DOCSLIB.ORG

RET/PTC Activation in Papillary Thyroid Carcinoma

Total Page：16

File Type：pdf, Size：1020Kb

Download full-text PDF Read full-text
RET/PTC Activation in Papillary Thyroid Carcinoma European Journal of Endocrinology (2006) 155 645–653 ISSN 0804-4643 INVITED REVIEW RET/PTC activation in papillary thyroid carcinoma: European Journal of Endocrinology Prize Lecture Massimo Santoro1, Rosa Marina Melillo1 and Alfredo Fusco1,2 1Istituto di Endocrinologia ed Oncologia Sperimentale del CNR ‘G. Salvatore’, c/o Dipartimento di Biologia e Patologia Cellulare e Molecolare, University ‘Federico II’, Via S. Pansini, 5, 80131 Naples, Italy and 2NOGEC (Naples Oncogenomic Center)–CEINGE, Biotecnologie Avanzate & SEMM, European School of Molecular Medicine, Naples, Italy (Correspondence should be addressed to M Santoro; Email: [email protected]) Abstract Papillary thyroid carcinoma (PTC) is frequently associated with RET gene rearrangements that generate the so-called RET/PTC oncogenes. In this review, we examine the data about the mechanisms of thyroid cell transformation, activation of downstream signal transduction pathways and modulation of gene expression induced by RET/PTC. These findings have advanced our understanding of the processes underlying PTC formation and provide the basis for novel therapeutic approaches to this disease. European Journal of Endocrinology 155 645–653 RET/PTC rearrangements in papillary growth factor, have been described in a fraction of PTC thyroid carcinoma patients (7). As illustrated in figure 1, many different genes have been found to be rearranged with RET in The rearranged during tansfection (RET) proto-onco- individual PTC patients. RET/PTC1 and 3 account for gene, located on chromosome 10q11.2, was isolated in more than 90% of all rearrangements and are hence, by 1985 and shown to be activated by a DNA rearrange- far, the most frequent variants (8–11). They result from ment (rearranged during transfection) (1).As the fusion of RET to the coiled-coil domain containing illustrated in Fig. 1, it encodes a single-pass trans- gene 6 (CCDC6, formerly called H4/D10S170) or to the membrane tyrosine kinase that functions as the nuclear receptor co-activator gene 4 (NcoA4, formerly receptor (receptor tyrosine kinase, RTK) for the growth called RET fused gene (RFG)/ELE1/androgen receptor factors of the glial cell line-derived neurotropic factor activator 70(ARA70)) (8–11). family (2). RET is essential for the development of the sympathetic, parasympathetic, and enteric nervous systems, the kidney and the testis (2). Germline point Prevalence of RET/PTC rearrangements mutations in RET lead to multiple endocrine neoplasia type 2 syndromes thereby predisposing to thyroid C-cell- For a detailed discussion of the prevalence of RET/PTC derived medullary thyroid carcinoma (3). rearrangements and their correlation with clinico- With an incidence ranging between 0.5 and 10 cases pathological features of thyroid carcinomas, we refer per 100 000 population, thyroid cancer is the most the reader to three excellent reviews (8–10). The frequent endocrine malignancy (4). Papillary thyroid prevalence of RET/PTC rearrangements in thyroid carcinoma (PTC), which accounts for approximately cancer varies widely among studies. In an adult population from the United States, the prevalence of 80% of cases, is the most frequent of all thyroid rearrangements was approximately 35% (9). Preva- malignancies (4). In PTC, genomic rearrangements lences between 3 and 85% have been reported for other juxtapose the RET kinase and COOH-terminus encoding regions (8–10). This wide range of values probably domains (exons 11–21) to unrelated genes, thereby reflects not only the geographic variation but also the creating dominantly transforming oncogenes called different procedures used to identify RET/PTC RET/PTC (5, 6). Similar rearrangements of another rearrangements, i.e. various reverse transcriptase neurotropic RTK, namely the neurotropic tyrosine (RT)-PCR methods, Southern blot, and fluorescence receptor kinase type 1 (NTRK1), the receptor for nerve in situ hybridization. An exhaustive study by Zhu and co-workers (12) demonstrated that the method used has Presented at the 7th European Congress of Endocrinology, a striking effect on the efficacy of RET/PTC detection, Gothenburg, Sweden, 2005. and hence on the prevalence reported. Tumor q 2006 Society of the European Journal