The Emerging Roles of RNA Modifications in Glioblastoma
Total Page:16
File Type:pdf, Size:1020Kb
Load more
Recommended publications
-
SRC Antibody - N-Terminal Region (ARP32476 P050) Data Sheet
SRC antibody - N-terminal region (ARP32476_P050) Data Sheet Product Number ARP32476_P050 Product Name SRC antibody - N-terminal region (ARP32476_P050) Size 50ug Gene Symbol SRC Alias Symbols ASV; SRC1; c-SRC; p60-Src Nucleotide Accession# NM_005417 Protein Size (# AA) 536 amino acids Molecular Weight 60kDa Product Format Lyophilized powder NCBI Gene Id 6714 Host Rabbit Clonality Polyclonal Official Gene Full Name V-src sarcoma (Schmidt-Ruppin A-2) viral oncogene homolog (avian) Gene Family SH2D This is a rabbit polyclonal antibody against SRC. It was validated on Western Blot by Aviva Systems Biology. At Aviva Systems Biology we manufacture rabbit polyclonal antibodies on a large scale (200-1000 Description products/month) of high throughput manner. Our antibodies are peptide based and protein family oriented. We usually provide antibodies covering each member of a whole protein family of your interest. We also use our best efforts to provide you antibodies recognize various epitopes of a target protein. For availability of antibody needed for your experiment, please inquire (). Peptide Sequence Synthetic peptide located within the following region: QTPSKPASADGHRGPSAAFAPAAAEPKLFGGFNSSDTVTSPQRAGPLAGG This gene is highly similar to the v-src gene of Rous sarcoma virus. This proto-oncogene may play a role in the Description of Target regulation of embryonic development and cell growth. SRC protein is a tyrosine-protein kinase whose activity can be inhibited by phosphorylation by c-SRC kinase. Mutations in this gene could be involved in the -
Genetic Screens in Isogenic Mammalian Cell Lines Without Single Cell Cloning
ARTICLE https://doi.org/10.1038/s41467-020-14620-6 OPEN Genetic screens in isogenic mammalian cell lines without single cell cloning Peter C. DeWeirdt1,2, Annabel K. Sangree1,2, Ruth E. Hanna1,2, Kendall R. Sanson1,2, Mudra Hegde 1, Christine Strand 1, Nicole S. Persky1 & John G. Doench 1* Isogenic pairs of cell lines, which differ by a single genetic modification, are powerful tools for understanding gene function. Generating such pairs of mammalian cells, however, is labor- 1234567890():,; intensive, time-consuming, and, in some cell types, essentially impossible. Here, we present an approach to create isogenic pairs of cells that avoids single cell cloning, and screen these pairs with genome-wide CRISPR-Cas9 libraries to generate genetic interaction maps. We query the anti-apoptotic genes BCL2L1 and MCL1, and the DNA damage repair gene PARP1, identifying both expected and uncharacterized buffering and synthetic lethal interactions. Additionally, we compare acute CRISPR-based knockout, single cell clones, and small- molecule inhibition. We observe that, while the approaches provide largely overlapping information, differences emerge, highlighting an important consideration when employing genetic screens to identify and characterize potential drug targets. We anticipate that this methodology will be broadly useful to comprehensively study gene function across many contexts. 1 Genetic Perturbation Platform, Broad Institute of MIT and Harvard, 75 Ames Street, Cambridge, MA 02142, USA. 2These authors contributed equally: Peter C. DeWeirdt, -
Download Ji Calendar Educator Guide
xxx Contents The Jewish Day ............................................................................................................................... 6 A. What is a day? ..................................................................................................................... 6 B. Jewish Days As ‘Natural’ Days ........................................................................................... 7 C. When does a Jewish day start and end? ........................................................................... 8 D. The values we can learn from the Jewish day ................................................................... 9 Appendix: Additional Information About the Jewish Day ..................................................... 10 The Jewish Week .......................................................................................................................... 