10,000 ft/lbs accuracy and the effect it has on productivity. We insure every  Manual wrench calibration to 2,000 ft/lbs precision torque tool is properly inspected and repaired for opti-  Multiplier certification to 10,000 PSI mum torque output.  Gauge calibration to 30,000 PSI  Certified calibration documents to NIST standards  Tool specific 100 Point Torque Conversion Charts By calibrating the system, we can insure that these outputs are  Affordable repair and inspection services 6717 KLEIN CEMETERY ROAD accurate and repeatable. This important service provides confi-  Quick and timely turnaround BDLG A dence in the tooling system being used for the critical bolting appli-  Scheduled automated reminders of calibration due dates SPRING, TX 77379 cation and further validates the systems ability to perform. 888.502.WORX ph  ISO 17001 certification pending 713-481-6220 fax www.torkworx.com quality repair and calibration services ADVANCED REPAIR AND CALIBRATION SERVICES

Torkworx delivers a higher value to the customer through supe- rior products, outstanding service, along with innovative engi- neering support and leading edge customer driven technologies

CUSTOM SOLUTIONS certified calibration Torkworx provides custom engi- for extreme applications neered solutions for the toughest bolting applications. Using Finite TORKWORX utilizes the newest generation in cer- Element Analysis along with 3D tified calibration systems. Every tool we repair and calibrate is insured to operate and perform to the modeling insures our systems fit and maximum output with repeatable precision. Addi- operate properly while providing the tionally, every detailed certificate is traceable to most effective method possible NIST standards. Our calibration systems are re- certified annually by an independent NVLAP to in- sure proper reading are always delivered. ONLINE SUPPORT All of our products come complete with operations manuals and sup- Why do torque tools and gauges require calibra- port documentation. If ever mis- tion? placed,, this important information Many companies make the mistake of assuming can be found electronically on our their torque tools and gauges are accurate and in website. Just go to torkworx.com good working order. They also assume factory and click on the “Documentation” torque charts are accurate for their specific tooling and that a certified gauge ensures tool accuracy. tab. But assuming only leads to inconsistent joint com- pletion, wasted money and the risk of failure with 24 HOUR SUPPORT possible EHS concerns. SERVICES Through our experience we have realized that the TORKWORX professionals are al- same make and model wrenches will in fact perform ways available either on the web or differently and factory torque conversion charts are by phone. If you require immediate only a general guideline. By calibrating each tool response services, simply go online and providing a tool specific torque conversion chart, an immediate increase in torque accuracy is and fill out our application form or realized. This advantage ultimately delivers a more call 1-888-502-WORX. We’ll are confident joint completion while minimizing always ready to help and insure your job is Done Right the First Time.

6717 KLEIN CEMETERY ROAD BLDG A SPRING, TX 77379 WE’VE WORKED IN ALL TYPES OF HEAVY INDUSTRY MARKETS. HOW CAN WE HELP YOU? 888.502.WORX ph 713-481-6220 fax extreme bolt working solutions for all industry types are available from one complete solutions based company...TORKWORX www.torkworx.com