DOCSLIB.ORG

Frameshift Mutation in the Dok1 Gene in Chronic Lymphocytic Leukemia

Total Page：16

File Type：pdf, Size：1020Kb

Download full-text PDF Read full-text
Frameshift Mutation in the Dok1 Gene in Chronic Lymphocytic Leukemia Oncogene (2004) 23, 2287–2297 & 2004 Nature Publishing Group All rights reserved 0950-9232/04 $25.00 www.nature.com/onc ORIGINAL PAPERS Frameshift mutation in the Dok1 gene in chronic lymphocytic leukemia Sanghoon Lee1, Franc¸ois Roy1, Carlos M Galmarini2, Rosita Accardi1, Jocelyne Michelon1, Alexandra Viller1, Emeline Cros2, Charles Dumontet2 and Bakary S Sylla*,1 1International Agency for Research on Cancer, 150 Cours Albert-Thomas, Lyon 69008, France; and 2INSERM U 590 and Hospices Civils de Lyon, Lyon 69008, France B-cell chronic lymphocytic leukemia (B-CLL) is a mulation of monoclonal CD5 þ , CD23 þ mature B malignant disease characterized by an accumulation of cells, with a high percentage of cells arrested in the G0/ monoclonal CD5 þ mature Bcells, with a high percentage G1 phase of the cell cycle. These cells have a severe of cells arrested in the G0/G1 phase of the cell cycle, and a defect in programed cell death due to high expression of particular resistance toward apoptosis-inducing agents. antiapoptotic proteins, like bcl-2 family proteins bcl-2, Dok1 (downstream of tyrosine kinases) is an abundant bcl-xL, bax and mcl-1 or survival factors such as Ras-GTPase-activating protein (Ras-GAP)-associated TRAF1, and TRAF2 (Schroeder and Dighiero, 1994; tyrosine kinase substrate, which negatively regulates cell Kitada et al., 1998; Caligaris-Cappio and Hamblin, proliferation, downregulates MAP kinase activation and 1999; Munzert et al., 2002). Signaling pathways such as promotes cell migration. The gene encoding Dok1 maps to signal transducer and activator of transcription 1 (STAT human chromosome 2p13, a region previously found to be 1) and (STAT 3), phosphatidylinositol-3 kinase (PI-3K) rearranged in B-CLL. We have screened the Dok1 gene or NF-kB have been found constitutively activated in B- for mutations from 46 individuals with B-CLL using CLL cells (Frank et al., 1997; Furman et al., 2000; heteroduplex analysis. A four-nucleotide GGCC deletion Munzert et al., 2002; Ringshausen et al., 2002). in the coding region was found in the leukemia cells from Activation of such pathways may contribute to the one patient. This mutation causes a frameshift leading to disease. protein truncation at the carboxyl-terminus, with the So far, no recurrent gene mutation has been found acquisition of a novel amino-acid sequence. In contrast to in B-CLL. Instead, numerous chromosomal abnor- the wild-type Dok1 protein, which has cytoplasmic/ malities involving chromosomes 6q21–q23, 11q22.3– membrane localization, the mutant Dok1 is a nuclear q23.1, 13q14, 17p13 or 2p13 have been identified, protein containing a functional bipartite nuclear localiza- some of which have clinical significance (Nelms et al., tion signal. Whereas overexpression of wild-type Dok1 1998; Wyatt et al., 2000). The p53 tumor-suppressor inhibited PDGF-induced MAP kinase activation, this gene and the ATM gene have been found mutated in inhibition was not observed with the mutant Dok1. B-CLL and p53 mutations are associated with Furthermore the mutant Dok1 forms heterodimers with resistance to chemotherapy (El Rouby et al., 1993; Dok1 wild type and the association can be enhanced by Wattel et al., 1994; Schaffner et al., 1999; Stankovic Lck-mediated tyrosine-phosphorylation. This is the first et al., 1999). example of a Dok1 mutation in B-CLL and the data Dok1 (downstream of tyrosine kinases), or p62Dok1, suggest that Dok1 might play a role in leukemogenesis. is a phosphorylated protein downstream of a wide range Oncogene (2004) 23, 2287–2297. doi:10.1038/sj.onc.1207385 of protein-tyrosine kinases (PTKs) (Carpino et al., 1997; Published online 19 January 2004 Yamanashi and Baltimore, 1997; Bhat et al., 1998). Dok1 and the related proteins Dok2, Dok3, Dok4, Keywords: Dok1; chronic