Fluoresans Ve Moleküler Biyolojide Uygulamalari

Total Page:16

File Type:pdf, Size:1020Kb

Load more

FLUORESANS VE MOLEKÜLER BİYOLOJİDE UYGULAMALARI Prof.Dr. Nermin Gözükırmızı İstanbul Üniversitesi Fen Fakültesi, Moleküler Biyoloji ve Genetik Bölümü FLUORESANS Bir atom veya molekülden elektromagnetik enerjinin absorbsiyonunu izleyen bir süre sonucu dışarıya yayılan ışımadır. Görünebilir ışık spektrumu: Fluoresans sınırları Kalsiyum Fluorit CaF2 Fluoresans(Fluoresans, molekülün belli dalga boyundaki ışığı absorblaması ve bunu tekrar daha büyük bir dalga boyunda yayması olayıdır). Luminesans (Bir dış kaynaktan alınan enerjinin bir kısmının elektro manyetik ışınım olarak salmasıdır). Bazı tanımlar • Emilim – Işık bir objenin içinden geçtiğinde değişen oranlarda ışığı absorblar. Böylece absorblanan ışığın dışındaki dalga boylarında renk üretilir. • Kırılma – Işığın bir optik yoğunluğa sahip ortamdan farklı optik yoğunluktaki bir otama geçişindeki yön değişimidir. • Yansıma – Işık ışınları bir cismin etrafında yön değiştirmesidir. Yansımasıdır. • Dağılma – Işık şeffaf bir alana girdiğinde, ışığın onu oluşturan farklı dalga boylarına ayrılması. Kontrol Absorpsiyon Yeşil ve mavi yok Kırmızı filtre Işık absorbsiyonu Beyaz ışık Mavi ışık Kırmızı ışık Yeşil ışık Kırmızı ve yeşil Mavi ve yeşil Mavi ve kırmızı absorblanır absorblanır absorblanır Absorbsiyon şeması Beyaz ışıktaki Absorblanan ışığın rengi renk kırmızı mavi yeşil mavi kırmızı yeşil yeşil kırmızıkırmızı mavi sarı mavi mor yeşil cyan kırmızı siyah kırmızı yeşil mavi gri pembe yeşil mavi • Kromoforlar ışığı absorblayan molekül bileşenleridir. • Örneği proteinlerde indol halkası benzeri. • Genellikle aromatik halkalardır. Jablonski Diagramı S’ 1 S1 hvex hvem S 0 Fluorescein – Tipik Fluoresan Prob 120 100 80 60 Intensity 40 20 0 380 480 nm 580 680 NEDEN FLUORESANS? • Çok güzel. • Moleküler çevre hakkında bilgi verir. • Dinamik olaylarda nanosaniye düzeyinde bilgi verir. The Nobel Prize in Chemistry 2008 "for the discovery and development of the green fluorescent protein, GFP" Osamu Shimomura (1962) Martin Chalfie Roger Y. Tsien 1/3 of the prize 1/3 of the prize 1/3 of the prize USA USA USA Marine Biological Laboratory (MBL) Columbia University University of California Woods Hole, MA, USA New York, NY, USA San Diego, CA, USA b. 1928 b. 1947 b. 1952 pGLO™ Transformation and Purification of Green Fluorescent Protein (GFP) GFP • 1962 bulunması • 1992 klonlanması Prasher • 1994 ilk gen anlatımı uygulaması Chalfie et al. • 1996 kristal yapısının bulunması Düşük toksisiteli, yüksek stabiliteli monomerik kromofor. GFP kullanım alanları • Gen anlatımının görülmesi • Protein etiketleme, hareketi, ilişkileri,aktivite ölçümü ve yıkımı • Organel etiketleme, füsyon vb. • Genetik sensörler pH, Ca+2, cAMP, cGMP,kinaz aktivitesi, voltaj vb. Osamu Shimomura Douglas Prasher Marty Chalfie Sergey A. Lukyanov Roger Tsien Shimomura (1979) In June 2003 GFP was the protein databank's (pdb) molecule of the month Işıma deniz suyundaki Ca+2 iyonları varlığında gerçekleşir. GFP, kendi kromoforunun oluşumunu katalizler. Bu katalizde Arg96’nın çok önemli bir rol oynadığı önerilmiştir. Douglas Prasher GFP Amino Acid Sequence: MSKGEELFTGVVPVLVELDGDVNGQKFSVSGEGEGDATYGKLTLNFICT