Detection of a Rare BCR–ABL Tyrosine Kinase Fusion Protein in H929 Multiple Myeloma Cells Using Immunoprecipitation (IP)-Tandem Mass Spectrometry (MS/MS)

Total Page:16

File Type:pdf, Size:1020Kb

Detection of a Rare BCR–ABL Tyrosine Kinase Fusion Protein in H929 Multiple Myeloma Cells Using Immunoprecipitation (IP)-Tandem Mass Spectrometry (MS/MS) Detection of a rare BCR–ABL tyrosine kinase fusion protein in H929 multiple myeloma cells using immunoprecipitation (IP)-tandem mass spectrometry (MS/MS) Susanne B. Breitkopfa,b, Min Yuana, German A. Pihanc, and John M. Asaraa,b,1 aDivision of Signal Transduction, Beth Israel Deaconess Medical Center, Boston, MA 02115; bDepartment of Medicine, Harvard Medical School, Boston, MA 02115; and cDepartment of Hematopathology, Beth Israel Deaconess Medical Center, Boston, MA 02115 Edited by Peter K. Vogt, The Scripps Research Institute, La Jolla, CA, and approved August 23, 2012 (received for review July 26, 2012) Hypothesis directed proteomics offers higher throughput over Here, we focused on a hypothesis-directed approach to identify global analyses. We show that immunoprecipitation (IP)–tandem the active signaling pathways that drive cancers. To this end, we mass spectrometry (LC-MS/MS) in H929 multiple myeloma (MM) immunoprecipitated proteins that have clinical significance in cell cancer cells led to the discovery of a rare and unexpected BCR– proliferation such as the central nodes in the AKT and ERK sig- ABL fusion, informing a therapeutic intervention using imatinib naling pathways. The p85 regulatory subunit of phosphoinositide- (Gleevec). BCR–ABL is the driving mutation in chronic myeloid leu- 3-kinase (PI3K) binds pYXXM motif-containing proteins to the kemia (CML) and is uncommon to other cancers. Three different IP– SRC homology 2 (SH2) domains of p85, thus recruiting the p110 MS experiments central to cell signaling pathways were sufficient to catalytic subunit to the plasma membrane for activation (5, 17). Activated p110 phosphorylates its lipid substrate phosphatidyli- discover a BCR–ABL fusion in H929 cells: phosphotyrosine (pY) pep- nositol-4,5-bisphosphate (PIP2) to phosphatidylinositol-3,4,5-tri- tide IP, p85 regulatory subunit of phosphoinositide-3-kinase (PI3K) phosphate (PIP3) and binds to the pleckstrin homology (PH) IP, and the GRB2 adaptor IP. The pY peptides inform tyrosine kinase domain of the serine/threonine kinase AKT, which is frequently activity, p85 IP informs the activating adaptors and receptor tyro- elevated in cancers (18). We recently showed that we can immu- fi sine kinases (RTKs) involved in AKT activation and GRB2 IP identi es nopurify p85 and quantify the activating PI3K adaptors and RTKs RTKs and adaptors leading to ERK activation. Integration of the by targeted LC-MS/MS (5). In addition, we show here that we can CELL BIOLOGY bait–prey data from the three separate experiments identified the IP the growth-factor-receptor-bound protein 2 (GRB2) adaptor to BCR–ABL protein complex, which was confirmed by biochemistry, identify associated activators of the extracellular signal-regulated cytogenetic methods, and DNA sequencing revealed the e14a2 fu- kinase (ERK), which is also frequently elevated in cancers (19). sion transcript. The tyrosine phosphatase SHP2 and the GAB2 adap- GRB2 is an important SH2/SH3 adaptor protein linking receptor tor protein, important for MAPK signaling, were common to all tyrosine kinases (RTK) and downstream targets and has implica- three IP–MS experiments. The comparative treatment of tyrosine tions in malignancies (20). The SH2 domain of GRB2 binds to the kinase inhibitor (TKI) drugs revealed only imatinib, the standard of phosphorylated tyrosine residue of an adaptor protein or RTK and care in CML, was inhibitory to BCR–ABL leading to down-regulation the SH3 domain binds proteins such as SOS leading to RAS/RAF of pERK and pS6K and inhibiting cell proliferation. These data sug- binding and ERK activation (20, 21). Tyrosine phosphorylation gest a model for directed proteomics from patient tumor samples (pY) is one of the most important and most studied post- fi for selecting the appropriate TKI drug(s) based on IP and LC-MS/MS. translational modi cation (PTM) of proteins because it regulates The data also suggest that MM patients, in addition to CML patients, signaling pathway activity and important cellular functions in- may benefit from BCR–ABL diagnostic screening. cluding cell proliferation, growth, survival, etc. (22). Abnormalities in tyrosine kinases play a role in the pathogenesis of numerous inherited or acquired human diseases from cancer to immune targeted therapies | personalized medicine | protein–protein interactions deficiencies (23, 24). Enrichment of low-abundance tyrosine phosphorylated proteins is necessary for a successful compre- roteomics studies over the last decade have provided signifi- hensive LC-MS/MS analysis. One common method for gaining Pcant advancements in our understanding of the functional insight into a broad range of active tyrosine signaling pathways in landscape of proteins, their posttranslational modifications and a cell can be achieved by an IP–MS analysis of phosphotyrosine the protein–protein interactions (PPI) (1–3). This is especially containing peptides from tryptic digested cell lysates (25, 26). important for diseases such as cancer