of Endocrinology DOI: 10.1530/eje.1.02289 Online version via www.eje-online.org Downloaded from Bioscientifica.com at 09/24/2021 07:34:47PM via free access 646 M Santoro and others EUROPEAN JOURNAL OF ENDOCRINOLOGY (2006) 155 Figure 1 Schematic drawing of the RET protein with the four extracellular cadherin-like domains, the cysteine-rich box adjacent to the plasma membrane, the juxtamembrane domain and the split tyrosine kinase domain (TK). In PTCs, RET is rearranged with diverse genes, encoding protein dimerization motifs (highlighted) that mediate ligand-independent RET dimerization. The arrowheads indicate RET breakpoints. heterogeneity is another factor that can affect the the presence of multiple RET/PTC variants in individ- evaluation of RET/PTC prevalence. In addition to PTC ual PTC samples (14). samples with ‘clonal’ RET/PTC rearrangements (those RET/PTC rearrangements have so far been identified affecting the majority of tumor cells), there are samples only in thyroid lesions, and in particular in PTC (8–10). with ‘non-clonal’ rearrangements (those affecting a Most studies concur that RET/PTC rearrangements are small portion of tumor cells) (12, 13). Whereas RET/ rare or absent in benign follicular adenomas, and absent PTC is likely to be important for tumor formation in in follicular and medullary carcinomas (8–10). Various samples with clonal rearrangements, RET/PTC could PTC histological variants have been identified, namely not be a ‘driver’ mutation in PTC samples with non- classic, follicular, diffuse-sclerosing, columnar-cell, clonal rearrangements (13). This distinction has Hurthle-cell, cribriform, solid and tall-cell variants (4). important implications for the stratification of patients Classic (w45%) and follicular (w18%) variants are the who could potentially benefit from novel therapeutic most prevalent (4). RET/PTCs are more frequent in approaches based on the use of RET kinase inhibitors tumors that have a classic architecture (15) and in (see below). It is still controversial the presence of RET/ microcarcinomas (!1 cm) (16). They are rare in the PTC rearrangements in non-neoplastic cells in Hashi- follicular variant of PTC (15). RET/PTCs have been moto’s thyroiditis. It is possible that a heterogeneous reported in the cribriform variant, which is typically presence of the rearrangement may account, at least in associated with familial adenomatous polyposis (17),in part, for such a controversy (8,9,13).Tumor the Hurthle-cell variant (18, 19), and in hyalinizing heterogeneity and multiclonality is also indicated by trabecular adenoma, a rare tumor that can be www.eje-online.org Downloaded from Bioscientifica.com at 09/24/2021 07:34:47PM via free access EUROPEAN JOURNAL OF ENDOCRINOLOGY (2006) 155 RET/PTC in thyroid cancer 647 morphologically similar to PTC (20, 21). The solid of childhood PTC was reported in contaminated areas. variant, which is an aggressive PTC subtype, is closely Post-Chernobyl PTC featured a high prevalence (over associated with the RET/PTC3 oncogene, whereas the 60%) of RET/PTC rearrangements (22, 36–39). classic variant is associated with RET/PTC1 (22). RET/PTC3 was more prevalent among short latency Clinical, epidemiologic, and pathologic evidence solid PTCs, whereas RET/PTC1 was more frequently supports the possibility of a stepwise progression from found after a long latency period (9, 22, 36–39). Rapid well-differentiated carcinoma, including PTC, to poorly thyroid cell proliferation may account for the particu- differentiated and anaplastic carcinoma (23). Accor- larly high sensitivity to radiation-induced RET/PTC dingly, some anaplastic carcinomas are associated with rearrangements among children (40). However, also in genetic lesions (rat sarcoma viral oncogene homolog cases of PTC in non-exposed populations, the prevalence (RAS) and BRAF mutations) that overlap those present of RET/PTC was higher in children than in adults, in PTC and in other well-differentiated carcinomas (23). which suggests that in general RET/PTC recombina- Conflicting results have been reported about the tions occur more frequently in young thyroids (41, 42). presence of RET/PTC in poorly-differentiated and RET/PTC rearrangements are not the only intrachro- anaplastic carcinomas and, therefore about whether mosomal aberration found in radiation-associated PTC. or not RET/PTC predisposes to thyroid tumor pro- Also NTRK1 rearrangements, caused