TGKLPVPWPTLVTTFSYGVQCFSRYPDHMKQHDFFKSAMPEGYVQERTI FYKDDGNYKTRAEVKFEGDTLVNRIELKGIDFKEDGNILGHKMEYNYNS HNVYIMGDKPKNGIKVNFKIRHNIKDGSVQLADHYQQNTPIGDGPVLLP DNHYLSTQSALSKDPNEKRDHMILLEFVTAARITHGMDELYK GFP E.coli, Chalfie. Fluoresan timer protein Dsred (2000) Sergey A. Lukyanov 44 yeni veya mutant variant GFP kristal yapısı GFP uzun bir zincir boyunca birleşen 238 aminoasit içerir. Bu zincir bir fıçı biçiminde katlanır. Fıçı yapısının içinde 65., 66. ve 67. aminoasitler UV ve mavi ışığı absorplayan kimyasal grupları oluşturur, ve yeşil fluoresan ışık yayar. GFP ışığı absorblayan ve yayan bir kimyasal grup olan kromofor taşır. Fluoresan proteinler Aequorea fluoresan protein (AFP) varyantları Yeşil fluoresan protein (GFP) Arttırılmış yeşil fluoresan protein (EGFP)508nm Sarı fluoresan protein (YFP) Arttırılmış sarı fluoresan protein (EYFP) 528nm Cyan fluoresan protein (CFP) Arttırılmış cyan fluoresan protein (ECFP)475nm Mavi fluoresan protein (BFP) Arttırılmış mavi fluoresan protein (ECFP)448nm Kırmızı fluoresan proteinlerin bulunması Anthozoa Yeni yeşil fluoresan benzeri proteinler Copepoda Fluorescence shown along the body structure of amphioxus. Credit: Scripps Institution of Oceanography at UC San Diego May 26, 2009—Fluorescent proteins in some sea creatures may actually promote a healthy glow, according to a new study of a fishlike animal called a lancelet (pictured). in vivo görüntüleme tumor (GFP)vasculature (Angiosense) Brainbow mice Painted in Fluorescent Serebral korteks Bacteria • Sarı hücreler replikasyonun başladığını, yeşil hücreler sentez (S) fazındaki ve kırmızı hücreler ise G1 fazındaki hücreleri işaret etmekte. • Fucci (fluorescent, ubiquitination-based cell cycle indicator). 46 Oksidatif Reaksiyonlar • Superoksid Hidroethidin • Hidrogen Peroksid Diklorofluorescein • Glutathion seviyesi Monobromobiman • Nitrik Oksid Diklorofluorescein Nükleik asid probları • Hoechst 33342 (AT rich) (uv) 346 460 • DAPI (uv) 359 461 • POPO-1 434 456 • YOYO-1 491 509 • Acridine Orange (RNA) 460 650 • Acridine Orange (DNA) 502 536 • Thiazole Orange (vis) 509 525 • TOTO-1 514 533 • Ethidium Bromide 526 604 • PI (uv/vis) 536 620 • 7-Aminoactinomycin D (7AAD) 555 655 Protein probları Probe Excitation Emission FITC 488 525 PE 488 575 APC 630 650 PerCP™ 488 680 Cascade Blue 360 450 Coumerin-phalloidin 350 450 Texas Red™ 610 630 Tetramethylrhodamine-amines 550 575 CY3 (indotrimethinecyanines) 540 575 CY5 (indopentamethinecyanines) 640 670 Moleküler yapı ve Hücre organizasyonu dinamiği ve dinamiği Geliştirilmiş yüzeyler Hayvansal sistemler İşlevsel genomik uygulamaları – İnsersional mutagenez – Enhancer tanısı – Reporter gen anlatımı • Hücre tanısı • Canlı hücrelerde protein trafiği ve hücre yapıları – Füsyon proteinler • protein-protein ilişkileri • Hücre içi iletişim –Fotoaktif ve foto dönüşümlü fluoresan proteinler. • Hayvan transformasyon sistemleri –Promotörler • Biyo-ekoloji – Etikletli spermler • Canlı hücreler ve bölümlerinde biyokimyasal analizler – Biosensörler • Protein fotoinaktivasyonu ve in vivo hücre öldürülmesi The Nobel Prize in Chemistry 1980 for his fundamental studies of the biochemistry of nucleic acids, with particular regard to recombinant-DNA" "for their contributions concerning the