DOCSLIB.ORG

9 Molecular Biology of Hearing and Deafness

Total Page：16

File Type：pdf, Size：1020Kb

Download full-text PDF Read full-text
9 Molecular Biology of Hearing and Deafness Welcome to the 9th Molecular Biology of Hearing and Deafness Conference June 22 – 25, 2013 Li Ka Shing Center for Learning and Knowledge, Palo Alto, CA • Stanford University i Acknowledgements We would like to thank the following sponsors for their support of this conference. Their generous financial support makes this conference possible. ii 9th Molecular Biology of Hearing and Deafness Conference PROGRAM Saturday, June 22 Page 3:00 - 5:30 PM Registration 4:00 PM Welcome Reception 5:00 PM Opening Keynote: A bright future for research on communication 1 and communication disorders, James F. Battey, Jr. 6:00 PM Adjourn Sunday, June 23 Page 8:00 AM Registration and Breakfast 8:55 AM Welcome to Stanford School of Medicine, Lloyd Minor 9:00 AM Keynote: Genomics for personalized medicine and human health, 2 Michael Snyder 9:30 AM Genetic testing for deafness: The future is now, Richard J.H. Smith 3 9:45 AM Identification of the gene causing nonsyndromic deafness DFNB86, 4 Atteeq Rehman 10:00 AM “A complex strategy for complex traits”: identification of new genes 5 involved in hearing function and age-related hearing loss, Giorgia Girotto 10:15 AM How much of nonsyndromic deafness is actually syndromic? Thomas B. 6 Friedman 10:30 AM Break & Posters - Group 1 iii Sunday, June 23 Page 11:00 AM Targeted exon capture and massive parallel sequencing identifies the 7 mutated genes in chinese deaf families, Huijun Yuan 11:15 AM Sound encoding: From molecular physiology to disease and restoration, 8 Tobias Moser 11:30 AM Composition and function of the synaptic ribbon, Albena Kantardzhieva 9 11:45 AM Lack of brain-derived neurotrophic factor in the cochlea but not in the 10 brain hampers inner hair cell synapse physiology, but protects against noise induced afferent fiber loss, Marlies Knipper 12:00 PM Cochlea spiral ganglion cell degeneration and hearing loss as a 11 consequence of satellite cell death in saposin B KO mice, Lawrence R. Lustig 12:15 PM Lunch & Posters – Group 1 1:30 PM The auditory hair bundle: genetics as a gateway to the understanding of 12 its multifaceted properties, Christine Petit 1:45 PM The mechanotransduction machinery of hair cells, Ulrich Mueller 13 2:00 PM Hair cell mechanotransducer adaptation is not driven by calcium entry 14 in mammalian auditory hair cells, Anthony J. Ricci 2:15 PM The function of transmembrane channel-like genes 1 and 2 in 15 mammalian hair cell mechanotransduction, Jeffrey R. Holt 2:30 PM The role of transmembrane channel-like proteins in cochlear hair cell 16 transduction, Robert Fettiplace 2:45 PM FGFR1 signalling assembles a kinocilia-specific transport particle to 17 traffic protocadherin-15 during inner ear hair cell specialization, Raj K. Ladher 3:00 PM Break & Posters – Group 1 iv Sunday, June 23 Page 3:30 PM Genome-wide association study for age-related hearing loss in the 18 mouse: A meta-analysis, Rick Friedman 3:45 PM Genetic variation in ESRRG is associated with adult hearing status in 19 humans and its targeted deletion causes hearing loss in mice, Lisa S. Nolan 4:00 PM Exome sequencing fills missing pieces of the auditory puzzle: 20 implications for deafness, Karen B. Avraham 4:15 PM A Y-linked form of hereditary hearing loss in an Italian family, 21 Mariateresa Di Stazio 4:30 PM Mutation of HOMER2 causes autosomal dominant non-syndromic 22 hearing loss, Hela Azaiez 4:45 PM Supporting diagnostics for hearing loss through next-generation 23 sequencing and community data sharing, Heidi Rehm 5:00 PM Screening strategy for molecular diagnosis of deafness: From social 24 health insurance based screening to massively parallel DNA sequencing, Shin-Ichi Usami 5:15 PM GJB2 testing of infants with sensorineural hearing loss, Mariia Lalayants 25 5:30 PM Adjourn Monday, June 24 