by paracentric gression (23–28). Again, methodological differences inversions of chromosome 1q, have been reported in and tumor heterogeneity may account for these post-Chernobyl PTC (7, 38). Moreover, in 11% of the post- controversies. A large multicenter study in which all Chernobyl PTCs there was a paracentric inversion of centers use the same methodology should resolve this chromosome 7q that resulted in the A-kinase anchor issue. It is also important to study the different RET/PTC protein (AKAP)9–BRAF fusion oncogene (43). Differently, variants individually, because, as mentioned above, they point mutations in BRAF, which are very frequent in could confer different degrees of aggressiveness on PTC. sporadic PTC (see below) are rare in Chernobyl cancers It should be noted that intercross of RET/PTC transgenic affecting children (44). This suggests that young age and mice with p53null mice induced
Load more

Recommended publications
  • Influencers on Thyroid Cancer Onset: Molecular Genetic Basis
    G C A T T A C G G C A T genes Review Influencers on Thyroid Cancer Onset: Molecular Genetic Basis Berta Luzón-Toro 1,2, Raquel María Fernández 1,2, Leticia Villalba-Benito 1,2, Ana Torroglosa 1,2, Guillermo Antiñolo 1,2 and Salud Borrego 1,2,* 1 Department of Maternofetal Medicine, Genetics and Reproduction, Institute of Biomedicine of Seville (IBIS), University Hospital Virgen del Rocío/CSIC/University of Seville, 41013 Seville, Spain; [email protected] (B.L.-T.); [email protected] (R.M.F.); [email protected] (L.V.-B.); [email protected] (A.T.); [email protected] (G.A.) 2 Centre for Biomedical Network Research on Rare Diseases (CIBERER), 41013 Seville, Spain * Correspondence: [email protected]; Tel.: +34-955-012641 Received: 3 September 2019; Accepted: 6 November 2019; Published: 8 November 2019 Abstract: Thyroid cancer, a cancerous tumor or growth located within the thyroid gland, is the most common endocrine cancer. It is one of the few cancers whereby incidence rates have increased in recent years. It occurs in all age groups, from children through to seniors. Most studies are focused on dissecting its genetic basis, since our current knowledge of the genetic background of the different forms of thyroid cancer is far from complete, which poses a challenge for diagnosis and prognosis of the disease. In this review, we describe prevailing advances and update our understanding of the molecular genetics of thyroid cancer, focusing on the main genes related with the pathology, including the different noncoding RNAs associated with the disease.
    [Show full text]
  • Genome-Wide Analysis of Host-Chromosome Binding Sites For
    Lu et al. Virology Journal 2010, 7:262 http://www.virologyj.com/content/7/1/262 RESEARCH Open Access Genome-wide analysis of host-chromosome binding sites for Epstein-Barr Virus Nuclear Antigen 1 (EBNA1) Fang Lu1, Priyankara Wikramasinghe1, Julie Norseen1,2, Kevin Tsai1, Pu Wang1, Louise Showe1, Ramana V Davuluri1, Paul M Lieberman1* Abstract The Epstein-Barr Virus (EBV) Nuclear Antigen 1 (EBNA1) protein is required for the establishment of EBV latent infection in proliferating B-lymphocytes. EBNA1 is a multifunctional DNA-binding protein that stimulates DNA replication at the viral origin of plasmid replication (OriP), regulates transcription of viral and cellular genes, and tethers the viral episome to the cellular chromosome. EBNA1 also provides a survival function to B-lymphocytes, potentially through its ability to alter cellular gene expression. To better understand these various functions of EBNA1, we performed a genome-wide analysis of the viral and cellular DNA sites associated with EBNA1 protein in a latently infected Burkitt lymphoma B-cell line. Chromatin-immunoprecipitation (ChIP) combined with massively parallel deep-sequencing (ChIP-Seq) was used to identify cellular sites bound by EBNA1. Sites identified by ChIP- Seq were validated by conventional real-time PCR, and ChIP-Seq provided quantitative, high-resolution detection of the known EBNA1 binding sites on the EBV genome at OriP and Qp. We identified at least one cluster of unusually high-affinity EBNA1 binding sites on chromosome 11, between the divergent FAM55 D and FAM55B genes. A con- sensus for all cellular EBNA1 binding sites is distinct from those derived from the known viral binding sites, sug- gesting that some of these sites are indirectly bound by EBNA1.