determination of base sequences in nucleic acids" Paul Berg Walter Gilbert Frederick Sanger 1/2 of the prize 1/4 of the prize 1/4 of the prize USA USA United Kingdom Harvard University, Biological MRC Laboratory of Stanford University Laboratories Molecular Biology Stanford, CA, USA Cambridge, MA, USA Cambridge, b. 1926 b. 1932 United Kingdom b. 1918 DNA analizleri elektroferogram 2008’in en iyi icadı evde yapılan DNA testi hürriyet.com.tr 8 Kasım 2008 Monday, November 10, 2008 1. The Retail DNA Test TIME's Best Inventions of 2008 Time Dergisi yılın en iyi 50 icadını seçti. Dergiye göre, 2008’in en iyi icadı, bu yıl perakende olarak satışa sunulan pratik DNA testi. 399 dolara satın alınabilen paket sayesinde herkes ev ortamında analiz yaparak, genetik olarak 90 hastalık ve rahatsızlığa yakalanma riskini öğrenebiliyor. Test paketi, 600 bin gen kombinasyonunu tanıyıp yorumlayarak, kişinin Alzheimer’a yakalanma ihtimalinden, kel kalma veya kör olma riskine dek birçok konuda tıbbi olasılık bilgisi veriyor. "23andMe" adlı testi pazarlayan firmanın sahibi, Google’ın kurucularından Sergey Brin’in eşi Anne Wojcicki. •Age-related Macular Degeneration •Alcohol Flush Reaction •Bitter Taste Perception •Celiac Disease •Crohn's Disease •Cystic Fibrosis (Delta F508 mutation) •Earwax Type •Eye Color •G6PD Deficiency •Lactose Intolerance •Malaria Resistance (Duffy Antigen) •Muscle Performance •Age-related Macular Degeneration •Alcohol Flush Reaction •Bitter Taste Perception •Celiac Disease •Crohn's Disease •Cystic Fibrosis (Delta F508 mutation) •Earwax Type •Eye Color •G6PD Deficiency •Lactose Intolerance •Malaria Resistance (Duffy Antigen) •Muscle Performance •Non-ABO Blood Groups •Norovirus Resistance •Parkinson's Disease •Prostate Cancer •Psoriasis •Resistance to HIV/AIDS •Rheumatoid Arthritis •Sickle Cell Anemia & Malaria Resistance •Type 1 Diabetes •Type 2 Diabetes •Venous Thromboembolism Yeni dizileme yöntemleri (Yeni genom center görünümü) Roche/454 GS FLX Dizileme hazırlığı Tüm genom rastgele parçalara ayrılır Parçalar nötralize edilir. Adaptörler eklenir. DNA su yağ karışımındaki tutucu boncuklara bağlanır. Boncuklara bağlı parçalarda PCR yapılır. Bir parçanın binlerce kopyasını içeren boncuklar PicoTiter Plate’te konur. Polimeraz ve luciferaz içeren enzimler eklenir. Dizileme işlemi Plate’ler dizileme aygıtına konur. Nukleotidler (A,C,G,T) plate üzerinde seri halinde yıkanır. Tamamlayıcı nukleotid girince, DNA polimeraz ile kalıp DNA uzatılır. Nukleotidlerin eklenmesi ışık saçar ve bu durum CCD kamera ile okunur. Binlerce boncuk ayni anda Genome sequencing in microfabricated high- dizilenir. density picolitre reactors-Nature 437, 376-380 (15 September 2005) Dizileme hızı • ~25 milyon baz >=% 99 doğrulukta 4 saatte • ~230,000 okuma • Ortalama okuma uzunluğu 110 baz Günümüzde kullanılan yeni nesil dizileme sistemleri Roche 454 Illumina HiSeq Helicos Heliscope Solid dizileme Ion Torrent Dizileme Pasific Bioscience Pacific Biosciences Tek Molekül Real Time (‘Single Molecular Real Time –SMRT) teknolojisidir. Her bir çip, 100 nm boşlukta DNA izlenir. Fosfor ile işaretli nükleotidler farklı renkle işaretlenir. Uzun okumalar, kısa sürelerde okunur ve yüksek
Recommended publications
  • GFP: Lighting up Life