13 A. An Accompaniment to Shabbat ....................................................................................... 13 B. The Days of the Week are all Connected to Shabbat ...................................................... 14 C. The Days of the Week are all Connected to the First Week of Creation ........................ 17 D. The Structure of the Jewish Week .................................................................................... 18 E. Deeper Lessons About the Jewish Week ......................................................................... 18 F. Did You Know? ................................................................................................................. -
Recent Advances of M6a Methylation Modification in Esophageal Squamous Cell Carcinoma
Zhang et al. Cancer Cell Int (2021) 21:421 https://doi.org/10.1186/s12935-021-02132-2 Cancer Cell International REVIEW Open Access Recent advances of m6A methylation modifcation in esophageal squamous cell carcinoma Xiaoqing Zhang1†, Ning Lu1†, Li Wang2†, Yixuan Wang1, Minna Li1, Ying Zhou3, Manli Cui1*, Mingxin Zhang1,3* and Lingmin Zhang4* Abstract In recent years, with the development of RNA sequencing technology and bioinformatics methods, the epigenetic modifcation of RNA based on N6-methyladenosine (m6A) has gradually become a research hotspot in the feld of bioscience. m6A is the most abundant internal modifcation in eukaryotic messenger RNAs (mRNAs). m6A methylation modifcation can dynamically and reversibly regulate RNA transport, localization, translation and degradation through the interaction of methyltransferase, demethylase and reading protein. m6A methylation can regulate the expression of proto-oncogenes and tumor suppressor genes at the epigenetic modifcation level to afect tumor occurrence and metastasis. The morbidity and mortality of esophageal cancer (EC) are still high worldwide. Esophageal squamous cell carcinoma (ESCC) is the most common tissue subtype of EC. This article reviews the related concepts, biological functions and recent advances of m6A methylation in ESCC, and looks forward to the prospect of m6A methylation as a new diagnostic biomarker and potential therapeutic target for ESCC. Keywords: N6-methyladenosine, Methylation, Esophageal squamous cell carcinoma Introduction surgical resection, combined radiotherapy and chemo- Esophageal cancer (EC) is one of the most invasive malig- therapy have improved the prognosis of patients with nant tumors of digestive tract in the world, and its mor- ESCC, the 5-year overall survival rate is still very low [5], bidity and mortality are still high in China [1]. -
March 2021 Adar / Nisan 5781
March 2021 Adar / Nisan 5781 www.ti-stl.org Congregation Temple Israel is an inclusive community that supports your unique Jewish journey. TEMPLE NEWS SHABBAT WORSHIP SCHEDULE HIAS REFUGEE SHABBAT SERVICES WORSHIP SERVICE SCHEDULE Friday, March 5 @ 6:30 PM Throughout the month of March, Shabbat services will Temple Israel will be a proud participant in HIAS’ Refugee be available online only. Join us and watch services Shabbat, during which Jews in the United States and around the remotely on our website or on our Facebook page, where world will take action for refugees and asylum seekers. you can connect with other viewers in the comments section. Founded as the Hebrew Immigrant Aid Society in 1881 to assist Jews fleeing persecution in Russia and Eastern Europe, HIAS’s work is rooted in Jewish values and the belief that anyone fleeing WATCH SERVICES ONLINE hatred, bigotry and xenophobia, regardless of their faith or Services on our website: ethnicity, should be provided with a safe refuge. www.ti-stl.org/Watch Services on our Facebook page: Over the Shabbat of March 5-6, 2021, the Jewish community www.facebook.com/TempleIsraelStLouis will dedicate sacred time and space to refugees and asylum seekers. Now in its third year with hundreds of congregations and thousands of individuals participating, this Refugee Shabbat SERVICE SCHEDULE & PARSHA will be an opportunity to once again raise awareness in our 6:00 pm Weekly Pre-Oneg on Zoom communities, to recognize the work that has been done, and to (Link shared in our eNews each week.) reaffirm our commitment to welcoming refugees and asylum seekers. -
Pseudouridine Synthase 1: a Site-Specific Synthase Without Strict Sequence Recognition Requirements Bryan S