    [Show full text]
  • Tamoxifen Erythroid Toxicity Revealed by Studying the Role of Nuclear
    COMMENT as in Santana-Codina et al.1 Briefly, 12-week old Sv129/J Tamoxifen erythroid toxicity revealed by studying Ncoa4-ko and wild-type littermates received 200 mg/kg the role of nuclear receptor co-activator 4 in tamoxifen via oral gavage daily for five consecutive days erythropoiesis (day 0-4) and complete blood count was obtained at days 0, 4, 11 and 21. We chose mice on Sv129/J background We read with great interest the paper recently pub- that, unlike C57BL/6 Ncoa4-ko animals,4 do not show lished by Santana-Codina et al.1 about the cell anemia or alterations of iron parameters but only mild autonomous and non-autonomous role of nuclear recep- microcytosis (Figure 1 and Nai et al., 2019, manuscript in tor co-activator 4 (NCOA4). NCOA4 is a cargo receptor preparation). At day 4, only Ncoa4-ko mice showed a sta- that, in conditions of iron deficiency, promotes fer- tistically significant decrease in red blood cell (RBC) ritinophagy to release iron from ferritin.2,3 Inactivation of count, and hematocrit (Hct) and hemoglobin (Hb) levels. Ncoa4 in C57BL/6 mice causes mild microcytic anemia and increases the susceptibility to iron-deficiency anemia At day 11, also wild-type mice showed a reduction in due to iron being trapped in ferritin in several organs.3,4 To RBC count and decreased Hb and Hct, although for the formally prove the role of Ncoa4 inactivation on erythro- latter two parameters levels were higher than those of poiesis, a tamoxifen-inducible CRE-dependent Ncoa4-ko mice.
    [Show full text]
  • The Proximal Signaling Network of the BCR-ABL1 Oncogene Shows a Modular Organization
    Oncogene (2010) 29, 5895–5910 & 2010 Macmillan Publishers Limited All rights reserved 0950-9232/10 www.nature.com/onc ORIGINAL ARTICLE The proximal signaling network of the BCR-ABL1 oncogene shows a modular organization B Titz, T Low, E Komisopoulou, SS Chen, L Rubbi and TG Graeber Crump Institute for Molecular Imaging, Institute for Molecular Medicine, Jonsson Comprehensive Cancer Center, California NanoSystems Institute, Department of Molecular and Medical Pharmacology, University of California, Los Angeles, CA, USA BCR-ABL1 is a fusion tyrosine kinase, which causes signaling effects of BCR-ABL1 toward leukemic multiple types of leukemia. We used an integrated transformation. proteomic approach that includes label-free quantitative Oncogene (2010) 29, 5895–5910; doi:10.1038/onc.2010.331; protein complex and phosphorylation profiling by mass published online 9 August 2010 spectrometry to systematically characterize the proximal signaling network of this oncogenic kinase. The proximal Keywords: adaptor protein; BCR-ABL1; phospho- BCR-ABL1 signaling network shows a modular and complex; quantitative mass spectrometry; signaling layered organization with an inner core of three leukemia network; systems biology transformation-relevant adaptor protein complexes (Grb2/Gab2/Shc1 complex, CrkI complex and Dok1/ Dok2 complex). We introduced an ‘interaction direction- ality’ analysis, which annotates static protein networks Introduction with information on the directionality of phosphorylation- dependent interactions. In this analysis, the observed BCR-ABL1 is a constitutively active oncogenic fusion network structure was consistent with a step-wise kinase that arises through a chromosomal translocation phosphorylation-dependent assembly of the Grb2/Gab2/ and causes multiple types of leukemia. It is found in Shc1 and the Dok1/Dok2 complexes on the BCR-ABL1 many cases (B25%) of adult acute lymphoblastic core.