    GFP: Lighting up Life

    PERSPECTIVE GFP: Lighting up life Martin Chalfie1 Department of Biological Sciences, Columbia University, New York, NY 10027 You can observe a lot by watching. Zernike, physics, 1953), large-array ra- My colleagues and I often call their Yogi Berra dio telescopes (Martin Ryle, physics, Nobel Prize the first worm prize. The 1974), the electron microscope (Ernst second went in 2006 to Andy Fire and My companions and I then witnessed Ruska, physics, 1986), the scanning tun- Craig Mello for their discovery of RNA a curious spectacle...TheNautilus neling microscope (Gerd Binnig and interference. I consider this year’s prize floated in the midst of ...trulyliv- Heinrich Rohrer, physics, 1986), com- to be the third worm prize, because if I ing light[,]...aninfinite agglomera- puter-assisted tomography (Allan M. had not worked on C. elegans and con- tion of colored...globules of diaph- Cormack and Godfrey N. Hounsfield, stantly told people that one of its advan- anous jelly.... physiology or medicine, 1979), and, tages was that it was transparent, I am Jules Verne, Twenty Thousand most recently, magnetic resonance imag- convinced I would have ignored GFP Leagues Under the Sea ing (Paul C. Lauterbur and Sir Peter when I first heard of it. These three Now it is such a bizarrely improbable Mansfield, physiology or medicine, prizes speak to the genius of Sydney coincidence that anything so mind- 2003). Brenner in choosing and developing a bogglingly useful could have evolved My road to imaging was not direct. I new organism for biological research. purely by chance that some thinkers had been interested in science from The year before I learned about GFP, have chosen to see it as a final and when I was very young, but after a di- my lab had begun looking at gene expres- clinching proof of the nonexistence sastrous summer lab experience in which sion in the C.
  • Nobel Lecture by Roger Y. Tsien

    Nobel Lecture by Roger Y. Tsien

    CONSTRUCTING AND EXPLOITING THE FLUORESCENT PROTEIN PAINTBOX Nobel Lecture, December 8, 2008 by Roger Y. Tsien Howard Hughes Medical Institute, University of California San Diego, 9500 Gilman Drive, La Jolla, CA 92093-0647, USA. MOTIVATION My first exposure to visibly fluorescent proteins (FPs) was near the end of my time as a faculty member at the University of California, Berkeley. Prof. Alexander Glazer, a friend and colleague there, was the world’s expert on phycobiliproteins, the brilliantly colored and intensely fluorescent proteins that serve as light-harvesting antennae for the photosynthetic apparatus of blue-green algae or cyanobacteria. One day, probably around 1987–88, Glazer told me that his lab had cloned the gene for one of the phycobilipro- teins. Furthermore, he said, the apoprotein produced from this gene became fluorescent when mixed with its chromophore, a small molecule cofactor that could be extracted from dried cyanobacteria under conditions that cleaved its bond to the phycobiliprotein. I remember becoming very excited about the prospect that an arbitrary protein could be fluorescently tagged in situ by genetically fusing it to the phycobiliprotein, then administering the chromophore, which I hoped would be able to cross membranes and get inside cells. Unfortunately, Glazer’s lab then found out that the spontane- ous reaction between the apoprotein and the chromophore produced the “wrong” product, whose fluorescence was red-shifted and five-fold lower than that of the native phycobiliprotein1–3. An enzyme from the cyanobacteria was required to insert the chromophore correctly into the apoprotein. This en- zyme was a heterodimer of two gene products, so at least three cyanobacterial genes would have to be introduced into any other organism, not counting any gene products needed to synthesize the chromophore4.
  • Liberal Arts Science $600 Million in Support of Undergraduate Science Education

    Liberal Arts Science $600 Million in Support of Undergraduate Science Education

    Janelia Update |||| Roger Tsien |||| Ask a Scientist SUMMER 2004 www.hhmi.org/bulletin LIBERAL ARTS SCIENCE In science and teaching— and preparing future investigators—liberal arts colleges earn an A+. C O N T E N T S Summer 2004 || Volume 17 Number 2 FEATURES 22 10 10 A Wellspring of Scientists [COVER STORY] When it comes to producing science Ph.D.s, liberal arts colleges are at the head of the class. By Christopher Connell 22 Cells Aglow Combining aesthetics with shrewd science, Roger Tsien found a bet- ter way to look at cells—and helped to revolutionize several scientif-ic disciplines. By Diana Steele 28 Night Science Like to take risks and tackle intractable problems? As construction motors on at Janelia Farm, the call is out for venturesome scientists with big research ideas. By Mary Beth Gardiner DEPARTMENTS 02 I N S T I T U T E N E W S HHMI Announces New 34 Investigator Competition | Undergraduate Science: $50 Million in New Grants 03 PRESIDENT’S LETTER The Scientific Apprenticeship U P F R O N T 04 New Discoveries Propel Stem Cell Research 06 Sleeper’s Hold on Science 08 Ask a Scientist 27 I N T E R V I E W Toward Détente on Stem Cell Research 33 G R A N T S Extending hhmi’s Global Outreach | Institute Awards Two Grants for Science Education Programs 34 INSTITUTE NEWS Bye-Bye Bio 101 NEWS & NOTES 36 Saving the Children 37 Six Antigens at a Time 38 The Emergence of Resistance 40 39 Hidden Potential 39 Remembering Santiago 40 Models and Mentors 41 Tracking the Transgenic Fly 42 Conduct Beyond Reproach 43 The 1918 Flu: Case Solved 44 HHMI LAB BOOK 46 N O T A B E N E 49 INSIDE HHMI Dollars and Sense ON THE COVER: Nancy H.
  • How Bad Luck & Bad Networking Cost Douglas Prasher a Nobel Prize