lymphocytic leukemia; frame- Dok5 and the insulin receptor substrate (IRS) (Nelms shift mutation; NLS; Lck; tyrosine phosphorylation et al., 1998; White, 1998; Cong et al., 1999; Lemay et al., 2000; Di Cristofano et al., 2001; Grimm et al., 2001; Cai et al., 2003; Favre et al., 2003) contain a pleckstrin homology (PH) domain at the N-terminus, a central phosphotyrosine-binding (PTB) domain and a C-term- Introduction inal domain rich in proline and several tyrosine- phosphorylation sites (Carpino et al., 1997; Yamanashi B-cell chronic lymphocytic leukemia (B-CLL) is the and Baltimore, 1997). After tyrosine-phosphorylation, most common type of adult leukemia found in Western Dok1 can interact with other signaling molecules populations. The disease is characterized by an accu- containing SH2 domains, such as Ras-GTPase-activat- ing protein (Ras-GAP), SHIP1, Nck, Csk and the X-linked lymphoproliferative syndrome (XLP) gene *Correspondence: BS Sylla; E-mail: [email protected] Received 23 May 2003; revised 19 November 2003; accepted 20 product SH2D1A (Neet and Hunter, 1995; Noguchi November 2003 et al., 1999; Sylla et al., 2000; Sattler et al., 2001). Dok1 mutation in B-CLL S Lee et al 2288 Dok1 downregulates several cell signaling processes: Results for example, it inhibits MAP kinase activity, down- regulates cell proliferation, affects T- and B-cell signal- Frameshift mutation in the coding region of Dok1 ing and plays a role in activin-induced apoptosis in B-CLL (Tamir et al., 2000; Yamanashi et al., 2000; Di Cristofano et al., 2001; Martelli et al., 2001; Nemorin cDNAs isolated from lymphocytes of 11 healthy et al., 2001; Songyang et al., 2001; Wick et al., 2001; individuals and from tumor samples of 46 B-CLL Zhao et al., 2001; Kato et al., 2002; Yamakawa et al., patients were investigated for the presence of mutations 2002). Dok1 can also affect cell adhesion, spreading and in the Dok1 gene. The entire coding sequence was migration (Noguchi et al., 1999; Hosooka et al., 2001). amplified using the primers listed in Table 1 and the Tyrosine phosphorylation and PH domain-mediated PCR products were subjected to heteroduplex analysis. plasma membrane translocation are necessary for Dok1 No abnormality in migration was observed for any PCR function (Liang et al., 2002; Zhao et al., 2001). Dok1 fragment except for one obtained with F4/R4 primers can suppress cell transformation and leukemogenesis in (see Table 1). With this set of primers, a different mice (Di Cristofano et al., 2001; Wick et al., 2001). electrophoretic mobility was seen for B-CLL patient Dok1 maps to human chromosome 2p13 (Nelms et al., number 13, where the fragment migrated faster than in 1998), a region of chromosomal translocation associated the other samples (Figure 1a, lane 3 and data not with several forms of leukemia including B-CLL and B- shown). Sequence analysis of this fragment revealed a cell acute lymphoblastic leukemia (B-ALL) (Sonnier four-nucleotide GGCC deletion at position 683 in exon et al., 1983; Yoffe et al., 1990; Inaba et al., 1991; 5 (amino acid 221) of the coding sequence of Dok1 Richardson et al., 1992; Nelms et al., 1998). Thus, the (GenBank Dok1 cDNA Accession No. NM-001381) function of Dok1 is likely to be altered in these (Figure 1b). This mutation was confirmed by amplifying malignancies. and sequencing a longer cDNA fragment from CLL13 In the present study, we examined whether Dok1 spanning nucleotide 683 (data not shown). The GGCC is mutated in 46 B-CLL cases. We found a deletion was not detected in the nucleotide sequence of four-nucleotide GGCC deletion in the coding region cDNAs from normal individuals (Figure 1b, and data of the gene in leukemia cells from one patient. not shown). The mutation generates a frameshift and This mutation causes a frameshift leading to protein premature termination of the encoded Dok1 protein, truncation at the carboxyl-terminus, with acquisition of with the generation of a hybrid truncated Dok1 protein a novel amino-acid sequence. In contrast to