6Wdwhphqw Rq Wkh Vxepdulqh +06 7Luhohvv

Total Page:16

File Type:pdf, Size:1020Kb

6Wdwhphqw Rq Wkh Vxepdulqh +06 7Luhohvv 63((&+ 7KH5W+RQ&KULV3DWWHQ Commissioner for External Relations 6WDWHPHQW RQ WKH VXEPDULQH +06 7LUHOHVV Plenary Session of the European Parliament 6WUDVERXUJWK'HFHPEHU 2SHQLQJ6SHHFK First, let me associate myself and the Commission with the remarks made by the Hon. Member Mr Galeote and others on the murder of the democratically elected councillor, Sr Francisco Cano. I extend my condolences to his family and I salute the courage of all those in Spain who stand up to the evil of terrorism in all its cowardly and vicious manifestations. Only yesterday we received in this chamber representatives of Basta Ya, who won this year’s Sakharov prize; I agreed with everything they said. I am grateful to the Honourable Members for their questions, to which I am responding on behalf of Commissioner Wallström. Mrs Wallström regrets that she cannot be here to answer the questions on HMS TIRELESS in person because she is engaged in meetings in Brussels to prepare for next week’s important Ministerial meeting on climate change. Honourable Members have asked a number of questions relating to the presence of the British nuclear submarine HMS TIRELESS in Gibraltar for repairs to her nuclear reactor. I know – the Commission knows – how concerned they are about this issue. Honourable Members have asked if the Commission considers that directives 89/618/Euratom on ,QIRUPLQJWKH3XEOLFLQWKH(YHQWRI5DGLRORJLFDO(PHUJHQF\and 96/29/Euratom on %DVLF 6DIHW\ 6WDQGDUGV apply in relation to the submarine, and what steps have been taken accordingly. Honourable Members have also asked a question concerning Article 37 of the Euratom Treaty in relation to the presence of the submarine in Gibraltar. And I have naturally read carefully the terms of the joint Motion for a Resolution. I can confirm the issue to which Honourable Members refer has indeed been the subject of complaints to the Commission. Let me set out the position under the Euratom Treaty. Chapter 3 of the Euratom Treaty – headed Health and Safety – is the legal basis for the three directives that are potentially relevant: − Directive 89/618/Euratom on Informing the Public in the Event of Radiological Emergency, Directive 96/29/Euratom on Basic Safety Standards and Directive 92/3/Euratom on the supervision and control of shipments of radioactive waste; − Article 37 of Chapter 3 concerns plans for the disposal of radioactive waste. The procedure under Article 37 of the Euratom Treaty relates to the submission of plans for disposal of radioactive waste, so as to enable the Commission to determine whether the implementation of such a plan is liable to result in the radioactive contamination of the water, soil or airspace of another Member State. The Commission has taken the following action. A letter was sent by the Commission to the British authorities on 10 October 2000. This requested information on: − the existence of an intervention plan for the area of Gibraltar and for the port of Gibraltar under the terms of Article 50 of Directive 96/29/Euratom; − measures taken to inform the public in the event of a radiological emergency in connection with the repairs being carried out to the submarine in the port of Gibraltar; 2 − whether these measures take into account the possible impact on Spanish territory; − whether there are any plans for shipment of radioactive waste, resulting from the repair of the submarine, from Gibraltar to the United Kingdom. The United Kingdom authorities replied by letter on 14 November and 1 December. These replies are currently under technical and legal assessment by the Commission’s experts. But at this stage the Commission can give the following information. In reply to whether an intervention plan exists for the area of Gibraltar and the port of Gibraltar, the British authorities have drawn the Commission’s attention to the existence of the Gibraltar Public Safety Scheme (GIBPUBSAFE), which is the intervention plan for Gibraltar. The Commission is analysing this plan. The British authorities state that GIBPUBSAFE provides background information and guidance on action to be taken in the event of a nuclear accident in Gibraltar. The intervention plan is drawn up, state the British authorities, by the interested parties – which include the British Ministry of Defence, the Gibraltar Government and emergency services – and is issued by the Chief Officer, Gibraltar City Fire Brigade and the Commander British Forces on behalf of the Gibraltar Local Liaison Committee. GIBPUBSAFE is a public document, and is freely available in the Gibraltar public library. The British authorities state that there will be no shipment of radioactive waste that will transit through any other Member State. They also state that they are in regular contact with the Spanish authorities. Honourable Members also asked if the port of Gibraltar meets the technical conditions needed for the repair of nuclear submarines. The Euratom Treaty does not enable the