Page 8:00 AM Registration and Breakfast 8:55 AM Organizational announcements 9:00 AM Keynote: Population genetics in the personal genome era, Carlos D. 26 Bustamante 9:30 AM Proteins of the hair bundle, Peter Barr-Gillespie 27 v Monday, June 24 Page 9:45 AM CLIC5 interacts with taperin at the base of stereocilia, Inna A. 28 Belyantseva 10:00 AM Ectopically expressed Tectb localises to the distal tips of sensory hair 29 bundles, Guy Richardson 10:15 AM Defects in protein complex assembly and ER stress as the proximal 30 cause of Usher Syndrome, Monte Westerfield 10:30 AM Break & Posters – Group 2 11:00 AM Genomic and pharmacological studies suggest multiple roles for Notch 31 signaling in the avian inner ear, Mark Warchol 11:15 AM Notch inhibition generates hair cells in the adult mouse crista, Olivia 32 Bermingham-McDonogh 11:30 AM Single cell transcriptional profiling of native otocyst cells and 33 comparison with in vitro generated murine otic progenitor cells, Robert Durruthy-Durruthy 11:45 AM Morphogen gradients regulate tonotopic identity along the chick basilar 34 papilla, Matthew Kelley 12:00 PM Identification of four novel genome-wide significant loci in sporadic 35 Meniere’s disease, Jose A. Lopez-Escamez 12:15 PM Lunch & Posters – Group 2 1:30 PM Sema3f-Nrp2 interactions control spiral ganglion neuron targeting to 36 inner hair cells, Thomas M. Coate 1:45 PM Wbp2-deficient mice show progressive high-frequency hearing loss 37 and abnormal cochlear innervation, Karen Steel 2:00 PM Cochlear gene expression differences in Diap3 (Diaphanous-homolog- 38 3) transgenic mice, Marci M. Lesperance 2:15 PM ErbB signaling within Schwann cells controls quiescence of zebrafish 39 mechanosensory progenitor cells through regulation of Wnt and FGF signaling, Mark Lush vi Monday, June 24 Page 2:30 PM ILDR1 is required for inner ear and neuromast development in 40 zebrafish, Qing Sang 2:45 PM Epigenetic regulation of Atoh1 expression during development and 41 regeneration of the mouse Organ of Corti, Zlatka P. Stojanova 3:00 PM Break & Posters – Group 2 3:30 PM FGF signaling in Muenke syndrome model hearing loss and rescue, 42 Suzanne L. Mansour 3:45 PM Concomitant differentiation of mouse embryonic stem cells into 43 neuron-like cells and schwann cell-like cells in a microfluidic device to develop approaches for functional repair of the inner ear, Kate F. Barald 4:00 PM Phage display discovery of rare peptides to support drug transport 44 through the tympanic membrane, Allen Ryan 4:15 PM Gene expression in the postnatal cochlea in hearing and deafened rats, 45 Steven Green 4:30 PM Proteome biology of noise induced hearing loss, Jeffrey Savas 46 4:45 PM Neurotrophin gene therapy via electroporation enhances the cochlear 47 implant neural interface, Gary D. Housley 5:00 PM In vivo reprogramming of inner border and phalangeal cells to the 48 inner hair cell fate by ectopic Atoh1 expression in the postnatal mouse cochlea, Jian Zuo 5:15 PM Adjourn 6:30 PM Banquet at Cantor Art Museum (Museum opens at 6:00 PM) 9:30 PM Adjourn Tuesday, June 25 Page 8:00 AM Registration and Breakfast 8:55 AM Organizational announcements vii Tuesday, June 25 Page 9:00 AM The tetraspan TMHS binds PCDH15 and regulates mechanotransduction 49 in cochlear hair cells, Wei Xiong 9:15AM Acf7 is a hair-bundle antecedent, positioned to integrate 50 cuticular plate actin and somatic tubulin, Brian McDermott 9:30 AM Localization of stereocilia proteins by structured illumination 51 microscopy (SIM), Matthew Avenarius 9:45 AM Genetic dissection of the vibratory modes of the organ of Corti 52 using in vivo imaging, John S. Oghalai 10:00 AM Ensemble and single molecule kinetics of purified myosin-15 53 demonstrate it is a bona-fide molecular motor specialized for transport within stereocilia, Jonathan E. Bird 10:15 AM Tricellulin integrates bicellular and tricellular tight junctions into 54 a functional complex essential for cochlear hair cell