the with 298 amino acids and a theoretical molecular mass wild-type Dok1 protein that has membrane/cytoplasmic of 33 kDa (Figure 1b, c). This predicted mutant protein, localization, the mutant Dok1 accumulates in the referred to as Dok1-CLL13, shares a 220 amino-acid nucleus and contains a functional nuclear localization sequence with wild-type Dok1, comprising the PH signal (NLS). Whereas the wild-type Dok1 down- domain at the N-terminus and part of the PTB domain regulates PDGF-induced MAP kinase activation, the in the middle. However, as a result of the frameshift, mutated Dok1 in CLL has no, or only a slightly Dok1-CLL13 contains a unique 78 amino-acid sequence increased effect on MAP kinase activity. These results at the C-terminal region that is not present in wild-type imply that Dok1 may play a role in the development of Dok1 (Figure 1c, d). Notably, the new sequence, which B-CLL. has no significant homology with any protein in the Table 1 Primers and PCR conditions for amplification of the Dok1 gene Primer Sequences Nucleotide positiona Exon Annealing T (1C) Expected size (bp) F1A 50-CATGGACGGAGCAGTGATG-30 22–40 1, 2 60 361 R1C 50-AAAGGCGTTTCGGCACAG-30 362–379 F2 50-CCTTCCGCCTGGACACTG-30 285–302 2, 3 60 329 R3A 50-TGGCTCCAGTATCTGACTCT-30 593–613 F4 50-GCCTGCATGGCTCCTACG-30 528–545 4, 5 62 290 R4 50-GAGAACATCGTGCCCCTGT-30 798–817 F5 50-ACATCTTCCAGGCAGTTGAGA-30 741–761 5 67 317 R5 50-CTGCGCATGCTCATACAAGT-30 1038–1057 F6 50-GGAGAGGGAGTACAACGGAAG-30 1001–1021 5 60 370 R6 50-TGTACAGGGCTGAGTTGTG-30 1352–1370 F7 50-AGCCTTCCCTGAACCTGGTA-30 1306–1325 5 60 351 R7 50-CATCTGCCCCACTTCTTAGG-30 1637–1656 aDok1 cDNA sequence (GenBank Accession No. NM-001381) Oncogene Dok1 mutation in B-CLL S Lee et al 2289 Cloning and expression of Dok1-CLL13 In order to obtain insight into the possible function of the mutant Dok1 protein, a cDNA fragment amplified from CLL13 using F1A/R5 primers (see Table 1) was cloned in a TA plasmid vector (see Materials and methods).
Load more

Recommended publications
  • The Proximal Signaling Network of the BCR-ABL1 Oncogene Shows a Modular Organization
    Oncogene (2010) 29, 5895–5910 & 2010 Macmillan Publishers Limited All rights reserved 0950-9232/10 www.nature.com/onc ORIGINAL ARTICLE The proximal signaling network of the BCR-ABL1 oncogene shows a modular organization B Titz, T Low, E Komisopoulou, SS Chen, L Rubbi and TG Graeber Crump Institute for Molecular Imaging, Institute for Molecular Medicine, Jonsson Comprehensive Cancer Center, California NanoSystems Institute, Department of Molecular and Medical Pharmacology, University of California, Los Angeles, CA, USA BCR-ABL1 is a fusion tyrosine kinase, which causes signaling effects of BCR-ABL1 toward leukemic multiple types of leukemia. We used an integrated transformation. proteomic approach that includes label-free quantitative Oncogene (2010) 29, 5895–5910; doi:10.1038/onc.2010.331; protein complex and phosphorylation profiling by mass published online 9 August 2010 spectrometry to systematically characterize the proximal signaling network of this oncogenic kinase. The proximal Keywords: adaptor protein; BCR-ABL1; phospho- BCR-ABL1 signaling network shows a modular and complex; quantitative mass spectrometry; signaling layered organization with an inner core of three leukemia network; systems biology transformation-relevant adaptor protein complexes (Grb2/Gab2/Shc1 complex, CrkI complex and Dok1/ Dok2 complex). We introduced an ‘interaction direction- ality’ analysis, which annotates static protein networks Introduction with information on the directionality of phosphorylation- dependent interactions. In this analysis, the observed BCR-ABL1 is a constitutively active oncogenic fusion network structure was consistent with a step-wise kinase that arises through a chromosomal translocation phosphorylation-dependent assembly of the Grb2/Gab2/ and causes multiple types of leukemia. It is found in Shc1 and the Dok1/Dok2 complexes on the BCR-ABL1 many cases (B25%) of adult acute lymphoblastic core.