Commission to offer any judgement on the UK’s decisions in that regard; this is a matter for the UK authorities. With regard to Article 37, due to the fact that a submarine is concerned for the first time, further assessment of the general applicability of Article 37 to such cases is being carried out by the Commission Services. It is clear, however, that Article 37 relates to the disposal of radioactive waste in general. The Community competence does not require general data to be submitted for the specific repair operations being undertaken. I have made it absolutely clear that we have to base our response to the legitimate concerns raised with us on the basis of Community competence. Pursuing Community competence, we have received a letter from the UK authorities, in response to a letter of our own, and to which I referred earlier. Under the usual complaints’ procedure, we are not entitled to make this reply public, although we can say broadly what it says. Speaking personally, I would encourage the British Government to make that reply public. As I mentioned, the reply makes reference to the nuclear intervention plan for Gibraltar (GIBPUBSAFE). This is a public document, as I mentioned, available in the Gibraltar public library. My office therefore contacted the Chief Secretary’s Office in Gibraltar yesterday to ask for a copy, which I have here. I am happy to provide this document to the House. 3 +067,5(/(66±:,1'8363((&+ I was well aware from reading the newspapers and listening to the radio and television of the passions engendered by this important issue. Those feelings have, understandably, been reflected in this debate. But Honourable Members know that in responding on behalf of my colleague, Commissioner Wallström, I must restrict myself to setting out clearly what is – and what is not – Community competence: Community competence under the terms of Chapter 3 “Health and Safety” of the Euratom Treaty covers the following issues relevant to this case: D LQIRUPLQJWKHJHQHUDOSXEOLFDERXWKHDOWKSURWHFWLRQPHDVXUHVWREH DSSOLHGDQGVWHSVWREHWDNHQLQWKHHYHQWRIDUDGLRORJLFDOHPHUJHQF\ E WKHDYDLODELOLW\RIDQLQWHUYHQWLRQSODQWRGHDOZLWKYDULRXVW\SHVRI UDGLRORJLFDOHPHUJHQF\ F WKHVXSHUYLVLRQDQGFRQWURORIVKLSPHQWVRIUDGLRDFWLYHZDVWH All these issues are being assessed further in detail by Commission Officials. This competence enables the Commission to ensure that Member States: − Inform the public of potential risks and steps to take should a radiological emergency occur; − Adequately control and supervise shipments of radioactive waste Community competence does not extend to: a) The classification of ports to carry out repair work on nuclear submarines. b) Questions of technical safety of nuclear reactors c) Requiring the submarine to be removed for repair elsewhere To answer one specific point which has been raised, that of co-operation between Member States, I can assure the Honourable Members that such co-operation is explicitly required in Community legislation. Article 51.5 of the Euratom Basic Safety Standards Directive 96/29/Euratom, states that “Each Member State shall, in the event of a radiological emergency occurring at an installation on its territory or being likely to have radiological consequences on its territory, establish relations to obtain co-operation with any other Member State or non-Member State which may be involved”. An additional point which has been raised in this context is the applicability of Article 37 of the Euratom Treaty concerning the submission of general data relating to plans for the disposal of radioactive waste. The relevance of the Community competence in this case is not clear. The general question of submission of plans for nuclear power submarines is being studied by Commission Officials. The Community competence does not require general data to be submitted for the specific repair operation being undertaken. Let me just say that I assume that if any Member State had doubts about the way the Commission has handled its competence in this matter it would let us know. 4 Finally, with respect to the questions raised about complaints received by the Commission in this case, I can confirm that four complaints have indeed been received. The first two have indeed been registered with the Secretariat General as complaints and an initial reply has been sent. The last two have only been received in the last few days and have been sent to the Secretariat General for registration as complaints. When the information has been assessed by Commission officials and when more information has been sought and obtained from the UK, the Commission will reply substantively to the complainants. Speaking not as a Commissioner, but as a politician who was once also an Environment Minister, it seems to me that the important thing in cases like this is to make as much information public as possible. I would urge the British authorities to do that. For its part, the Commission undertakes to keep Honourable Members who have raised these questions with us informed of developments in the coming weeks. 5.