View metadata, citation and similar papers at core.ac.uk brought to you by CORE provided by PubMed Central Published online 18 November 2011 Nucleic Acids Research, 2012, Vol. 40, No. 5 2107–2118 doi:10.1093/nar/gkr1017 Pseudouridine synthase 1: a site-specific synthase without strict sequence recognition requirements Bryan S. Sibert and Jeffrey R. Patton* Department of Pathology, Microbiology and Immunology, University of South Carolina, School of Medicine, Columbia, SC 29208 USA Received May 20, 2011; Revised October 19, 2011; Accepted October 22, 2011 ABSTRACT rRNA and snRNA and requires Dyskerin or its homologs Pseudouridine synthase 1 (Pus1p) is an unusual (Cbf5p in yeast for example) and RNP cofactors [most site-specific modification enzyme in that it can often H/ACA small nucleolar ribonucleoprotein particles modify a number of positions in tRNAs and can rec- (snoRNPs)] that enable one enzyme to recognize many ognize several other types of RNA. No consensus different sites for modification on different substrates recognition sequence or structure has been identi- (17–25). The other pathway for É formation employs fied for Pus1p. Human Pus1p was used to determine site-specific É synthases that require no cofactors to rec- which structural or sequence elements of human ognize and modify the RNA substrate. A number of en- tRNASer are necessary for pseudouridine ()) forma- zymes have been identified in this pathway and are grouped in six families that all share a common basic tion at position 28 in the anticodon stem-loop (ASL). Ser structure (4). It is safe to say the cofactor ‘guided’ pathway Some point mutations in the ASL stem of tRNA has received a great deal of attention because of its simi- had significant effects on the levels of modification larity to aspects of RNA editing, but the site-specific and compensatory mutation, to reform the base pseudouridine synthases accomplish the same task, on pair, restored a wild-type level of ) formation. -
A Computational Approach for Defining a Signature of Β-Cell Golgi Stress in Diabetes Mellitus
Page 1 of 781 Diabetes A Computational Approach for Defining a Signature of β-Cell Golgi Stress in Diabetes Mellitus Robert N. Bone1,6,7, Olufunmilola Oyebamiji2, Sayali Talware2, Sharmila Selvaraj2, Preethi Krishnan3,6, Farooq Syed1,6,7, Huanmei Wu2, Carmella Evans-Molina 1,3,4,5,6,7,8* Departments of 1Pediatrics, 3Medicine, 4Anatomy, Cell Biology & Physiology, 5Biochemistry & Molecular Biology, the 6Center for Diabetes & Metabolic Diseases, and the 7Herman B. Wells Center for Pediatric Research, Indiana University School of Medicine, Indianapolis, IN 46202; 2Department of BioHealth Informatics, Indiana University-Purdue University Indianapolis, Indianapolis, IN, 46202; 8Roudebush VA Medical Center, Indianapolis, IN 46202. *Corresponding Author(s): Carmella Evans-Molina, MD, PhD ([email protected]) Indiana University School of Medicine, 635 Barnhill Drive, MS 2031A, Indianapolis, IN 46202, Telephone: (317) 274-4145, Fax (317) 274-4107 Running Title: Golgi Stress Response in Diabetes Word Count: 4358 Number of Figures: 6 Keywords: Golgi apparatus stress, Islets, β cell, Type 1 diabetes, Type 2 diabetes 1 Diabetes Publish Ahead of Print, published online August 20, 2020 Diabetes Page 2 of 781 ABSTRACT The Golgi apparatus (GA) is an important site of insulin processing and granule maturation, but whether GA organelle dysfunction and GA stress are present in the diabetic β-cell has not been tested. We utilized an informatics-based approach to develop a transcriptional signature of β-cell GA stress using existing RNA sequencing and microarray datasets generated using human islets from donors with diabetes and islets where type 1(T1D) and type 2 diabetes (T2D) had been modeled ex vivo. To narrow our results to GA-specific genes, we applied a filter set of 1,030 genes accepted as GA associated. -
Longitudinal Peripheral Blood Transcriptional Analysis of COVID-19 Patients