    How Bad Luck & Bad Networking Cost Douglas Prasher a Nobel Prize

    How Bad Luck & Bad Networking Cost Douglas Prasher a N... http://discovermagazine.com/2011/apr/30-how-bad-luck-netw... FROM THE APRIL 2011 ISSUE How Bad Luck & Bad Networking Cost Douglas Prasher a Nobel Prize The discoverer of a gene for a glowing protein was driving a van for a car dealership in Huntsville, Alabama, when he learned that former colleagues had won science's greatest honor. By Yudhijit Bhattacharjee | Monday, July 18, 2011 In December 2008 Douglas Prasher took a week off from his job driving a courtesy van at the Penney Toyota car dealership in Huntsville, Alabama, to attend the Nobel Prize ceremonies in Stockholm. It was the first vacation he and his wife, Gina, had taken in years. On the day of the awards, he donned a rented copy of the penguin suit that all male Nobel attendees are required to wear, along with a pair of leather shoes that a Huntsville store had let him borrow. At the Nobel banquet, sitting beneath glittering chandeliers suspended from a seven-story ceiling, Prasher got his first sip of a dessert wine that he had dreamed of tasting for 30 years. When the waitress was done pouring it into his glass, he asked if she could leave the bottle at the table. She couldn’t, she told him, because the staff planned to finish it later. His buddies back at Penney Toyota were going to love that story, he thought. Prasher’s trip would have been impossible without the sponsorship of biologist Martin Chalfie and chemist and biologist Roger Tsien, who not only invited the Prashers but paid for their airfare and hotel.
  • United States Patent 19 11 Patent Number: 5,766,941 Cormier Et Al

    United States Patent 19 11 Patent Number: 5,766,941 Cormier Et Al

    USO05766941A United States Patent 19 11 Patent Number: 5,766,941 Cormier et al. 45) Date of Patent: Jun. 16, 1998 54 RECOMBINANT DNA VECTORS CAPABLE Inouye. S. et al., "Cloning and sequence analysis of cDNA OF EXPRESSINGAPOAEQUORIN for the luminescent protein aequorin." Proc. Natl. Acad. Sci. USA, vol. 82, pp. 3154-3158. (May 1985). (75) Inventors: Milton J. Cormier, Bogart. Ga.; Tsuji, F.I. et al., "Site-specific mutagenesis of the calci Douglas Prasher. East Falmouth, Mass. um-binding photoprotein aequorin.” Proc. Natl. Acad. Sci. USA, vol. 83, pp. 8107-8111. (Nov. 1986). 73) Assignee: University of Georgia Research Charbonneau, H. et al., "Amino Acid Sequence of the Foundation, Inc., Athens. Ga. Calcium-Dependent Photoprotein Aequorin ." Biochemis try, vol. 24, No. 24. pp. 6762-6771. (Nov. 19, 1985). (21) Appl. No.: 487,779 Shimomura, O. et al., “Resistivity to denaturation of the apoprotein of aequorin and reconstitution of the luminescent 22 Filed: Jun. 7, 1995 photoprotein from the partially denatured apoprotein." Bio chem. J. vol. 199, pp. 825-828. (Dec. 1981). Related U.S. Application Data Prendergast, F.G. et al., "Chemical and Physical Properties 63 Continuation of Ser. No. 346,379, Nov. 29, 1994, which is of Aequorin and the Green Fluorescent Protein Isolated from a continuation of Ser. No. 960,195, Oct. 9, 1992, Pat. No. Aequorea forskalea." American Chemical Society, vol. 17. 5,422,266, which is a continuation of Ser, No. 569,362, Aug. No. 17. pp. 3449-3453. (Aug. 1978). 13, 1990, abandoned, which is a continuation of Ser. No. Shimomura. O. et al., "Chemical Nature of Bioluminescence 165,422, Feb.
  • Lighting up Biology: Expression of the Green Fluorescent Protein