Recommended publications
  • UNITED STATES SUBMARINE VETERANS INCORPORTATED PALMETTO BASE NEWSLETTER December 2011
    OUR CREED: To perpetuate the memory of our shipmates who gave their lives in the pursuit of duties while serving their country. That their dedication, deeds, and supreme sacrifice be a constant source of motivation toward greater accomplishments. Pledge loyalty and patriotism to the United States of America and its constitution. UNITED STATES SUBMARINE VETERANS INCORPORTATED PALMETTO BASE NEWSLETTER December 2011 1 Picture of the Month………………………………………………………………………………………………………………...3 Members…………………………………………………………………………………………………………………………………..4 Honorary Members……………………………………………………………………………………………………………………4 Meeting Attendees………………………………………………………………………………………………………………..….5 Old Business….…………………………………………………………………………………………………………………………..5 New Business…………………………………………………………………………………………………………………………….6 Good of the Order……………………………………………………………………………………………………………………..6 Base Contacts…………………………………………………………………………………………………………………………….8 Birthdays……………………………………………………………………………………………………………………………………8 Welcome…………………………………………………………………………………………………………………………………..8 Binnacle List……………………………………………………………………………………………………………………………,…8 Quote of the Month.……………………………………………………………………………………………………………….…8 Fernando Igleasis Eternal Patrol…………………………………………………………………………………………………9 Robert Gibbs’ Memorial……………..….…………………..……………………………………………………………………10 Lexington Veteran’s Day Parade………………………………………………………………………………………………12 Columbia Veteran’s Day Parade.………………………………………………………………………………………………13 Dates in American Naval History………………………………………………………………………………………………16 Dates in U.S. Submarine History………………………………………………………………………………………………22
    [Show full text]
  • Damaged British Nuclear Submarine HMS Tireless Docked in Gibraltar
    COUNCIL OF Brussels, 20 December 2000 (22.12) THE EUROPEAN UNION (OR. fr) 14133/00 NM LIMITE PE-&E 536 PRELIMINAR) DRAFT REPL) TO WRITTEN QUESTION P-3584/00 put by Laura GON2ALE2 AL3ARE2 on 14 November 2000 from : General Secretariat of the Council to : Permanent Re resentations of the Member States Subject : Damaged British nuclear submarine HMS Tireless docked in Gibraltar 1. Delegations will find attached: œ the te,t of the above Written Question; œ a reliminar1 draft re l1 re ared b1 the General Secretariat. 2. If no comments have been received from delegations within 10 wor8ing days of toda1, this reliminar1 draft re l1 will be submitted to the Permanent Re resentatives Committee 4Part 1) and to the Council for a roval. An1 comments received will be e,amined b1 the .orking Part1 on General Affairs. ______________________ 14133/00 ani/AM/jr 1 DG F I EN WRITTEN QUESTION P-3584/00 put by Laura González >lvarez on (1UE/N1L) to the Council Subject: Damaged British nuclear submarine HMS Tireless, docked in Gibraltar The British nuclear submarine HMS Tireless has been docked at the British naval base in Gibraltar since 19 Ma1 2000 for re airs to its damaged rimar1 coolant circuit. The British authorities have given conflicting accounts regarding the e,tent of the damage, whilst the re air eriod, initiall1 announced as lasting onl1 three months, has now been e,tended to summer 2001. The Ro1al 8av1 rohibits re airs to nuclear9 owered submarines in orts with facilities such as those in Gibraltar 4:9class orts5 and onl1 authorises such re airs in X9class bases such as those at Devon ort and Faslane in the United Kingdom, which have medical equi ment, evacuation lans and s ecial machiner1.