    [Show full text]
  • RET/PTC Activation in Papillary Thyroid Carcinoma
    European Journal of Endocrinology (2006) 155 645–653 ISSN 0804-4643 INVITED REVIEW RET/PTC activation in papillary thyroid carcinoma: European Journal of Endocrinology Prize Lecture Massimo Santoro1, Rosa Marina Melillo1 and Alfredo Fusco1,2 1Istituto di Endocrinologia ed Oncologia Sperimentale del CNR ‘G. Salvatore’, c/o Dipartimento di Biologia e Patologia Cellulare e Molecolare, University ‘Federico II’, Via S. Pansini, 5, 80131 Naples, Italy and 2NOGEC (Naples Oncogenomic Center)–CEINGE, Biotecnologie Avanzate & SEMM, European School of Molecular Medicine, Naples, Italy (Correspondence should be addressed to M Santoro; Email: [email protected]) Abstract Papillary thyroid carcinoma (PTC) is frequently associated with RET gene rearrangements that generate the so-called RET/PTC oncogenes. In this review, we examine the data about the mechanisms of thyroid cell transformation, activation of downstream signal transduction pathways and modulation of gene expression induced by RET/PTC. These findings have advanced our understanding of the processes underlying PTC formation and provide the basis for novel therapeutic approaches to this disease. European Journal of Endocrinology 155 645–653 RET/PTC rearrangements in papillary growth factor, have been described in a fraction of PTC thyroid carcinoma patients (7). As illustrated in figure 1, many different genes have been found to be rearranged with RET in The rearranged during tansfection (RET) proto-onco- individual PTC patients. RET/PTC1 and 3 account for gene, located on chromosome 10q11.2, was isolated in more than 90% of all rearrangements and are hence, by 1985 and shown to be activated by a DNA rearrange- far, the most frequent variants (8–11). They result from ment (rearranged during transfection) (1).As the fusion of RET to the coiled-coil domain containing illustrated in Fig.
    [Show full text]
  • Redefining the Specificity of Phosphoinositide-Binding by Human
    bioRxiv preprint doi: https://doi.org/10.1101/2020.06.20.163253; this version posted June 21, 2020. The copyright holder for this preprint (which was not certified by peer review) is the author/funder, who has granted bioRxiv a license to display the preprint in perpetuity. It is made available under aCC-BY-NC 4.0 International license. Redefining the specificity of phosphoinositide-binding by human PH domain-containing proteins Nilmani Singh1†, Adriana Reyes-Ordoñez1†, Michael A. Compagnone1, Jesus F. Moreno Castillo1, Benjamin J. Leslie2, Taekjip Ha2,3,4,5, Jie Chen1* 1Department of Cell & Developmental Biology, University of Illinois at Urbana-Champaign, Urbana, IL 61801; 2Department of Biophysics and Biophysical Chemistry, Johns Hopkins University School of Medicine, Baltimore, MD 21205; 3Department of Biophysics, Johns Hopkins University, Baltimore, MD 21218; 4Department of Biomedical Engineering, Johns Hopkins University, Baltimore, MD 21205; 5Howard Hughes Medical Institute, Baltimore, MD 21205, USA †These authors contributed equally to this work. *Correspondence: [email protected]. bioRxiv preprint doi: https://doi.org/10.1101/2020.06.20.163253; this version posted June 21, 2020. The copyright holder for this preprint (which was not certified by peer review) is the author/funder, who has granted bioRxiv a license to display the preprint in perpetuity. It is made available under aCC-BY-NC 4.0 International license. ABSTRACT Pleckstrin homology (PH) domains are presumed to bind phosphoinositides (PIPs), but specific interaction with and regulation by PIPs for most PH domain-containing proteins are unclear. Here we employed a single-molecule pulldown assay to study interactions of lipid vesicles with full-length proteins in mammalian whole cell lysates.