survival, Saima Riazuddin 10:30 AM Break 11:00 AM Expression profiling of FACS-sorted hair cells with deep 55 sequencing leads to the identification of a stereociliary actin- binding protein, Déborah Scheffer 11:15 AM Pitch: A model of sensorineural deafness identifies Neuroplastin 56 as essential for inner hair cell maturation and function, Lea Carrott 11:30 AM Gene expression profiling of young and adult mouse cochlea by 57 RNA-Seq in strains with normal and age-related hearing loss, Anne Giersch 11:45 AM MET channel-independent uptake of aminoglycosides by cochlear 58 hair cells, Hongzhe Li 12:00 PM Following intracellular calcium during aminoglycoside-induced 59 hair cell death, David Raible 12:15 PM Business Meeting 12:30 PM Final Adjournment viii A BRIGHT FUTURE FOR RESEARCH ON COMMUNICATION AND COMMUNICATION DISORDERS JAMES F. BATTEY, JR. NIDCD The National Institutes on Deafness and Other Communication Disorders (NIDCD) is one of 27 Institutes and Centers that comprise the National Institutes of Health. This presentation will highlight research progress in the seven mission areas relevant to the Institute: hearing, balance, smell, taste, voice, speech, and language. Even in a constrained Federal budget environment, the research community supported by NIDCD continues to make remarkable progress towards achieving a better understanding of human communication and its disorders. 1 GENOMICS FOR PERSONALIZED MEDICINE AND HUMAN HEALTH 1 1 RAJINI R. HARAKSINGH, FERESHTEH JAHANIANI KENARI, JUAN RODRIGUEZ- 2 3 4 5 PARIS, JOEL GELERNTER, KARI C. NADEAU, JOHN S. OGHALAI, IRIS 2,4 1 SCHRIJVER, AND MICHAEL P. SNYDER 1 Department of Genetics, Stanford University School of Medicine, Stanford, California, USA. 2 Department of Pathology, Stanford University School of Medicine, Stanford, California, USA. 3 Department of Psychiatry, Yale University School of Medicine, New Haven, CT, USA. 4 Department of Pediatrics, Stanford University School of Medicine, Stanford, CA 94305, USA.
Load more

Recommended publications
  • Natural Genetic Variation Screen in Drosophila Identifies
    INVESTIGATION Natural Genetic Variation Screen in Drosophila Identifies Wnt Signaling, Mitochondrial Metabolism, and Redox Homeostasis Genes as Modifiers of Apoptosis Rebecca A. S. Palu,*,1 Elaine Ong,* Kaitlyn Stevens,* Shani Chung,* Katie G. Owings,* Alan G. Goodman,†,‡ and Clement Y. Chow*,2 *Department of Human Genetics, University of Utah School of Medicine, Salt Lake City, UT 84112, †School of Molecular Biosciences, and ‡Paul G. Allen School for Global Animal Health, Washington State University College of Veterinary Medicine, Pullman, WA 99164 ORCID IDs: 0000-0001-9444-8815 (R.A.S.P.); 0000-0001-6394-332X (A.G.G.); 0000-0002-3104-7923 (C.Y.C.) ABSTRACT Apoptosis is the primary cause of degeneration in a number of neuronal, muscular, and KEYWORDS metabolic disorders. These diseases are subject to a great deal of phenotypic heterogeneity in patient apoptosis populations, primarily due to differences in genetic variation between individuals. This creates a barrier to Drosophila effective diagnosis and treatment. Understanding how genetic variation influences apoptosis could lead to genetic variation the development of new therapeutics and better personalized treatment approaches. In this study, we modifier genes examine the impact of the natural genetic variation in the Drosophila Genetic Reference Panel (DGRP) on two models of apoptosis-induced retinal degeneration: overexpression of p53 or reaper (rpr). We identify a number of known apoptotic, neural, and developmental genes as candidate modifiers of degeneration. We also use Gene Set Enrichment Analysis (GSEA) to identify pathways that harbor genetic variation that impact these apoptosis models, including Wnt signaling, mitochondrial metabolism, and redox homeostasis. Fi- nally, we demonstrate that many of these candidates have a functional effect on apoptosis and degener- ation.