    [Show full text]
  • The Sea Ice Experiment: Dynamic Nature of the Arctic (SEDNA) Applied Physics Laboratory Ice Station (APLIS) 2007
    The Sea Ice Experiment: Dynamic Nature of the Arctic (SEDNA) Applied Physics Laboratory Ice Station (APLIS) 2007 Field Report Editor: Jennifer K. Hutchings Sedna by Brenda Jones 0 Table of Contents Participant List 2 1. Introduction 4 2. Remote Sensing Support 18 3. Buoy Deployments 45 4. Ice Thickness Campaign 56 5. Ridge Study 85 6. Perimeter Survey 96 7. Meteorology 106 8. Oceanography 115 9. Outreach 119 Acknowledgements 126 Appendix 1 128 Appendix 2 129 Appendix 3 130 Appendix 4 131 Appendix 5 134 Appendix 6 138 Appendix 7 140 References 143 1 Field Campaign Participants SEDNA Field Participants (incl. remote sensing groups and home support) Rob Chadwell [email protected] Pablo Clemente-Colon [email protected] Martin Doble [email protected] Bruce Elder [email protected] Rene Forsberg [email protected] Cathy Geiger [email protected] Katharine Giles [email protected] Scott Grauer-Gray [email protected] Christian Haas [email protected] Stephan Hendriks [email protected] Ben Holt [email protected] Nick Hughes [email protected] Jenny Hutchings [email protected] Chandra Kambhamettu [email protected] M. McGregor [email protected] Eggert Jon Magnusson [email protected] Torge Martin [email protected] Alice Orlich [email protected] Mitch Osborne [email protected] Jackie Richter-Menge [email protected] Andrew Roberts [email protected] Henriette Skourup [email protected] Mani Thomas [email protected] Adrian Turner [email protected] Peter
    [Show full text]
  • Damaged British Nuclear Submarine HMS Tireless Docked in Gibraltar
    COUNCIL OF Brussels, 5 February 2001 (07.02) THE EUROPEAN UNION (OR. fr 5602/01 LIMITE PE-&E 53 DRAFT REPL) TO WRITTEN QUESTION P-3584/00 put by Laura GON1ALE1 AL2ARE1 on 14 November 2000 from : Working Party on General Affair to : Permanent Repre entative Committee/Council Subject : Damaged Briti h nuclear submarine HMS Tirele docked in Gibraltar 1. Delegations will find attached: œ the te0t of the above Written Que tion; œ a draft reply prepared by the Working Party on General Affair at it meeting on 29 January 2001. 2. ,hi draft reply will be submitted to the Permanent Repre entative Committee (Part 1) and to the Council for approval. ______________________ 5602/01 ett/HM/mh 1 DG F I EN WRITTEN QUESTION P-3584/00 .ut by Laura Gon7ále7 9lvare7 on (0UE/N0L to the Council Subject: Damaged Briti h nuclear submarine HMS Tirele , docked in Gibraltar ,he Briti h nuclear submarine HMS Tirele ha been docked at the Briti h naval ba e in Gibraltar ince 19 May 2000 for repair to it damaged primary coolant circuit. The Briti h authoritie have given conflicting account regarding the e0tent of the damage, whil t the repair period, initially announced a la ting only three months, ha now been e0tended to summer 2001. The Royal Navy prohibit repair to nuclear-powered submarine in port with facilitie such a those in Gibraltar 5;-cla port 6 and only authori e such repair in X-cla ba e such a tho e at Devonport and Fa lane in the United Kingdom, which have medical equipment, evacuation plans and special machinery.
    [Show full text]
  • Research Guide to Submarine Arctic Operations
    Research Guide To Submarine Arctic Operations A list of materials available at the Submarine Force Library & Archives Featuring images & documents from the archival collection Submarine Arctic Operations A list of Materials Available at the Submarine Force Library & Archives Introduction: This guide provides a listing of research material available at the Submarine Force Library and Archives on the topic of Submarine Arctic Operations. The collection includes both published and unpublished sources. The items listed in this guide may be viewed, by appointment at the museum library. Inter-library loan is not available. Library hours are; Monday, Wednesday, Thursday, and Friday 9:00 – 11:30 and 1:00 – 3:45. Currently, the library is unable to provide photocopy or photographic duplication services. Although a few courtesy copies can be provided, researchers should come prepared to take notes. Researchers are permitted to use their own cameras to take photographs of images in the collection. For further information, or to schedule a visit, please call the Archivist at (860) 694-3558 x 12, or visit our web site at: www.ussnautilus.org Table of Contents: Library Collections I Books II Periodical Articles III Vertical Files Archival & Special Collections IV Personal Papers/Manuscript Collections V Oral Histories VI “Boat Books” VII Audio Visual Materials VIII Memorabilia IX Foreign Navies--Arctic Submarine Resources Exhibits X Arctic Submarine Exhibits at the Submarine Force Museum On-line Links XI Links to additional Arctic Submarine Resources available on the Web Chronology XII U.S. Submarine Arctic Operations – Historical Timeline USS HAMPTON (SSN 767) – ICEX ‘04 Books Non-Fiction Fiction Children’s Rare Books Non-Fiction J9.80 Althoff, William F.