    [Show full text]
  • RET Gene Fusions in Malignancies of the Thyroid and Other Tissues
    G C A T T A C G G C A T genes Review RET Gene Fusions in Malignancies of the Thyroid and Other Tissues Massimo Santoro 1,*, Marialuisa Moccia 1, Giorgia Federico 1 and Francesca Carlomagno 1,2 1 Department of Molecular Medicine and Medical Biotechnology, University of Naples “Federico II”, 80131 Naples, Italy; [email protected] (M.M.); [email protected] (G.F.); [email protected] (F.C.) 2 Institute of Endocrinology and Experimental Oncology of the CNR, 80131 Naples, Italy * Correspondence: [email protected] Received: 10 March 2020; Accepted: 12 April 2020; Published: 15 April 2020 Abstract: Following the identification of the BCR-ABL1 (Breakpoint Cluster Region-ABelson murine Leukemia) fusion in chronic myelogenous leukemia, gene fusions generating chimeric oncoproteins have been recognized as common genomic structural variations in human malignancies. This is, in particular, a frequent mechanism in the oncogenic conversion of protein kinases. Gene fusion was the first mechanism identified for the oncogenic activation of the receptor tyrosine kinase RET (REarranged during Transfection), initially discovered in papillary thyroid carcinoma (PTC). More recently, the advent of highly sensitive massive parallel (next generation sequencing, NGS) sequencing of tumor DNA or cell-free (cfDNA) circulating tumor DNA, allowed for the detection of RET fusions in many other solid and hematopoietic malignancies. This review summarizes the role of RET fusions in the pathogenesis of human cancer. Keywords: kinase; tyrosine kinase inhibitor; targeted therapy; thyroid cancer 1. The RET Receptor RET (REarranged during Transfection) was initially isolated as a rearranged oncoprotein upon the transfection of a human lymphoma DNA [1].
    [Show full text]
  • DOK1 Purified Maxpab Rabbit Polyclonal Antibody (D01P)
    DOK1 purified MaxPab rabbit polyclonal antibody (D01P) Catalog # : H00001796-D01P 規格 : [ 100 ug ] List All Specification Application Image Product Rabbit polyclonal antibody raised against a full-length human DOK1 Western Blot (Transfected lysate) Description: protein. Immunogen: DOK1 (NP_001372.1, 1 a.a. ~ 481 a.a) full-length human protein. Sequence: MDGAVMEGPLFLQSQRFGTKRWRKTWAVLYPASPHGVARLEFFDHKG SSSGGGRGSSRRLDCKVIRLAECVSVAPVTVETPPEPGATAFRLDTAQR SHLLAADAPSSAAWVQTLCRNAFPKGSWTLAPTDNPPKLSALEMLENSL enlarge YSPTWEGSQFWVTVQRTEAAERCGLHGSYVLRVEAERLTLLTVGAQS QILEPLLSWPYTLLRRYGRDKVMFSFEAGRRCPSGPGTFTFQTAQGNDI FQAVETAIHRQKAQGKAGQGHDVLRADSHEGEVAEGKLPSPPGPQELL DSPPALYAEPLDSLRIAPCPSQDSLYSDPLDSTSAQAGEGVQRKKPLYW DLYEHAQQQLLKAKLTDPKEDPIYDEPEGLAPVPPQGLYDLPREPKDAW WCQARVKEEGYELPYNPATDDYAVPPPRSTKPLLAPKPQGPAFPEPGT ATGSGIKSHNSALYSQVQKSGASGSWDCGLSRVGTDKTGVKSEGST Host: Rabbit Reactivity: Human Quality Control Antibody reactive against mammalian transfected lysate. Testing: Storage Buffer: In 1x PBS, pH 7.4 Storage Store at -20°C or lower. Aliquot to avoid repeated freezing and thawing. Instruction: MSDS: Download Datasheet: Download Applications Western Blot (Transfected lysate) Western Blot analysis of DOK1 expression in transfected 293T cell line (H00001796-T01) by DOK1 MaxPab polyclonal antibody. Lane 1: DOK1 transfected lysate(52.40 KDa). Lane 2: Non-transfected lysate. Page 1 of 2 2016/5/20 Protocol Download Gene Information Entrez GeneID: 1796 GeneBank NM_001381 Accession#: Protein NP_001372.1 Accession#: Gene Name: DOK1 Gene Alias: MGC117395,MGC138860,P62DOK
    [Show full text]
  • X-Linked Diseases: Susceptible Females
    REVIEW ARTICLE X-linked diseases: susceptible females Barbara R. Migeon, MD 1 The role of X-inactivation is often ignored as a prime cause of sex data include reasons why women are often protected from the differences in disease. Yet, the way males and females express their deleterious variants carried on their X chromosome, and the factors X-linked genes has a major role in the dissimilar phenotypes that that render women susceptible in some instances. underlie many rare and common disorders, such as intellectual deficiency, epilepsy, congenital abnormalities, and diseases of the Genetics in Medicine (2020) 22:1156–1174; https://doi.org/10.1038/s41436- heart, blood, skin, muscle, and bones. Summarized here are many 020-0779-4 examples of the different presentations in males and females. Other INTRODUCTION SEX DIFFERENCES ARE DUE TO X-INACTIVATION Sex differences in human disease are usually attributed to The sex differences in the effect of X-linked pathologic variants sex specific life experiences, and sex hormones that is due to our method of X chromosome dosage compensation, influence the function of susceptible genes throughout the called X-inactivation;9 humans and most placental mammals – genome.1 5 Such factors do account for some dissimilarities. compensate for the sex difference in number of X chromosomes However, a major cause of sex-determined expression of (that is, XX females versus XY males) by transcribing only one disease has to do with differences in how males and females of the two female X chromosomes. X-inactivation silences all X transcribe their gene-rich human X chromosomes, which is chromosomes but one; therefore, both males and females have a often underappreciated as a cause of sex differences in single active X.10,11 disease.6 Males are the usual ones affected by X-linked For 46 XY males, that X is the only one they have; it always pathogenic variants.6 Females are biologically superior; a comes from their mother, as fathers contribute their Y female usually has no disease, or much less severe disease chromosome.