    Lighting up Biology: Expression of the Green Fluorescent Protein

    Lighting Up Biology: Expression of the Green Fluorescent Protein By Martin Chalfie and Ghia Euskirchen A Key Experiment produced by The Explorer’s Guide to Biology 2 Th e Explorer’s Guide to Biology https://explorebiology.org/ Lighting up Biology Expression of the Green Fluorescence Protein Martin Chalfi e and Ghia Euskirchen Martin (Marty) Chalfi e Martin (Marty) Chalfie holds the title of University Professor at Columbia University in New York City. He shared the 2008 Nobel Prize in Chemistry, along with Osamu Shimomura and Roger Y. Tsien, “for the discovery and development of the green fl uorescent protein, GFP.” He received his Ph.D. in Physiology from Harvard University in 1977. ghia Euskirchen Ghia Euskirchen received a Ph.D. in molecular biology from Columbia University. Her career has taken her to Yale University as a postdoc, then to Stanford University where she was director of a DNA sequencing center, and she currently resides in Washington, DC. Published on September, 2019 3 Lighting up Biology: Expression of the Green Fluorescence Protein What’s the Big Deal? Certain jellyfish emit a beautiful green light. Although why jellyfish would want to glow in the dark is still a mystery, the green fluorescent protein (GFP) from these animals has proven to be a gift from nature that has transformed cell biology. Three scientists were recognized with a Nobel Prize for their work on GFP, although others contributed in important ways, as you will see from this story. Why is GFP a big deal? With the combination of GFP and microscopes equipped with very sensitive cameras, scientists began making incredible movies of the dynamic processes that underlie life at that microscopic level.
  • Reniformis Luciferase (Bioluminescence/Renifla Luciferase/Green Fluorescent Protein/Gene Expression) W

    Reniformis Luciferase (Bioluminescence/Renifla Luciferase/Green Fluorescent Protein/Gene Expression) W

    Proc. Natl. Acad. Sci. USA Vol. 88, pp. 4438-4442, May 1991 Biochemistry Isolation and expression of a cDNA encoding Renilla reniformis luciferase (bioluminescence/Renifla luciferase/green fluorescent protein/gene expression) W. WALTER LORENZ*, RICHARD 0. MCCANN*, MATHEW LONGIARUt, AND MILTON J. CORMIER*t *Department of Biochemistry, University of Georgia, Athens, GA 30602; and tHoffman.La Roche, Nutley, NJ 07110 Communicated by W. D. McElroy, December 26, 1990 (receivedfor review, October 12, 1990) ABSTRACT Renilka reniformis is an anthozoan coelenterate V-8 (9). The resulting peptides were purified by HPLC and capable of exhibiting bioluminescence. Bioluminescence in Re- subjected to NH2-terminal Edman sequencing as described niUa results from the oxidation ofcoelenterate luciferin (coelen- (10). Based on these peptide sequences two 17-base oligo- terazine) by luciferase [Renilka-luciferin:oxygen 2-oxidoreduc- nucleotide probes were synthesized with an Applied Biosys- tase (decarboxylating), EC 1.13.12.51. In vivo, the excited state tems DNA synthesizer at the Molecular Genetics Instrumen- luciferin4uciferase complex undergoes the process of nonradi- tation Facility at the University of Georgia. ative energy transfer to an accessory protein, green fluorescent Construction of a cDNA Library in Agtll. Live R. reni- protein, which results in green bioluminescence. In vitro, Renila formis were collected at the University of Georgia Marine luciferase emits blue light in the absence ofany green fluorescent Institute located at Sapelo Island. The animals were frozen protein. A Renifa cDNA library has been constructed in Agtll immediately in liquid N2 and stored at -80TC. Frozen tissue and screened by plaque hybridization with two oligonucleotide was ground to a fine powder in liquid N2 with mortar and probes.
  • “For the Discovery and Development of the Green Fluorescent Protein, GFP” P I X J

    “For the Discovery and Development of the Green Fluorescent Protein, GFP” P I X J