    [Show full text]
  • Advancing Cooperation and Capabilities in the Arctic
    PHOTO CONTEST CALL FOR ENTRIES SUMMER 2018 U. S. SUBMARINES … B ECAUSE STEALTH MATTERS ICEX ‘18 Advancing Cooperation and Capabilities in the Arctic INSIDE History of U.S. Subs in the Arctic Leave as a Performance Metric Q&A: ex-Submariner in Hollywood Advice for new PNEO Graduates U. S. SUBMARINES … B ECAUSE STEALTH MATTERS THE OFFiciaL MAGAZINE OF THE U.S. SUBMARINE Force FORCE COMMANDER’S CORNER ICEX ‘18 Vice Adm. Joseph E. Tofalo, USN Commander, Submarine Forces Summer 2018 4 Advancing Cooperation and 65 Capabilities in the Arctic o. N Arctic Exercises ssue I 4 by Lt. Courtney Callaghan, CSS-11 PAO, Mr. Theo Goda, Joseph Hardy and Larry Estrada, Arctic Submarine Lab Undersea Warriors, Sixty Years of U.S. Submarines in the Arctic 8 by Lt. Cmdr. Bradley Boyd, Officer in Charge, Historic Ship Nautilus As my three-year tenure as Commander, Submarine Forces draws to a close, I want you all to know that it has been Director, Submarine Force Museum the greatest privilege of my career to be your Force Commander. It has been an honor to work with the best people on the best warships supported by the best families! 8 10 Operation Sunshine For much of the last century, we really only had one main competitor on which to focus. We are now in a world by Lt. Cmdr. Bradley Boyd, Officer in Charge, Historic Ship Nautilus where we not only have two near-peer competitors with which to contend, but also three non-near-peer adversaries Director, Submarine Force Museum that challenge us as well—overall a much broader field.
    [Show full text]
  • Marine Nuclear Power: 1939 – 2018
    Marine Nuclear Power: 1939 – 2018 Part 6: Arctic Operations Peter Lobner February 2019 1 Foreword In 2015, I compiled the first edition of this resource document to support a presentation I made in August 2015 to The Lyncean Group of San Diego (www.lynceans.org) commemorating the 60th anniversary of the world’s first “underway on nuclear power” by USS Nautilus on 17 January 1955. That presentation to the Lyncean Group, “60 years of Marine Nuclear Power: 1955 – 2015,” was my attempt to tell a complex story, starting from the early origins of the US Navy’s interest in marine nuclear propulsion in 1939, resetting the clock on 17 January 1955 with USS Nautilus’ historic first voyage, and then tracing the development and exploitation of marine nuclear power over the next 60 years in a remarkable variety of military and civilian vessels created by eight nations. In July 2018, I finished a complete update of the resource document and changed the title to, “Marine Nuclear Power: 1939 – 2018.” What you have here is Part 6: Arctic Operations. The other parts are: Part 1: Introduction Part 2A: United States - Submarines Part 2B: United States - Surface Ships Part 3A: Russia - Submarines Part 3B: Russia - Surface Ships & Non-propulsion Marine Nuclear Applications Part 4: Europe & Canada Part 5: China, India, Japan and Other Nations 2 Foreword This resource document was compiled from unclassified, open sources in the public domain. I acknowledge the great amount of work done by others who have published material in print or posted information on the internet pertaining to international marine nuclear propulsion programs, naval and civilian nuclear powered vessels, naval weapons systems, and other marine nuclear applications.