    [Show full text]
  • SLAMF1 Antibody (Pab)
    21.10.2014SLAMF1 antibody (pAb) Rabbit Anti-Human/Mouse/Rat Signaling lymphocytic activation molecule family member 1 (CD150, CDw150, IPO -3, SLAM) Instruction Manual Catalog Number PK-AB718-6247 Synonyms SLAMF1 Antibody: Signaling lymphocytic activation molecule family member 1, CD150, CDw150, IPO-3, SLAM Description The signaling lymphocyte-activation molecule family member 1 (SLAMF1) is a novel receptor on T cells that potentiates T cell expansion in a CD28-independent manner. SLAMF1 is predominantly expressed by hematopoietic tissues. Reports suggest that the extracellular domain of SLAMF1 is the receptor for the measles virus and acts as a co-activator on both T and B cells. It is thought to interact with SH2D1A and with PTPN11 via its cytoplasmic domain. Mutations of the SLAM associated gene may be associated with X-linked lympho-proliferative disease (XLP). Quantity 100 µg Source / Host Rabbit Immunogen SLAMF1 antibody was raised against a 15 amino acid synthetic peptide near the amino terminus of human SLAMF1. Purification Method Affinity chromatography purified via peptide column. Clone / IgG Subtype Polyclonal antibody Species Reactivity Human, Mouse, Rat Specificity Two isoforms of SLAMF1 are known to exist; this antibody will recognize both isoforms. SLAMF1 antibody is predicted to not cross-react with other SLAM protein family members. Formulation Antibody is supplied in PBS containing 0.02% sodium azide. Reconstitution During shipment, small volumes of antibody will occasionally become entrapped in the seal of the product vial. For products with volumes of 200 μl or less, we recommend gently tapping the vial on a hard surface or briefly centrifuging the vial in a tabletop centrifuge to dislodge any liquid in the container’s cap.
    [Show full text]
  • Detection of a Rare BCR–ABL Tyrosine Kinase Fusion Protein in H929 Multiple Myeloma Cells Using Immunoprecipitation (IP)-Tandem Mass Spectrometry (MS/MS)
    Detection of a rare BCR–ABL tyrosine kinase fusion protein in H929 multiple myeloma cells using immunoprecipitation (IP)-tandem mass spectrometry (MS/MS) Susanne B. Breitkopfa,b, Min Yuana, German A. Pihanc, and John M. Asaraa,b,1 aDivision of Signal Transduction, Beth Israel Deaconess Medical Center, Boston, MA 02115; bDepartment of Medicine, Harvard Medical School, Boston, MA 02115; and cDepartment of Hematopathology, Beth Israel Deaconess Medical Center, Boston, MA 02115 Edited by Peter K. Vogt, The Scripps Research Institute, La Jolla, CA, and approved August 23, 2012 (received for review July 26, 2012) Hypothesis directed proteomics offers higher throughput over Here, we focused on a hypothesis-directed approach to identify global analyses. We show that immunoprecipitation (IP)–tandem the active signaling pathways that drive cancers. To this end, we mass spectrometry (LC-MS/MS) in H929 multiple myeloma (MM) immunoprecipitated proteins that have clinical significance in cell cancer cells led to the discovery of a rare and unexpected BCR– proliferation such as the central nodes in the AKT and ERK sig- ABL fusion, informing a therapeutic intervention using imatinib naling pathways. The p85 regulatory subunit of phosphoinositide- (Gleevec). BCR–ABL is the driving mutation in chronic myeloid leu- 3-kinase (PI3K) binds pYXXM motif-containing proteins to the kemia (CML) and is uncommon to other cancers. Three different IP– SRC homology 2 (SH2) domains of p85, thus recruiting the p110 MS experiments central to cell signaling pathways were sufficient to catalytic subunit to the plasma membrane for activation (5, 17). Activated p110 phosphorylates its lipid substrate phosphatidyli- discover a BCR–ABL fusion in H929 cells: phosphotyrosine (pY) pep- nositol-4,5-bisphosphate (PIP2) to phosphatidylinositol-3,4,5-tri- tide IP, p85 regulatory subunit of phosphoinositide-3-kinase (PI3K) phosphate (PIP3) and binds to the pleckstrin homology (PH) IP, and the GRB2 adaptor IP.