    [Show full text]
  • NCOA4 Maintains Murine Erythropoiesis Via Cell Autonomous and Non-Autonomous Mechanisms
    Red Cell Biology & its Disorders SUPPLEMENTARY APPENDIX NCOA4 maintains murine erythropoiesis via cell autonomous and non-autonomous mechanisms Naiara Santana-Codina,1,* Sebastian Gableske,1,* Maria Quiles del Rey,1 Beata Małachowska,2,3 Mark P. Jedrychowski,1,4 Douglas E. Biancur,1 Paul J. Schmidt,5 Mark D. Fleming,5 Wojciech Fendler,1,2 J. Wade Harper,4,# Alec C. Kimmelman6,# and Joseph D. Mancias1 1Division of Genomic Stability and DNA Repair, Department of Radiation Oncology, Dana-Farber Cancer Institute, Boston, MA, USA; 2De- partment of Biostatistics and Translational Medicine, Medical University of Lodz, Poland; 3Postgraduate School of Molecular Medicine, Medical University of Warsaw, Poland; 4Department of Cell Biology, Harvard Medical School, Boston, MA, USA; 5Department of Pathology, Boston Children’s Hospital and Harvard Medical School, Boston, MA, USA and 6Department of Radiation Oncology, Perlmutter Cancer Center, New York University School of Medicine, New York, NY, USA * These authors contributed equally to this work ©2019 Ferrata Storti Foundation. This is an open-access paper. doi:10.3324/haematol.2018.204123 Received: August 10, 2018. Accepted: January 9, 2019. Pre-published: January 10, 2019. Correspondence: JOSEPH D. MANCIAS - [email protected] SUPPLEMENTARY INFORMATION SUPPLEMENTAL EXPERIMENTAL PROCEDURES Cell culture. Cells were cultured in a humidified incubator at 37°C and 5% carbon dioxide (CO2). HEK-293T and K562 cell lines were obtained from the American Type Culture Collection (ATCC, Manassas, Virginia) and tested for mycoplasma contamination by PCR. Cells were grown in DMEM (HEK-293T, Life Technologies, 11965) or IMDM (K562, Thermo Fisher 12440053) with 10% FBS and 1% Pen/Strep (Life Technologies 15140).
    [Show full text]
  • Redefining the Specificity of Phosphoinositide-Binding by Human
    bioRxiv preprint doi: https://doi.org/10.1101/2020.06.20.163253; this version posted June 21, 2020. The copyright holder for this preprint (which was not certified by peer review) is the author/funder, who has granted bioRxiv a license to display the preprint in perpetuity. It is made available under aCC-BY-NC 4.0 International license. Redefining the specificity of phosphoinositide-binding by human PH domain-containing proteins Nilmani Singh1†, Adriana Reyes-Ordoñez1†, Michael A. Compagnone1, Jesus F. Moreno Castillo1, Benjamin J. Leslie2, Taekjip Ha2,3,4,5, Jie Chen1* 1Department of Cell & Developmental Biology, University of Illinois at Urbana-Champaign, Urbana, IL 61801; 2Department of Biophysics and Biophysical Chemistry, Johns Hopkins University School of Medicine, Baltimore, MD 21205; 3Department of Biophysics, Johns Hopkins University, Baltimore, MD 21218; 4Department of Biomedical Engineering, Johns Hopkins University, Baltimore, MD 21205; 5Howard Hughes Medical Institute, Baltimore, MD 21205, USA †These authors contributed equally to this work. *Correspondence: [email protected]. bioRxiv preprint doi: https://doi.org/10.1101/2020.06.20.163253; this version posted June 21, 2020. The copyright holder for this preprint (which was not certified by peer review) is the author/funder, who has granted bioRxiv a license to display the preprint in perpetuity. It is made available under aCC-BY-NC 4.0 International license. ABSTRACT Pleckstrin homology (PH) domains are presumed to bind phosphoinositides (PIPs), but specific interaction with and regulation by PIPs for most PH domain-containing proteins are unclear. Here we employed a single-molecule pulldown assay to study interactions of lipid vesicles with full-length proteins in mammalian whole cell lysates.