    [Show full text]
  • Tag-SNP Analysis of the GFI1-EVI5-RPL5-FAM69 Risk Locus
    Tag-SNP analysis of the GFI1-EVI5-RPL5-FAM69 risk locus for multiple sclerosis Fuencisla Matesanz, Antonio Alcina, Oscar Fernández, Juan R González, Antonio Catalá-Rabasa, Maria Fedetz, Dorothy Ndagire, Laura Leyva, Miguel Guerrero, Carmen Arnal, et al. To cite this version: Fuencisla Matesanz, Antonio Alcina, Oscar Fernández, Juan R González, Antonio Catalá-Rabasa, et al.. Tag-SNP analysis of the GFI1-EVI5-RPL5-FAM69 risk locus for multiple sclerosis. Eu- ropean Journal of Human Genetics, Nature Publishing Group, 2010, n/a (n/a), pp.n/a-n/a. 10.1038/ejhg.2009.240. hal-00504138 HAL Id: hal-00504138 https://hal.archives-ouvertes.fr/hal-00504138 Submitted on 20 Jul 2010 HAL is a multi-disciplinary open access L’archive ouverte pluridisciplinaire HAL, est archive for the deposit and dissemination of sci- destinée au dépôt et à la diffusion de documents entific research documents, whether they are pub- scientifiques de niveau recherche, publiés ou non, lished or not. The documents may come from émanant des établissements d’enseignement et de teaching and research institutions in France or recherche français ou étrangers, des laboratoires abroad, or from public or private research centers. publics ou privés. 1 Tag-SNP analysis of the GFI1-EVI5-RPL5-FAM69 risk 2 locus for multiple sclerosis 3 A Alcina 1, O Fernández 2 , JR Gonzalez3, A Catalá-Rabasa 1, M Fedetz 1, D Ndagire 1, L 4 Leyva2, M Guerrero 2, C Arnal 4, C Delgado5, M Lucas 6, G Izquierdo 7, F Matesanz 1 5 Authors’ Affiliation: 6 1 Instituto de Parasitología y Biomedicina “López Neyra”.
    [Show full text]
  • Nº Ref Uniprot Proteína Péptidos Identificados Por MS/MS 1 P01024
    Document downloaded from http://www.elsevier.es, day 26/09/2021. This copy is for personal use. Any transmission of this document by any media or format is strictly prohibited. Nº Ref Uniprot Proteína Péptidos identificados 1 P01024 CO3_HUMAN Complement C3 OS=Homo sapiens GN=C3 PE=1 SV=2 por 162MS/MS 2 P02751 FINC_HUMAN Fibronectin OS=Homo sapiens GN=FN1 PE=1 SV=4 131 3 P01023 A2MG_HUMAN Alpha-2-macroglobulin OS=Homo sapiens GN=A2M PE=1 SV=3 128 4 P0C0L4 CO4A_HUMAN Complement C4-A OS=Homo sapiens GN=C4A PE=1 SV=1 95 5 P04275 VWF_HUMAN von Willebrand factor OS=Homo sapiens GN=VWF PE=1 SV=4 81 6 P02675 FIBB_HUMAN Fibrinogen beta chain OS=Homo sapiens GN=FGB PE=1 SV=2 78 7 P01031 CO5_HUMAN Complement C5 OS=Homo sapiens GN=C5 PE=1 SV=4 66 8 P02768 ALBU_HUMAN Serum albumin OS=Homo sapiens GN=ALB PE=1 SV=2 66 9 P00450 CERU_HUMAN Ceruloplasmin OS=Homo sapiens GN=CP PE=1 SV=1 64 10 P02671 FIBA_HUMAN Fibrinogen alpha chain OS=Homo sapiens GN=FGA PE=1 SV=2 58 11 P08603 CFAH_HUMAN Complement factor H OS=Homo sapiens GN=CFH PE=1 SV=4 56 12 P02787 TRFE_HUMAN Serotransferrin OS=Homo sapiens GN=TF PE=1 SV=3 54 13 P00747 PLMN_HUMAN Plasminogen OS=Homo sapiens GN=PLG PE=1 SV=2 48 14 P02679 FIBG_HUMAN Fibrinogen gamma chain OS=Homo sapiens GN=FGG PE=1 SV=3 47 15 P01871 IGHM_HUMAN Ig mu chain C region OS=Homo sapiens GN=IGHM PE=1 SV=3 41 16 P04003 C4BPA_HUMAN C4b-binding protein alpha chain OS=Homo sapiens GN=C4BPA PE=1 SV=2 37 17 Q9Y6R7 FCGBP_HUMAN IgGFc-binding protein OS=Homo sapiens GN=FCGBP PE=1 SV=3 30 18 O43866 CD5L_HUMAN CD5 antigen-like OS=Homo
    [Show full text]
  • Genetic and Functional Approaches to Understanding Autoimmune and Inflammatory Pathologies