    [Show full text]
  • Winter 2010 Review the .SU
    Naval War College Review Volume 63 Article 24 Number 1 Winter 2010 Winter 2010 Review The .SU . Naval War College Follow this and additional works at: https://digital-commons.usnwc.edu/nwc-review Recommended Citation War College, The .SU . Naval (2010) "Winter 2010 Review," Naval War College Review: Vol. 63 : No. 1 , Article 24. Available at: https://digital-commons.usnwc.edu/nwc-review/vol63/iss1/24 This Full Issue is brought to you for free and open access by the Journals at U.S. Naval War College Digital Commons. It has been accepted for inclusion in Naval War College Review by an authorized editor of U.S. Naval War College Digital Commons. For more information, please contact [email protected]. 1 Winter 2010 Volume 63, Number 1 Volume War College: Winter 2010 Review NAVAL WAR COLLEGE REVIEW Published by U.S. Naval War College Digital Commons, 2010 NAVAL WAR COLLEGE REVIEW Winter 2010 R COL WA LEG L E A A I V R A N O T C I V I R A M S U S B E I T R A T I T H S E V D U E N T I p Composite Default screen Naval War College Review, Vol. 63 [2010], No. 1, Art. 24 Cover A plane captain “walks down” the wing of an F/A-18C Hornet of Strike Fighter Squadron 113 on the flight deck of the aircraft carrier USS Ronald Reagan (CVN 76), operating in the Gulf of Oman in September 2008. This stringent safety inspection, conducted before and after flight operations, exemplifies the new practicalities that will face the navy of the People’s Republic of China if—as our lead article, by Professors Nan Li and Christopher Weuve, argues is likely—it decides to build and operate carriers of its own.
    [Show full text]
  • On Thin Ice? Perspectives on Arctic Security
    On Thin Ice? Perspectives on Arctic Security Edited by DuNcan Depledge and P. Whitney Lackenbauer ON THIN ICE? Perspectives on Arctic Security © The authors, 2021 North American and Arctic Defence and Security Network (NAADSN) / Réseau sur la défense et la sécurité nord-américanes et arctiques (RDSNAA) c/o School for the Study of Canada Trent University Peterborough, Ontario, Canada K9J 7B8 All rights reserved. LIBRARY AND ARCHIVES CANADA CATALOGUING IN PUBLICATION On Thin Ice? Perspectives on Arctic Security / Edited by Duncan Depledge and P. Whitney Lackenbauer (NAADSN Engage Series no. 5 / RDSNAA série d’engage no. 5) Published in print and electronic formats. ISBN: 978-1-989811-13-9 (e-book) 978-1-989811-14-6 (print) 1. Arctic regions—Strategic aspects. 2. Arctic regions—Defence and Security. 3. Arctic security. I. Depledge, Duncan, editor. II. Lackenbauer, P. Whitney, editor. Title: On Thin Ice? Perspectives on Arctic Security. III. Series: NAADSN Engage Series / RDSNAA série d’engage; no. 5 Designer and layout: P. Whitney Lackenbauer Cover design: Jennifer Arthur-Lackenbauer Cover image: Duncan Depledge Copy editor: Corah Hodgson Distributed by the North American and Arctic Defence and Security Network (NAADSN) Distribué par le Réseau sur la défense et la sécurité nord-américanes et arctiques (RDSNAA) ON THIN ICE? Perspectives on Arctic Security Edited by Duncan Depledge and P. Whitney Lackenbauer Table of Contents Foreword by Lt. Col. Adam Rutherford ........................................................ i Preface by Duncan Depledge ...................................................................... iii Introduction by Duncan Depledge and P. Whitney Lackenbauer ...................v List of Acronyms .................................................................................... xviii 1. Comprehensive Security in the Arctic: Beyond “Arctic Exceptionalism” by Gunhild Hoogensen Gjørv and Kara K.
    [Show full text]
  • 60 Years of Marine Nuclear Power
    Marine Nuclear Power: 1939 – 2018 Part 6: Arctic Operations Peter Lobner July 2018 1 Foreword In 2015, I compiled the first edition of this resource document to support a presentation I made in August 2015 to The Lyncean Group of San Diego (www.lynceans.org) commemorating the 60th anniversary of the world’s first “underway on nuclear power” by USS Nautilus on 17 January 1955. That presentation to the Lyncean Group, “60 years of Marine Nuclear Power: 1955 – 2015,” was my attempt to tell a complex story, starting from the early origins of the US Navy’s interest in marine nuclear propulsion in 1939, resetting the clock on 17 January 1955 with USS Nautilus’ historic first voyage, and then tracing the development and exploitation of marine nuclear power over the next 60 years in a remarkable variety of military and civilian vessels created by eight nations. In July 2018, I finished a complete update of the resource document and changed the title to, “Marine Nuclear Power: 1939 – 2018.” What you have here is Part 6: Arctic Operations. The other parts are: Part 1: Introduction Part 2A: United States - Submarines Part 2B: United States - Surface Ships Part 3A: Russia - Submarines Part 3B: Russia - Surface Ships & Non-propulsion Marine Nuclear Applications Part 4: Europe & Canada Part 5: China, India, Japan and Other Nations 2 Foreword This resource document was compiled from unclassified, open sources in the public domain. I acknowledge the great amount of work done by others who have published material in print or posted information on the internet pertaining to international marine nuclear propulsion programs, naval and civilian nuclear powered vessels, naval weapons systems, and other marine nuclear applications.