    [Show full text]
  • Orally Bioavailable Androgen Receptor Degrader, Potential Next
    Published OnlineFirst September 3, 2019; DOI: 10.1158/1078-0432.CCR-19-1458 Translational Cancer Mechanisms and Therapy Clinical Cancer Research Orally Bioavailable Androgen Receptor Degrader, Potential Next-Generation Therapeutic for Enzalutamide-Resistant Prostate Cancer Suriyan Ponnusamy1, Yali He2, Dong-Jin Hwang2, Thirumagal Thiyagarajan1, Rene Houtman3,Vera Bocharova4, Bobby G. Sumpter4, Elias Fernandez5, Daniel Johnson6, Ziyun Du7, Lawrence M. Pfeffer7, Robert H. Getzenberg8, Iain J. McEwan9, Duane D. Miller2, and Ramesh Narayanan1,10 Abstract Purpose: Androgen receptor (AR)-targeting prostate Results: UT-34 inhibits the wild-type and LBD-mutant cancer drugs, which are predominantly competitive ARs comparably and inhibits the in vitro proliferation and ligand-binding domain (LBD)-binding antagonists, are in vivo growth of enzalutamide-sensitive and -resistant pros- inactivated by common resistance mechanisms. It is tate cancer xenografts. In preclinical models, UT-34 induced important to develop next-generation mechanistically theregressionofenzalutamide-resistanttumorsatdoses distinct drugs to treat castration- and drug-resistant pros- when the AR is degraded; but, at lower doses, when the AR tate cancers. is just antagonized, it inhibits, without shrinking, the Experimental Design: Second-generation AR pan antag- tumors. This indicates that degradation might be a prereq- onist UT-34 was selected from a library of compounds uisite for tumor regression. Mechanistically, UT-34 promotes and tested in competitive AR binding and transactivation
    [Show full text]
  • RET Gene Fusions in Malignancies of the Thyroid and Other Tissues
    G C A T T A C G G C A T genes Review RET Gene Fusions in Malignancies of the Thyroid and Other Tissues Massimo Santoro 1,*, Marialuisa Moccia 1, Giorgia Federico 1 and Francesca Carlomagno 1,2 1 Department of Molecular Medicine and Medical Biotechnology, University of Naples “Federico II”, 80131 Naples, Italy; [email protected] (M.M.); [email protected] (G.F.); [email protected] (F.C.) 2 Institute of Endocrinology and Experimental Oncology of the CNR, 80131 Naples, Italy * Correspondence: [email protected] Received: 10 March 2020; Accepted: 12 April 2020; Published: 15 April 2020 Abstract: Following the identification of the BCR-ABL1 (Breakpoint Cluster Region-ABelson murine Leukemia) fusion in chronic myelogenous leukemia, gene fusions generating chimeric oncoproteins have been recognized as common genomic structural variations in human malignancies. This is, in particular, a frequent mechanism in the oncogenic conversion of protein kinases. Gene fusion was the first mechanism identified for the oncogenic activation of the receptor tyrosine kinase RET (REarranged during Transfection), initially discovered in papillary thyroid carcinoma (PTC). More recently, the advent of highly sensitive massive parallel (next generation sequencing, NGS) sequencing of tumor DNA or cell-free (cfDNA) circulating tumor DNA, allowed for the detection of RET fusions in many other solid and hematopoietic malignancies. This review summarizes the role of RET fusions in the pathogenesis of human cancer. Keywords: kinase; tyrosine kinase inhibitor; targeted therapy; thyroid cancer 1. The RET Receptor RET (REarranged during Transfection) was initially isolated as a rearranged oncoprotein upon the transfection of a human lymphoma DNA [1].