    University of Vermont ScholarWorks @ UVM Graduate College Dissertations and Theses Dissertations and Theses 2020 Genetic And Functional Approaches To Understanding Autoimmune And Inflammatory Pathologies Abbas Raza University of Vermont Follow this and additional works at: https://scholarworks.uvm.edu/graddis Part of the Genetics and Genomics Commons, Immunology and Infectious Disease Commons, and the Pathology Commons Recommended Citation Raza, Abbas, "Genetic And Functional Approaches To Understanding Autoimmune And Inflammatory Pathologies" (2020). Graduate College Dissertations and Theses. 1175. https://scholarworks.uvm.edu/graddis/1175 This Dissertation is brought to you for free and open access by the Dissertations and Theses at ScholarWorks @ UVM. It has been accepted for inclusion in Graduate College Dissertations and Theses by an authorized administrator of ScholarWorks @ UVM. For more information, please contact [email protected]. GENETIC AND FUNCTIONAL APPROACHES TO UNDERSTANDING AUTOIMMUNE AND INFLAMMATORY PATHOLOGIES A Dissertation Presented by Abbas Raza to The Faculty of the Graduate College of The University of Vermont In Partial Fulfillment of the Requirements for the Degree of Doctor of Philosophy Specializing in Cellular, Molecular, and Biomedical Sciences January, 2020 Defense Date: August 30, 2019 Dissertation Examination Committee: Cory Teuscher, Ph.D., Advisor Jonathan Boyson, Ph.D., Chairperson Matthew Poynter, Ph.D. Ralph Budd, M.D. Dawei Li, Ph.D. Dimitry Krementsov, Ph.D. Cynthia J. Forehand, Ph.D., Dean of the Graduate College ABSTRACT Our understanding of genetic predisposition to inflammatory and autoimmune diseases has been enhanced by large scale quantitative trait loci (QTL) linkage mapping and genome-wide association studies (GWAS). However, the resolution and interpretation of QTL linkage mapping or GWAS findings are limited.
    [Show full text]
  • 1 Fibrillar Αβ Triggers Microglial Proteome Alterations and Dysfunction in Alzheimer Mouse 1 Models 2 3 4 Laura Sebastian
    bioRxiv preprint doi: https://doi.org/10.1101/861146; this version posted December 2, 2019. The copyright holder for this preprint (which was not certified by peer review) is the author/funder. All rights reserved. No reuse allowed without permission. 1 Fibrillar triggers microglial proteome alterations and dysfunction in Alzheimer mouse 2 models 3 4 5 Laura Sebastian Monasor1,10*, Stephan A. Müller1*, Alessio Colombo1, Jasmin König1,2, Stefan 6 Roth3, Arthur Liesz3,4, Anna Berghofer5, Takashi Saito6,7, Takaomi C. Saido6, Jochen Herms1,4,8, 7 Michael Willem9, Christian Haass1,4,9, Stefan F. Lichtenthaler 1,4,5# & Sabina Tahirovic1# 8 9 1 German Center for Neurodegenerative Diseases (DZNE) Munich, 81377 Munich, Germany 10 2 Faculty of Chemistry, Technical University of Munich, Garching, Germany 11 3 Institute for Stroke and Dementia Research (ISD), Ludwig-Maximilians Universität München, 12 81377 Munich, Germany 13 4 Munich Cluster for Systems Neurology (SyNergy), Munich, Germany 14 5 Neuroproteomics, School of Medicine, Klinikum Rechts der Isar, Technical University of Munich, 15 Munich, Germany 16 6 Laboratory for Proteolytic Neuroscience, RIKEN Center for Brain Science Institute, Wako, 17 Saitama 351-0198, Japan 18 7 Department of Neurocognitive Science, Nagoya City University Graduate School of Medical 19 Science, Nagoya, Aichi 467-8601, Japan 20 8 Center for Neuropathology and Prion Research, Ludwig-Maximilians-Universität München, 81377 21 Munich, Germany 22 9 Biomedical Center (BMC), Ludwig-Maximilians Universität München, 81377 Munich, Germany 23 10 Graduate School of Systemic Neuroscience, Ludwig-Maximilians-University Munich, Munich, 24 Germany. 25 *Contributed equally 26 #Correspondence: [email protected] and [email protected] 27 28 Running title: 29 Microglial proteomic signatures of AD 30 Keywords: Alzheimer’s disease / microglia / proteomic signatures / neuroinflammation / 31 phagocytosis 32 1 bioRxiv preprint doi: https://doi.org/10.1101/861146; this version posted December 2, 2019.