    [Show full text]
  • Leak of Nuclear Reactor on Board HMS Tireless Submarine
    Date Line Date: 17th April 2013 No.109 Subject: Leak of nuclear reactor on board HMS Tireless submarine 1. Introduction This Nuclear Free Local Authorities (NFLA) Policy Briefing provides member authorities with an overview of an incident involving the British nuclear powered submarine „HMS Tireless‟. This briefing has been developed by the NFLA Secretary with assistance and the full co-operation of Peter Burt of the Nuclear Information Service (NIS) and Dr David Lowry, an independent nuclear policy consultant who provides policy advice to Paul Flynn MP, who has been asking questions on the matter in the House of Commons. An approach has also been made to an Irish TD to ask similar questions in the Dail. This incident raises a number of concerns for coastal local authorities in Scotland, Northern Ireland, the Republic of Ireland, Wales and England and should be of interest to national and devolved Governments, councillors, emergency planning officers, public health and environmental health officers. 2. Background According to reports in the British media, HMS Tireless, one of the Royal Navy's nuclear powered fleet submarines, experienced a leak from its reactor cooling system during an exercise off the west coast of Scotland in early February 2013 (http://bit.ly/ZC9J1N). UK Defence Ministers were notified of the incident on 5th February and the damaged submarine returned to its home port at HM Naval Base Devonport in the south west of England. The submarine almost certainly returned to Devonport by travelling through the Irish Sea – the most direct route between the two bases. The UK Government has said little in public about this incident, although it has given short answers to two Parliamentary Questions which have been tabled by Members of Parliament on the matter.
    [Show full text]
  • Charleston Base Newsletter
    Vol. 9, No. 4 April 2013 United States Submarine Veterans - Charleston Base Newsletter USSVI Creed “To perpetuate the memory of our shipmates who gave their lives in the pursuit of their duties while serving their country. That their dedication, deeds, and supreme sacrifice be a constant source of motivation toward greater accomplishments. Pledge loyalty and patriotism to the United States of America and its Constitution” Base Meeting: Appointed Officers Click to email Phone Number May 9 2013 Social hour 1800 General Meeting 1900 Chief of the Boat Rick Sparger 843-553-5594 Location: Public Affairs Ed Stank 843 863-8474 Fleet Reserve Association Branch 269 Veterans Affairs Jim Morrison 843-832-9716 Low Country Home 99 Wisteria Rd Chaplain John Nichols 843-452-3189 Goose Creek, South Carolina Phone 843-569-2962 Membership Carl Chinn 843-875-3098 Holland Club John Kratz 843-873-0238 Base Officers Click to email Phone Number Scholarship Julian Villegas 843-871-6135 Commander Carl Chinn 843-875-3098 Newsletter Steve Morawiec 843-410-0131 Vice Commander Jerry Stout 843-871-9533 Storekeeper Ken Hutchison 843-553-0935 Secretary Rick Wise 843-875-5559 Webmaster John Nichols 843-452-3189 Treasurer Terry Trump 843-873-9563 Historian George Scharf 843 873-3318 The attendance for the March 14, 2013 meeting was 98. Opening Ceremonies: The meeting was called to order by sounding the klaxon. A quorum was present and the meeting started at 1902. Following the Pledge of Allegiance, Chaplain Nick Nichols gave the Invocation and tolled the boats lost in March. MT1/SS Augustus “Gus” Christian Martin, who departed on Eternal Patrol February 15, was also tolled.
    [Show full text]