    2008 NOBEL LAUREATES The Nobel Prize in Chemistry 2008 “for the discovery and development of the green fluorescent protein, GFP” X O I P G SCAN ICAL LABORATORY ICAL ORNIA, SAN DIE ORNIA, SAN G F J. HENRIKSSON/ CALI F UNIVERSITY O TOM KLEINDINST/MARINE BIOLO TOM Osamu Shimomura Martin Chalfie Roger Y. Tsien 1/3 of the prize 1/3 of the prize 1/3 of the prize Born: 1928 Born: 1947 Born: 1952 Birthplace: Japan Birthplace: United States Birthplace: United States Nationality: Nationality: Nationality: Japanese citizen US citizen US citizen Current position: Current position: Current position: Professor Emeritus, Marine William R. Kenan Jr Professor, University of Biological Laboratory (MBL), Professor of Biological California, San Diego, Woods Hole, Massachusetts, Sciences, Columbia La Jolla, California, USA USA, and Boston University, New York, University Medical School, New York, USA Massachusetts, USA CHEMISTRY 7 Copyright Nobel Web AB 2008. Nobelprize.org, Nobel Prize and the Nobel Prize medal design mark are registered trademarks of the Nobel Foundation. 2008 NOBEL LAUREATES Speed read: Illuminating biology IBRARY L The story begins with Osamu Shimomura’s research OTO OTO H into the phenomenon of bioluminescence, in which chemical reactions within living organisms give off CIENCE P CIENCE light. While studying a glowing jellyfish in the early S / X 1960s he isolated a bioluminescent protein that gave off blue light. But the jellyfish glowed green. Further studies revealed that the protein’s blue light ANTATOMI H was absorbed by a second jellyfish protein, later P called green fluorescent protein (GFP), which in turn re-emitted green light.
  • A Short History of Plant Light Microscopy

    A Short History of Plant Light Microscopy

    1 From the identification of ‘Cells’, to Schleiden & Schwann’s Cell Theory, to Confocal 2 Microscopy and GFP lighting up the Plant Cytoskeleton, to Super-Resolution 3 Microscopy with Single Molecule Tracking: Here’s... 4 A Short History of Plant Science Chapter 5: 5 A Short History of Plant Light Microscopy 6 Marc Somssich 7 School of BioSciences, the University of Melbourne, Parkville 3010, VIC, Australia 8 Email: [email protected] ; Twitter: @somssichm 9 http://dx.doi.org/10.5281/zenodo.4682573 10 When the microscope was first introduced to scientists in the 17th century it started a 11 revolution. Suddenly a whole new world, invisible to the naked eye, opened up to curious 12 explorers. In response to this realization Nehemiah Grew, one of the early microscopists, 13 noted in 1682 ‘that Nothing hereof remains further to be known, is a Thought not well 14 Calculated.’1. And indeed, with ever increasing resolution, there really does not seem to be an 15 end to what can be explored with a microscope. 16 The Beginnings: Plant Internal Structures and ‘Cells’ (1600-1835) 17 While simple lenses were being used as magnifying glasses for several centuries, the early 18 17th century brought the invention of the compound microscope, and with it launched the 19 scientific field of microscopy2. It is not clear who invented the first microscope, but it was 20 most likely developed from early telescopes2. Galileo Galilei built his first telescope in the 21 early 1600s and used it to chart the stars2. He subsequently published his treatise ‘Sidereus 22 nuncius’ (1610) about his observations2,3.
  • Fluorescent Proteins: Aequorin and Luciferase University of Georgia Research Foundation

    Fluorescent Proteins: Aequorin and Luciferase University of Georgia Research Foundation

    Fluorescent Proteins: Aequorin And Luciferase University of Georgia Research Foundation Bioluminescent animals possess special enzymes, pigments and other compounds that, when present in sufficient concentrations, can produce flashes of dazzling blue and green light that they use to communicate, attract mates, distract predators or lure unsuspecting prey. Many researchers imagined using the naturally glowing substance to track important processes in the human body, harnessing the proteins for medical research, diagnostics and therapeutics. But the only reliable sources for the light- emitting substances were the animals themselves, making them both difficult to acquire and prohibitively expensive. A group of scientists from the University of Georgia tackled this problem by studying light- emitting proteins harvested from Renilla and Aequorea, better known as the sea pansy and crystal jellyfish. After years of experimentation, Milton Cormier, Douglas Prasher, Richard McCann and William Lorenz found a way to produce two proteins–Aequorin and Luciferase–using E. coli. Their discoveries enabled the industrial-scale production of these critical proteins, and now, less than 30 years later, bioluminescent proteins are used in many branches of medicine and industry. They serve as indicators for reporter genes, a kind of tag used to see the expression of certain genes in an organism. Their fluorescent glow makes it possible to trace infections, cancer progression, brain function and the development of nerve cells. Bioluminescent proteins are also used to evaluate the effectiveness of new cancer treatments designed to limit blood flow to tumors. The scientists did their work during the 1980s, well before the aid of the now ubiquitous computational and robotic tools, as part of UGA’s newly formed department of biochemistry and molecular biology.
  • Exposure to Heavy Metal Stress Regulates Intercellular Signaling Via Callose Deposition and Breakdown