    [Show full text]
  • RET Aberrations in Diverse Cancers: Next-Generation Sequencing of 4,871 Patients Shumei Kato1, Vivek Subbiah2, Erica Marchlik3, Sheryl K
    Published OnlineFirst September 28, 2016; DOI: 10.1158/1078-0432.CCR-16-1679 Personalized Medicine and Imaging Clinical Cancer Research RET Aberrations in Diverse Cancers: Next-Generation Sequencing of 4,871 Patients Shumei Kato1, Vivek Subbiah2, Erica Marchlik3, Sheryl K. Elkin3, Jennifer L. Carter3, and Razelle Kurzrock1 Abstract Purpose: Aberrations in genetic sequences encoding the tyrosine (52/88)], cell cycle–associated genes [39.8% (35/88)], the PI3K kinase receptor RET lead to oncogenic signaling that is targetable signaling pathway [30.7% (27/88)], MAPK effectors [22.7% with anti-RET multikinase inhibitors. Understanding the compre- (20/88)], or other tyrosine kinase families [21.6% (19/88)]. hensive genomic landscape of RET aberrations across multiple RET fusions were mutually exclusive with MAPK signaling cancers may facilitate clinical trial development targeting RET. pathway alterations. All 72 patients harboring coaberrations Experimental Design: We interrogated the molecular portfolio had distinct genomic portfolios, and most [98.6% (71/72)] of 4,871 patients with diverse malignancies for the presence of had potentially targetable coaberrations with either an FDA- RET aberrations using Clinical Laboratory Improvement Amend- approved or an investigational agent. Two cases with lung ments–certified targeted next-generation sequencing of 182 or (KIF5B-RET) and medullary thyroid carcinoma (RET M918T) 236 gene panels. thatrespondedtoavandetanib(multikinase RET inhibitor)- Results: Among diverse cancers, RET aberrations were iden- containing regimen are shown. tified in 88 cases [1.8% (88/4, 871)], with mutations being Conclusions: RET aberrations were seen in 1.8% of diverse the most common alteration [38.6% (34/88)], followed cancers, with most cases harboring actionable, albeit dis- by fusions [30.7% (27/88), including a novel SQSTM1-RET] tinct, coexisting alterations.
    [Show full text]
  • DOK1 Purified Maxpab Rabbit Polyclonal Antibody (D01P)
    DOK1 purified MaxPab rabbit polyclonal antibody (D01P) Catalog # : H00001796-D01P 規格 : [ 100 ug ] List All Specification Application Image Product Rabbit polyclonal antibody raised against a full-length human DOK1 Western Blot (Transfected lysate) Description: protein. Immunogen: DOK1 (NP_001372.1, 1 a.a. ~ 481 a.a) full-length human protein. Sequence: MDGAVMEGPLFLQSQRFGTKRWRKTWAVLYPASPHGVARLEFFDHKG SSSGGGRGSSRRLDCKVIRLAECVSVAPVTVETPPEPGATAFRLDTAQR SHLLAADAPSSAAWVQTLCRNAFPKGSWTLAPTDNPPKLSALEMLENSL enlarge YSPTWEGSQFWVTVQRTEAAERCGLHGSYVLRVEAERLTLLTVGAQS QILEPLLSWPYTLLRRYGRDKVMFSFEAGRRCPSGPGTFTFQTAQGNDI FQAVETAIHRQKAQGKAGQGHDVLRADSHEGEVAEGKLPSPPGPQELL DSPPALYAEPLDSLRIAPCPSQDSLYSDPLDSTSAQAGEGVQRKKPLYW DLYEHAQQQLLKAKLTDPKEDPIYDEPEGLAPVPPQGLYDLPREPKDAW WCQARVKEEGYELPYNPATDDYAVPPPRSTKPLLAPKPQGPAFPEPGT ATGSGIKSHNSALYSQVQKSGASGSWDCGLSRVGTDKTGVKSEGST Host: Rabbit Reactivity: Human Quality Control Antibody reactive against mammalian transfected lysate. Testing: Storage Buffer: In 1x PBS, pH 7.4 Storage Store at -20°C or lower. Aliquot to avoid repeated freezing and thawing. Instruction: MSDS: Download Datasheet: Download Applications Western Blot (Transfected lysate) Western Blot analysis of DOK1 expression in transfected 293T cell line (H00001796-T01) by DOK1 MaxPab polyclonal antibody. Lane 1: DOK1 transfected lysate(52.40 KDa). Lane 2: Non-transfected lysate. Page 1 of 2 2016/5/20 Protocol Download Gene Information Entrez GeneID: 1796 GeneBank NM_001381 Accession#: Protein NP_001372.1 Accession#: Gene Name: DOK1 Gene Alias: MGC117395,MGC138860,P62DOK
    [Show full text]
  • Detection of a Rare BCR–ABL Tyrosine Kinase Fusion Protein in H929 Multiple Myeloma Cells Using Immunoprecipitation (IP)-Tandem Mass Spectrometry (MS/MS)