medRxiv preprint doi: https://doi.org/10.1101/2020.05.05.20091355; this version posted May 8, 2020. The copyright holder for this preprint (which was not certified by peer review) is the author/funder, who has granted medRxiv a license to display the preprint in perpetuity. All rights reserved. No reuse allowed without permission. 1 Longitudinal peripheral blood transcriptional analysis of COVID-19 patients 2 captures disease progression and reveals potential biomarkers 3 Qihong Yan1,5,†, Pingchao Li1,†, Xianmiao Ye1,†, Xiaohan Huang1,5,†, Xiaoneng Mo2, 4 Qian Wang1, Yudi Zhang1, Kun Luo1, Zhaoming Chen1, Jia Luo1, Xuefeng Niu3, Ying 5 Feng3, Tianxing Ji3, Bo Feng3, Jinlin Wang2, Feng Li2, Fuchun Zhang2, Fang Li2, 6 Jianhua Wang1, Liqiang Feng1, Zhilong Chen4,*, Chunliang Lei2,*, Linbing Qu1,*, Ling 7 Chen1,2,3,4,* 8 1Guangzhou Regenerative Medicine and Health-Guangdong Laboratory 9 (GRMH-GDL), Guangdong Laboratory of Computational Biomedicine, Guangzhou 10 Institutes of Biomedicine and Health, Chinese Academy of Sciences, Guangzhou, 11 China 12 2Guangzhou Institute of Infectious Disease, Guangzhou Eighth People’s Hospital, 13 Guangzhou Medical University, Guangzhou, China 14 3State Key Laboratory of Respiratory Disease, National Clinical Research Center for 15 Respiratory Disease, Guangzhou Institute of Respiratory Health, the First Affiliated 16 Hospital of Guangzhou Medical University, Guangzhou, China 17 4School of Medicine, Huaqiao University, Xiamen, China 18 5University of Chinese Academy of Science, Beijing, China 19 †These authors contributed equally to this work. 20 *To whom correspondence should be addressed: Ling Chen ([email protected]), 21 Linbing Qu ([email protected]), Chunliang Lei ([email protected]), Zhilong 22 Chen ([email protected]) NOTE: This preprint reports new research that has not been certified by peer review and should not be used to guide clinical practice. -
Passover Guide & March 2021
VIRTUAL SEDERS MARCH 27 5:00PM MARCH 28 5:00PM PAGE 3 PASSOVER GUIDE & MARCH 2021 ADAR / NISSAN1 5781 BULLETIN A MESSAGE FOR PASSOVER A Message for Passover Every year we remind the participants at the Passover table that the recounting of the experience is a “Haggadah,” a telling, and not a “Kriyah,” a reading. What’s the difference? A reading is simply going by the script of what’s on the page. A telling, on the other hand, requires both creativity, and the art, making the story pop. While the words on the page of the Haggadah have been the basis for the Passover Seder for thousands of years, they are merely jumping off points for rituals, conversations, and teaching the Passover narrative to our children and to each other. Taking part in a fulfilling Seder isn’t about reading every word on the page, but rather making the words that you do read come to life. Look no further than the famous Haggadah section of the Four Children to remind us of our responsibility to make the Seder interesting for every kind of participant. The Haggadah offers us four different types of Seder guests, the wise one, the rebellious one, the simple one, and the one who doesn’t know how to ask. We are given guidelines for how to explain the meaning of Passover to each of them. The four children remind us that each type of person at the table requires a different type of experience, and it’s the leader’s job to make the narrative relevant for each of them. -
Investigation of Overhauser Effects Between Pseudouridine and Water Protons in RNA Helices
Investigation of Overhauser effects between pseudouridine and water protons in RNA helices Meredith I. Newby* and Nancy L. Greenbaum*†‡ *Department of Chemistry and Biochemistry and †Institute of Molecular Biophysics, Florida State University, Tallahassee, FL 32306-4390 Communicated by Michael Kasha, Florida State University, Tallahassee, FL, August 8, 2002 (received for review July 2, 2002) The inherent chemical properties of RNA molecules are expanded by posttranscriptional modification of specific nucleotides. Pseudouridine (), the most abundant of the modified bases, features an additional imino group, NH1, as compared with uri- dine. When forms a Watson–Crick base pair with adenine in an RNA helix, NH1 is positioned within the major groove. The pres- ence of often increases thermal stability of the helix or loop in which it is found [Hall, K. B. & McLaughlin, L. (1992) Nucleic Acids Res. 20, 1883–1889]. X-ray crystal structures of transfer RNAs [e.g., Arnez, J. & Steitz, T. (1994) Biochemistry 33, 7560–7567] have depicted water molecules bridging NH1 groups and nearby phos- phate oxygen atoms, but direct evidence for this interaction in solution has not been acquired. Toward this end, we have used a rotating-frame Overhauser effect spectroscopy-type NMR pulse sequence with a CLEAN chemical-exchange spectroscopy spin-lock pulse train [Hwang, T.-L., Mori, S., Shaka, A. J. & van Zijl, P. C. M. Fig. 1. Schematic structures of U and bases. R, ribose. The base is a uracil (1997) J. Am. Chem. Soc. 119, 6203–6204] to test for NH1–water rotated about the 3–6 ring axis, so that is has a COC base–sugar linkage and cross-relaxation effects within two RNA helices: (i) a complemen- an additional protonated ring nitrogen. -