    Exposure to Heavy Metal Stress Regulates Intercellular Signaling Via Callose Deposition and Breakdown

    University of Pennsylvania ScholarlyCommons Publicly Accessible Penn Dissertations 2017 Exposure To Heavy Metal Stress Regulates Intercellular Signaling Via Callose Deposition And Breakdown Ruthsabel O'lexy University of Pennsylvania, [email protected] Follow this and additional works at: https://repository.upenn.edu/edissertations Part of the Cell Biology Commons, Genetics Commons, and the Molecular Biology Commons Recommended Citation O'lexy, Ruthsabel, "Exposure To Heavy Metal Stress Regulates Intercellular Signaling Via Callose Deposition And Breakdown" (2017). Publicly Accessible Penn Dissertations. 3057. https://repository.upenn.edu/edissertations/3057 This paper is posted at ScholarlyCommons. https://repository.upenn.edu/edissertations/3057 For more information, please contact [email protected]. Exposure To Heavy Metal Stress Regulates Intercellular Signaling Via Callose Deposition And Breakdown Abstract How organisms sense external cues and integrate them into developmental changes remains a large biological question. Plants, which are sessile organisms, are particularly vulnerable to challenges in their environment. An early response to abiotic and biotic stress in plants is the modification of intercellular signaling through plasmodesmata, cytoplasmic channels that connect adjacent cells. However, the different ways in which plasmodesmata-mediated signaling can be affected, the molecular players involved in this response, the genetic basis of this regulation, and the biological benefits of this esponser are still poorly understood. Here, we take a survey of seven different agriculturally relevant stresses of nutrient starvation and heavy metal contamination, and their effects on plasmodesmata transport in the A. thaliana root. We examine the role of the polysaccharide callose, a known plasmodesmata regulator, in these modifications. Focusing on the conditions of excess iron and copper, we take a genetic approach to identify the genes involved in callose metabolism under these conditions.
  • The Green Fluorescent Protein: Discovery, Expression and Development

    The Green Fluorescent Protein: Discovery, Expression and Development

    8 October 2008 Scientific Background on the Nobel Prize in Chemistry 2008 The green fluorescent protein: discovery, expression and development ____________________________________________________________________________________________________ The Royal Swedish Academy of Sciences, Information Department, Box 50005, SE-104 05 Stockholm, Sweden Phone: +46 8 673 95 00, Fax: +46 8 15 56 70, [email protected], www.kva.se Nobel Prize® and the Nobel Prize® medal design mark are registered trademarks of the Nobel Foundation Background During the 20th century the foundations of biochemistry were laid and used to explore the basal principles of the anabolic and catabolic pathways inside living cells. The 20th century also witnessed a revolution in our understanding of enzyme function and, through crystal- lography and nuclear magnetic resonance, of protein structures revealed at atomic resolution. During the second half of that century, classical genetics and nucleic-acid chemistry merged into modern genomics, based on whole-genome sequencing of an ever increasing number of organisms. This genetics revolution, supported by bioinformatics and other auxiliary tech- niques, has had an impact in many areas of the biological sciences, with practical conse- quences for medicine, pharmacy and ecology. However, neither the biochemical nor the ge- netics revolution provided the experimental tools that would allow for quantitative and ex- perimentally well-defined monitoring at the molecular level of the spatio-temporal intra- and inter-cellular processes that define the dynamic behaviour of all living systems. To obtain such knowledge, new experimental and conceptual tools were required. Now, at the begin- ning of the 21st century, we are witnessing the rapid development of such tools based on the green fluorescent protein (GFP) from the jellyfish Aequorea victoria, its siblings from other organisms and engineered variants of members of the “GFP family” of proteins.