    Detection of a rare BCR–ABL tyrosine kinase fusion protein in H929 multiple myeloma cells using immunoprecipitation (IP)-tandem mass spectrometry (MS/MS) Susanne B. Breitkopfa,b, Min Yuana, German A. Pihanc, and John M. Asaraa,b,1 aDivision of Signal Transduction, Beth Israel Deaconess Medical Center, Boston, MA 02115; bDepartment of Medicine, Harvard Medical School, Boston, MA 02115; and cDepartment of Hematopathology, Beth Israel Deaconess Medical Center, Boston, MA 02115 Edited by Peter K. Vogt, The Scripps Research Institute, La Jolla, CA, and approved August 23, 2012 (received for review July 26, 2012) Hypothesis directed proteomics offers higher throughput over Here, we focused on a hypothesis-directed approach to identify global analyses. We show that immunoprecipitation (IP)–tandem the active signaling pathways that drive cancers. To this end, we mass spectrometry (LC-MS/MS) in H929 multiple myeloma (MM) immunoprecipitated proteins that have clinical significance in cell cancer cells led to the discovery of a rare and unexpected BCR– proliferation such as the central nodes in the AKT and ERK sig- ABL fusion, informing a therapeutic intervention using imatinib naling pathways. The p85 regulatory subunit of phosphoinositide- (Gleevec). BCR–ABL is the driving mutation in chronic myeloid leu- 3-kinase (PI3K) binds pYXXM motif-containing proteins to the kemia (CML) and is uncommon to other cancers. Three different IP– SRC homology 2 (SH2) domains of p85, thus recruiting the p110 MS experiments central to cell signaling pathways were sufficient to catalytic subunit to the plasma membrane for activation (5, 17). Activated p110 phosphorylates its lipid substrate phosphatidyli- discover a BCR–ABL fusion in H929 cells: phosphotyrosine (pY) pep- nositol-4,5-bisphosphate (PIP2) to phosphatidylinositol-3,4,5-tri- tide IP, p85 regulatory subunit of phosphoinositide-3-kinase (PI3K) phosphate (PIP3) and binds to the pleckstrin homology (PH) IP, and the GRB2 adaptor IP.
    [Show full text]
  • Signaling Opposing Roles in CD200 Receptor Downstream of Tyrosine
    Downstream of Tyrosine Kinase 1 and 2 Play Opposing Roles in CD200 Receptor Signaling Robin Mihrshahi and Marion H. Brown This information is current as J Immunol published online 15 November 2010 of October 1, 2021. http://www.jimmunol.org/content/early/2010/11/14/jimmun ol.1002858 Downloaded from Why The JI? Submit online. • Rapid Reviews! 30 days* from submission to initial decision • No Triage! Every submission reviewed by practicing scientists http://www.jimmunol.org/ • Fast Publication! 4 weeks from acceptance to publication *average Subscription Information about subscribing to The Journal of Immunology is online at: http://jimmunol.org/subscription Permissions Submit copyright permission requests at: by guest on October 1, 2021 http://www.aai.org/About/Publications/JI/copyright.html Email Alerts Receive free email-alerts when new articles cite this article. Sign up at: http://jimmunol.org/alerts The Journal of Immunology is published twice each month by The American Association of Immunologists, Inc., 1451 Rockville Pike, Suite 650, Rockville, MD 20852 All rights reserved. Print ISSN: 0022-1767 Online ISSN: 1550-6606. Published November 15, 2010, doi:10.4049/jimmunol.1002858 The Journal of Immunology Downstream of Tyrosine Kinase 1 and 2 Play Opposing Roles in CD200 Receptor Signaling Robin Mihrshahi and Marion H. Brown The CD200 receptor (CD200R) negatively regulates myeloid cells by interacting with its widely expressed ligand CD200. CD200R signals through a unique inhibitory pathway involving a direct interaction with the adaptor protein downstream of tyrosine kinase 2 (Dok2) and the subsequent recruitment and activation of Ras GTPase-activating protein (RasGAP). Ligand engagement of CD200R also results in tyrosine phosphorylation of Dok1, but this protein is not essential for inhibitory CD200R signaling in human myeloid cells.
    [Show full text]