    [Show full text]
  • Supplementary Tables S1-S3
    Supplementary Table S1: Real time RT-PCR primers COX-2 Forward 5’- CCACTTCAAGGGAGTCTGGA -3’ Reverse 5’- AAGGGCCCTGGTGTAGTAGG -3’ Wnt5a Forward 5’- TGAATAACCCTGTTCAGATGTCA -3’ Reverse 5’- TGTACTGCATGTGGTCCTGA -3’ Spp1 Forward 5'- GACCCATCTCAGAAGCAGAA -3' Reverse 5'- TTCGTCAGATTCATCCGAGT -3' CUGBP2 Forward 5’- ATGCAACAGCTCAACACTGC -3’ Reverse 5’- CAGCGTTGCCAGATTCTGTA -3’ Supplementary Table S2: Genes synergistically regulated by oncogenic Ras and TGF-β AU-rich probe_id Gene Name Gene Symbol element Fold change RasV12 + TGF-β RasV12 TGF-β 1368519_at serine (or cysteine) peptidase inhibitor, clade E, member 1 Serpine1 ARE 42.22 5.53 75.28 1373000_at sushi-repeat-containing protein, X-linked 2 (predicted) Srpx2 19.24 25.59 73.63 1383486_at Transcribed locus --- ARE 5.93 27.94 52.85 1367581_a_at secreted phosphoprotein 1 Spp1 2.46 19.28 49.76 1368359_a_at VGF nerve growth factor inducible Vgf 3.11 4.61 48.10 1392618_at Transcribed locus --- ARE 3.48 24.30 45.76 1398302_at prolactin-like protein F Prlpf ARE 1.39 3.29 45.23 1392264_s_at serine (or cysteine) peptidase inhibitor, clade E, member 1 Serpine1 ARE 24.92 3.67 40.09 1391022_at laminin, beta 3 Lamb3 2.13 3.31 38.15 1384605_at Transcribed locus --- 2.94 14.57 37.91 1367973_at chemokine (C-C motif) ligand 2 Ccl2 ARE 5.47 17.28 37.90 1369249_at progressive ankylosis homolog (mouse) Ank ARE 3.12 8.33 33.58 1398479_at ryanodine receptor 3 Ryr3 ARE 1.42 9.28 29.65 1371194_at tumor necrosis factor alpha induced protein 6 Tnfaip6 ARE 2.95 7.90 29.24 1386344_at Progressive ankylosis homolog (mouse)
    [Show full text]
  • Mapping of the Chromosomal Amplification 1P21-22 in Bladder Cancer Mauro Scaravilli1, Paola Asero1, Teuvo LJ Tammela1,2, Tapio Visakorpi1 and Outi R Saramäki1*
    Scaravilli et al. BMC Research Notes 2014, 7:547 http://www.biomedcentral.com/1756-0500/7/547 RESEARCH ARTICLE Open Access Mapping of the chromosomal amplification 1p21-22 in bladder cancer Mauro Scaravilli1, Paola Asero1, Teuvo LJ Tammela1,2, Tapio Visakorpi1 and Outi R Saramäki1* Abstract Background: The aim of the study was to characterize a recurrent amplification at chromosomal region 1p21-22 in bladder cancer. Methods: ArrayCGH (aCGH) was performed to identify DNA copy number variations in 7 clinical samples and 6 bladder cancer cell lines. FISH was used to map the amplicon at 1p21-22 in the cell lines. Gene expression microarrays and qRT-PCR were used to study the expression of putative target genes in the region. Results: aCGH identified an amplification at 1p21-22 in 10/13 (77%) samples. The minimal region of the amplification was mapped to a region of about 1 Mb in size, containing a total of 11 known genes. The highest amplification was found in SCaBER squamous cell carcinoma cell line. Four genes, TMED5, DR1, RPL5 and EVI5,showedsignificant overexpression in the SCaBER cell line compared to all the other samples tested. Oncomine database analysis revealed upregulation of DR1 in superficial and infiltrating bladder cancer samples, compared to normal bladder. Conclusions: In conclusions, we have identified and mapped chromosomal amplification at 1p21-22 in bladder cancer as well as studied the expression of the genes in the region. DR1 was found to be significantly overexpressed in the SCaBER, which is a model of squamous cell carcinoma. However, the overexpression was found also in a published clinical sample cohort of superficial and infiltrating bladder cancers.