How Asbestos Drives the Tissue Towards Tumors: YAP Activation, Macrophage and Mesothelial Precursor Recruitment, RNA Editing, and Somatic Mutations
Oncogene (2018) 37:2645–2659 https://doi.org/10.1038/s41388-018-0153-z ARTICLE How asbestos drives the tissue towards tumors: YAP activation, macrophage and mesothelial precursor recruitment, RNA editing, and somatic mutations 1 2 3 3 3 4 Hubert Rehrauer ● Licun Wu ● Walter Blum ● Lazslo Pecze ● Thomas Henzi ● Véronique Serre-Beinier ● 1 5 2 3 6 Catherine Aquino ● Bart Vrugt ● Marc de Perrot ● Beat Schwaller ● Emanuela Felley-Bosco Received: 1 September 2017 / Revised: 11 December 2017 / Accepted: 30 December 2017 / Published online: 6 March 2018 © The Author(s) 2018. This article is published with open access Abstract Chronic exposure to intraperitoneal asbestos triggered a marked response in the mesothelium well before tumor development. Macrophages, mesothelial precursor cells, cytokines, and growth factors accumulated in the peritoneal lavage. Transcriptome profiling revealed YAP/TAZ activation in inflamed mesothelium with further activation in tumors, paralleled by increased levels of cells with nuclear YAP/TAZ. Arg1 was one of the highest upregulated genes in inflamed tissue and tumor. Inflamed tissue showed increased levels of single-nucleotide variations, with an RNA-editing signature, which were 1234567890();,: even higher in the tumor samples. Subcutaneous injection of asbestos-treated, but tumor-free mice with syngeneic mesothelioma tumor cells resulted in a significantly higher incidence of tumor growth when compared to naïve mice supporting the role of the environment in tumor progression. Introduction The association of exposure to asbestos with development of mesothelioma has been demonstrated in the seminal experimental work of Wagner in the 1960s [1]. In 1987, Kane and co-workers [2] observed that already a single dose These authors contributed equally: Hubert Rehrauer, Licun Wu. -
Pearls and Forget-Me-Nots in the Management of Retinoblastoma
POSTERIOR SEGMENT ONCOLOGY FEATURE STORY Pearls and Forget-Me-Nots in the Management of Retinoblastoma Retinoblastoma represents approximately 4% of all pediatric malignancies and is the most common intraocular malignancy in children. BY CAROL L. SHIELDS, MD he management of retinoblastoma has gradu- ular malignancy in children.1-3 It is estimated that 250 to ally evolved over the years from enucleation to 300 new cases of retinoblastoma are diagnosed in the radiotherapy to current techniques of United States each year, and 5,000 cases are found world- chemotherapy. Eyes with massive retinoblas- Ttoma filling the globe are still managed with enucleation, TABLE 1. INTERNATIONAL CLASSIFICATION OF whereas those with small, medium, or even large tumors RETINOBLASTOMA (ICRB) can be managed with chemoreduction followed by Group Quick Reference Specific Features tumor consolidation with thermotherapy or cryotherapy. A Small tumor Rb <3 mm* Despite multiple or large tumors, visual acuity can reach B Larger tumor Rb >3 mm* or ≥20/40 in many cases, particularly in eyes with extrafoveal retinopathy, and facial deformities that have Macula Macular Rb location been found following external beam radiotherapy are not (<3 mm to foveola) anticipated following chemoreduction. Recurrence from Juxtapapillary Juxtapapillary Rb location subretinal and vitreous seeds can be problematic. Long- (<1.5 mm to disc) term follow-up for second cancers is advised. Subretinal fluid Rb with subretinal fluid Most of us can only remember a few interesting points C Focal seeds Rb with: from a lecture, even if was delivered by an outstanding, Subretinal seeds <3 mm from Rb colorful speaker. Likewise, we generally retain only a small and/or percentage of the information that we read, even if writ- Vitreous seeds <3 mm ten by the most descriptive or lucent author.