    [Show full text]
  • Signaling Opposing Roles in CD200 Receptor Downstream of Tyrosine
    Downstream of Tyrosine Kinase 1 and 2 Play Opposing Roles in CD200 Receptor Signaling Robin Mihrshahi and Marion H. Brown This information is current as J Immunol published online 15 November 2010 of October 1, 2021. http://www.jimmunol.org/content/early/2010/11/14/jimmun ol.1002858 Downloaded from Why The JI? Submit online. • Rapid Reviews! 30 days* from submission to initial decision • No Triage! Every submission reviewed by practicing scientists http://www.jimmunol.org/ • Fast Publication! 4 weeks from acceptance to publication *average Subscription Information about subscribing to The Journal of Immunology is online at: http://jimmunol.org/subscription Permissions Submit copyright permission requests at: by guest on October 1, 2021 http://www.aai.org/About/Publications/JI/copyright.html Email Alerts Receive free email-alerts when new articles cite this article. Sign up at: http://jimmunol.org/alerts The Journal of Immunology is published twice each month by The American Association of Immunologists, Inc., 1451 Rockville Pike, Suite 650, Rockville, MD 20852 All rights reserved. Print ISSN: 0022-1767 Online ISSN: 1550-6606. Published November 15, 2010, doi:10.4049/jimmunol.1002858 The Journal of Immunology Downstream of Tyrosine Kinase 1 and 2 Play Opposing Roles in CD200 Receptor Signaling Robin Mihrshahi and Marion H. Brown The CD200 receptor (CD200R) negatively regulates myeloid cells by interacting with its widely expressed ligand CD200. CD200R signals through a unique inhibitory pathway involving a direct interaction with the adaptor protein downstream of tyrosine kinase 2 (Dok2) and the subsequent recruitment and activation of Ras GTPase-activating protein (RasGAP). Ligand engagement of CD200R also results in tyrosine phosphorylation of Dok1, but this protein is not essential for inhibitory CD200R signaling in human myeloid cells.
    [Show full text]
  • The Tec Kinase−Regulated Phosphoproteome Reveals a Mechanism for the Regulation of Inhibitory Signals in Murine Macrophages
    The Tec Kinase−Regulated Phosphoproteome Reveals a Mechanism for the Regulation of Inhibitory Signals in Murine Macrophages This information is current as Giacomo Tampella, Hannah M. Kerns, Deqiang Niu, Swati of September 29, 2021. Singh, Socheath Khim, Katherine A. Bosch, Meghan E. Garrett, Albanus Moguche, Erica Evans, Beth Browning, Tahmina A. Jahan, Mariana Nacht, Alejandro Wolf-Yadlin, Alessandro Plebani, Jessica A. Hamerman, David J. Rawlings and Richard G. James Downloaded from J Immunol published online 29 May 2015 http://www.jimmunol.org/content/early/2015/05/29/jimmun ol.1403238 http://www.jimmunol.org/ Supplementary http://www.jimmunol.org/content/suppl/2015/05/29/jimmunol.140323 Material 8.DCSupplemental Why The JI? Submit online. • Rapid Reviews! 30 days* from submission to initial decision by guest on September 29, 2021 • No Triage! Every submission reviewed by practicing scientists • Fast Publication! 4 weeks from acceptance to publication *average Subscription Information about subscribing to The Journal of Immunology is online at: http://jimmunol.org/subscription Permissions Submit copyright permission requests at: http://www.aai.org/About/Publications/JI/copyright.html Email Alerts Receive free email-alerts when new articles cite this article. Sign up at: http://jimmunol.org/alerts The Journal of Immunology is published twice each month by The American Association of Immunologists, Inc., 1451 Rockville Pike, Suite 650, Rockville, MD 20852 Copyright © 2015 by The American Association of Immunologists, Inc. All rights reserved. Print ISSN: 0022-1767 Online ISSN: 1550-6606. Published May 29, 2015, doi:10.4049/jimmunol.1403238 The Journal of Immunology The Tec Kinase–Regulated Phosphoproteome Reveals a Mechanism for the Regulation of Inhibitory Signals in Murine Macrophages Giacomo Tampella,*,1 Hannah M.