    [Show full text]
  • The Evi5 Family in Cellular Physiology and Pathology
    FEBS Letters 587 (2013) 1703–1710 journal homepage: www.FEBSLetters.org Review The Evi5 family in cellular physiology and pathology ⇑ Yi Shan Lim a, Bor Luen Tang a,b, a Department of Biochemistry, Yong Loo Lin School of Medicine, National University Health System, Singapore b NUS Graduate School of Integrative Sciences and Engineering, National University of Singapore, 8 Medical Drive, Singapore 117597, Singapore article info abstract Article history: The Ecotropic viral integration site 5 (Evi5) and Evi5-like (Evi5L) belong to a small subfamily of the Received 25 February 2013 Tre-2/Bub2/Cdc16 (TBC) domain-containing proteins with enigmatically divergent roles as modula- Revised 23 April 2013 tors of cell cycle progression, cytokinesis, and cellular membrane traffic. First recognized as a poten- Accepted 28 April 2013 tial oncogene and a cell cycle regulator, Evi5 acts as a GTPase Activating Protein (GAP) for Rab11 in Available online 10 May 2013 cytokinesis. On the other hand, its homologue Evi5L has Rab-GAP activity towards Rab10 as well as Edited by Lukas Huber Rab23, and has been implicated in primary cilia formation. Recent genetic susceptibility analysis points to Evi5 as an important factor in susceptibility to multiple sclerosis. We discuss below the myriad of cellular functions exhibited by the Evi5 family members, and their associations with dis- Keywords: Cell cycle ease conditions. Evi5 Ó 2013 Federation of European Biochemical Societies. Published by Elsevier B.V. All rights reserved. GTPase Activating Protein (GAP) Rab
    [Show full text]
  • PRODUCT SPECIFICATION Product Datasheet
    Product Datasheet QPrEST PRODUCT SPECIFICATION Product Name QPrEST EVI5L Mass Spectrometry Protein Standard Product Number QPrEST33667 Protein Name EVI5-like protein Uniprot ID Q96CN4 Gene EVI5L Product Description Stable isotope-labeled standard for absolute protein quantification of EVI5-like protein. Lys (13C and 15N) and Arg (13C and 15N) metabolically labeled recombinant human protein fragment. Application Absolute protein quantification using mass spectrometry Sequence (excluding PRKLVVGELQDELMSVRLREAQALAEGRELRQRVVELETQDHIHRNLLNR fusion tag) VEA Theoretical MW 24047 Da including N-terminal His6ABP fusion tag Fusion Tag A purification and quantification tag (QTag) consisting of a hexahistidine sequence followed by an Albumin Binding Protein (ABP) domain derived from Streptococcal Protein G. Expression Host Escherichia coli LysA ArgA BL21(DE3) Purification IMAC purification Purity >90% as determined by Bioanalyzer Protein 230 Purity Assay Isotopic Incorporation >99% Concentration >5 μM after reconstitution in 100 μl H20 Concentration Concentration determined by LC-MS/MS using a highly pure amino acid analyzed internal Determination reference (QTag), CV ≤10%. Amount >0.5 nmol per vial, two vials supplied. Formulation Lyophilized in 100 mM Tris-HCl 5% Trehalose, pH 8.0 Instructions for Spin vial before opening. Add 100 μL ultrapure H2O to the vial. Vortex thoroughly and spin Reconstitution down. For further dilution, see Application Protocol. Shipping Shipped at ambient temperature Storage Lyophilized product shall be stored at -20°C. See COA for expiry date. Reconstituted product can be stored at -20°C for up to 4 weeks. Avoid repeated freeze-thaw cycles. Notes For research use only Product of Sweden. For research use only. Not intended for pharmaceutical development, diagnostic, therapeutic or any in vivo use.
    [Show full text]
  • Thesis Complete Recovered
    Genetic basis of congenital myeloid failure syndromes in mutant zebrafish Thesis submitted for the degree of Doctor of Philosophy By Duncan Peter Carradice Submitted in total fulfillment of the requirements of the degree of Doctor of Philosophy August 2010 Walter & Eliza Hall Institute of Medical Research Affiliated with the University of Melbourne Produced on archival quality paper Abstract Zinc finger and BTB domain containing proteins (BTB-ZF) are transcriptional repressors from a family including members with critical roles in haematopoiesis and oncogenesis. From an N-ethyl-N-nitrosourea (ENU) mutagenesis screen for defects in myeloid development, a zebrafish mutant deficient in cells expressing myeloperoxidase (mpx) designated marsanne (man) was identified. Positional cloning identified that man carried a mutation in zbtb11, a largely unstudied BTB-ZF transcription factor, suggesting that zbtb11 is critical for normal neutrophil development. The mutant man was found in a gynogenetic haploid ENU screen for defective expression of genes along the developmental pathway from mesoderm to mature neutrophil, undertaken to search for novel genetic regulators of myelopoiesis in an unbiased fashion. Since zebrafish are ectothermic, embryos were screened at 33°C to maximise recovery of temperature dependant alleles; man was the single temperature dependent mutant recovered. man was a recessive, early embryonic lethal mutant with normal expression of genes involved in early haematopoietic differentiation and specification but markedly reduced expression of mpx, a gene expressed in terminally differentiated neutrophils. Erythropoiesis was unaffected. man mutants also developed brain and spinal cord degeneration with hydrocephalus, with marked apoptosis throughout the central nervous system. Positional cloning resolved the genetic interval containing the man mutation to 52.5 Kb containing the open reading frame of a single gene, zbtb11.
    [Show full text]
  • Genomic Approach in Idiopathic Intellectual Disability Maria De Fátima E Costa Torres
    ESTUDOS DE 8 01 PDPGM 2 CICLO Genomic approach in idiopathic intellectual disability Maria de Fátima e Costa Torres D Autor. Maria de Fátima e Costa Torres D.ICBAS 2018 Genomic approach in idiopathic intellectual disability Genomic approach in idiopathic intellectual disability Maria de Fátima e Costa Torres SEDE ADMINISTRATIVA INSTITUTO DE CIÊNCIAS BIOMÉDICAS ABEL SALAZAR FACULDADE DE MEDICINA MARIA DE FÁTIMA E COSTA TORRES GENOMIC APPROACH IN IDIOPATHIC INTELLECTUAL DISABILITY Tese de Candidatura ao grau de Doutor em Patologia e Genética Molecular, submetida ao Instituto de Ciências Biomédicas Abel Salazar da Universidade do Porto Orientadora – Doutora Patrícia Espinheira de Sá Maciel Categoria – Professora Associada Afiliação – Escola de Medicina e Ciências da Saúde da Universidade do Minho Coorientadora – Doutora Maria da Purificação Valenzuela Sampaio Tavares Categoria – Professora Catedrática Afiliação – Faculdade de Medicina Dentária da Universidade do Porto Coorientadora – Doutora Filipa Abreu Gomes de Carvalho Categoria – Professora Auxiliar com Agregação Afiliação – Faculdade de Medicina da Universidade do Porto DECLARAÇÃO Dissertação/Tese Identificação do autor Nome completo _Maria de Fátima e Costa Torres_ N.º de identificação civil _07718822 N.º de estudante __ 198600524___ Email institucional [email protected] OU: [email protected] _ Email alternativo [email protected] _ Tlf/Tlm _918197020_ Ciclo de estudos (Mestrado/Doutoramento) _Patologia e Genética Molecular__ Faculdade/Instituto _Instituto de Ciências
    [Show full text]
  • The Zinc Transporter Zip14 (Slc39a14) Affects Beta-Cell Function
    www.nature.com/scientificreports OPEN The zinc transporter Zip14 (SLC39a14) afects Beta-cell Function: Proteomics, Gene Received: 7 January 2019 Accepted: 24 May 2019 expression, and Insulin secretion Published: xx xx xxxx studies in INS-1E cells Trine Maxel1, Kamille Smidt2, Charlotte C. Petersen1, Bent Honoré1, Anne K. Christensen1, Per B. Jeppesen2,3, Birgitte Brock4, Jørgen Rungby5, Johan Palmfeldt2,6 & Agnete Larsen1 Insulin secretion from pancreatic beta-cells is dependent on zinc ions as essential components of insulin crystals, zinc transporters are thus involved in the insulin secretory process. Zip14 (SLC39a14) is a zinc importing protein that has an important role in glucose homeostasis. Zip14 knockout mice display hyperinsulinemia and impaired insulin secretion in high glucose conditions. Endocrine roles for Zip14 have been established in adipocytes and hepatocytes, but not yet confrmed in beta- cells. In this study, we investigated the role of Zip14 in the INS-1E beta-cell line. Zip14 mRNA was upregulated during high glucose stimulation and Zip14 silencing led to increased intracellular insulin content. Large-scale proteomics showed that Zip14 silencing down-regulated ribosomal mitochondrial proteins, many metal-binding proteins, and others involved in oxidative phosphorylation and insulin secretion. Furthermore, proliferation marker Mki67 was down-regulated in Zip14 siRNA-treated cells. In conclusion, Zip14 gene expression is glucose sensitive and silencing of Zip14 directly afects insulin processing in INS-1E beta-cells. A link between Zip14 and ribosomal mitochondrial proteins suggests altered mitochondrial RNA translation, which could disturb mitochondrial function and thereby insulin secretion. This highlights a role for Zip14 in beta-cell functioning and suggests Zip14 as a future pharmacological target in the treatment of beta-cell dysfunction.
    [Show full text]