    [Show full text]
  • Structure, Function, and Regulation of the SRMS Tyrosine Kinase
    International Journal of Molecular Sciences Review Structure, Function, and Regulation of the SRMS Tyrosine Kinase Chakia J. McClendon 1 and W. Todd Miller 1,2,* 1 Department of Physiology and Biophysics, Stony Brook University, Stony Brook, NY 11794-8661, USA; [email protected] 2 Department of Veterans Affairs Medical Center, Northport, NY 11768, USA * Correspondence: [email protected] Received: 21 May 2020; Accepted: 12 June 2020; Published: 14 June 2020 Abstract: Src-related kinase lacking C-terminal regulatory tyrosine and N-terminal myristoylation sites (SRMS) is a tyrosine kinase that was discovered in 1994. It is a member of a family of nonreceptor tyrosine kinases that also includes Brk (PTK6) and Frk. Compared with other tyrosine kinases, there is relatively little information about the structure, function, and regulation of SRMS. In this review, we summarize the current state of knowledge regarding SRMS, including recent results aimed at identifying downstream signaling partners. We also present a structural model for the enzyme and discuss the potential involvement of SRMS in cancer cell signaling. Keywords: tyrosine kinase; signal transduction; phosphorylation; SH3 domains; SH2 domains; Src family kinases 1. Introduction Src-related kinase lacking C-terminal regulatory tyrosine and N-terminal myristoylation sites (SRMS) is a 53 kDa nonreceptor tyrosine kinase that was first discovered in mouse neural precursor cells [1]. Studies of the expression pattern of SRMS mRNA showed that the highest levels were present in lung, testes, and liver tissues. Full-length cDNA encoding SRMS was isolated from a murine lung cDNA library, with the predicted SRMS protein containing all of the conserved amino acid residues expected for a nonreceptor tyrosine kinase.
    [Show full text]
  • Identification of a Novel Nonsense Mutation in SH2D1A in a Patient with X-Linked Lymphoproliferative Syndrome Type 1
    Lyu et al. BMC Medical Genetics (2018) 19:60 https://doi.org/10.1186/s12881-018-0576-y CASEREPORT Open Access Identification of a novel nonsense mutation in SH2D1A in a patient with X-linked lymphoproliferative syndrome type 1: a case report Xiaodong Lyu1, Zhen Guo1, Yangwei Li1, Ruihua Fan1 and Yongping Song2* Abstract Background: X-linked lymphoproliferative syndrome type 1 (XLP1) is an X-linked recessive genetic disorder with a strong resemblance to hemophagocytic lymphohistiocytosis (HLH). Causative mutations for XLP1 have been identified in SH2D1A, located on chromosome Xq25. Case presentation: We report a case of an 18-month-old male with a novel nonsense mutation in SH2D1A. The patient presented the typical phenotype of HLH, including splenomegaly and hemophagocytosis in the bone marrow. Thus, he was initially diagnosed with HLH based on HLH-2004 guidelines. High-throughput amplicon sequencing was performed to detect mutations in the most commonly reported causative genes of HLH, i.e., PRF1, UNC13D, STX11, STXBP2, SH2D1A, and XIAP. A likely pathogenic nonsense mutation was detected in SH2D1A (NM_ 002351.4:c.300T>A). The mutation was inherited from the patient’s mother, and an X-linked recessive mode of inheritance was confirmed by a two-generation pedigree analysis based on Sanger sequencing results. Conclusions: The nonsense mutation in SH2D1A (NM_002351.4:c.300T>A) was reported for the first time in a case of XLP1 and was considered to be likely pathogenic based on the truncation of the mRNA sequence. This finding expands the spectrum of known XLP-related mutations in Chinese patients and indicates the utility of amplicon sequencing for XLP and HLH diagnosis.
    [Show full text]