because proteins and their Here we show a clinically relevant example using our three- transient posttranslational modifications (PTMs) reflect the pronged IP–MS technology (p85 IP, GRB2 IP, and pY IP) in fi changes cells undergo during pathogenic development. Modern multiple myeloma (MM) cells and how we identi ed a rare high-resolution mass spectrometers are well suited for these breakpoint cluster region-Abl tyrosine kinase (BCR-ABL) fusion analyses and have led the efforts in this field of proteomics, protein by converging protein complexes and activated tyrosine kinases. BCR–ABL is unexpected in MM because, unlike the allowing researchers to analyze dynamic changes in cell lines or leukemias and lymphomas, MM typically has no specific chro- tissue and to distinguish between normal and unhealthy states (4, mosomal abnormalities and is characterized by a genomic in- 5). PPI networks and phosphoproteomics are important for un- stability that involves both ploidy and structural translocation (27). derstanding the function and regulation of pathways leading to cell There have only been two reports of MM patients with a Phila- growth and proliferation in diseases such as cancer. The advantage delphia chromosome t(9;22)(q34;q11), a 64-y-old woman of analyzing purified protein complexes is the ability to identify specific interacting proteins and posttranslational modifications that may otherwise go undetected in large-scale global analyses. Author contributions: J.M.A. designed research; S.B.B., M.Y., G.A.P., and J.M.A. performed This can be achieved by performing an immunoprecipitation (IP) research; G.A.P. contributed new reagents/analytic tools; S.B.B., M.Y., G.A.P., and J.M.A. with a bait protein and analyzing the prey proteins using micro- analyzed data; and S.B.B. and J.M.A. wrote the paper. capillary–tandem mass spectrometry (LC-MS/MS) (6–13). These The authors declare no conflict of interest. experiments have included various types of affinity tags and have This article is a PNAS Direct Submission. been overlaid with RNAi genetic screens (14, 15). Undoubtedly, 1To whom correspondence should be addressed. E-mail: [email protected]. PPI networks provide a valuable framework for a better un- This article contains supporting information online at www.pnas.org/lookup/suppl/doi:10. derstanding of the functional organization of the proteome (16). 1073/pnas.1212759109/-/DCSupplemental. www.pnas.org/cgi/doi/10.1073/pnas.1212759109 PNAS Early Edition | 1of6 Downloaded by guest on September 28, 2021 presenting a P190 BCR–ABL hybrid transcript by PCR analysis ments and the protein products from identified phosphopeptides (28) and a 61-y-old man showing BCR–ABL-positive bone mar- from the pY IP are then correlated in a simple network to clarify row after autologous bone marrow transplantation (29). which upstream RTK and adaptor proteins may be involved in The mass spectrometry results were verified using biochemistry promoting cell proliferation in cancers. and histological analyses as well as DNA sequencing and com- pared with an array of MM cell lines and the K562 chronic my- Case Study Using H929 MM Cells. H929 cells as well as other MM eloid leukemia (CML) cell line known to contain a BCR–ABL cells were investigated to explore which kinase signaling pathways fusion. We show that imatinib (trade name Gleevec) selectively may be responsible for driving proliferation and to explore whether inhibits signaling in H929 cells and halts cell proliferation. This any recently developed TKI drugs would be useful in inhibiting these report shows the molecular investigation of BCR–ABL fusion in cell lines. H929 cells are known to have a rearrangement of the MM, and the results should serve as a template for the use of c-Myc proto-oncogene and express c-Myc RNA and an activated N hypothesis directed proteomics on human tumor samples or cell -RAS allele. They are positive for plasma cell antigen 1 (PCA-1), lines derived from tumors for aiding the appropriate therapeutic transferrin receptor and CD38 (T10), but are negative for HLA selection of single or combinations of TKI drugs in patients. DR, CALLA, and markers of early B-cell development (31, 32). p85 IP–MS PPI landscape. The PPI landscape of p85 (PI3K) was in- Results vestigated as the first phase in identifying drivers of cell pro- liferation in MM cells. H929 cells were lysed, and a polyclonal Analysis of Activating Signaling Pathways Using a Multifaceted antibody recognizing the p85 regulatory subunit of PI3K was used Hypothesis-Directed Proteomics Approach.
Recommended publications
  • The Proximal Signaling Network of the BCR-ABL1 Oncogene Shows a Modular Organization
    Oncogene (2010) 29, 5895–5910 & 2010 Macmillan Publishers Limited All rights reserved 0950-9232/10 www.nature.com/onc ORIGINAL ARTICLE The proximal signaling network of the BCR-ABL1 oncogene shows a modular organization B Titz, T Low, E Komisopoulou, SS Chen, L Rubbi and TG Graeber Crump Institute for Molecular Imaging, Institute for Molecular Medicine, Jonsson Comprehensive Cancer Center, California NanoSystems Institute, Department of Molecular and Medical Pharmacology, University of California, Los Angeles, CA, USA BCR-ABL1 is a fusion tyrosine kinase, which causes signaling effects of BCR-ABL1 toward leukemic multiple types of leukemia. We used an integrated transformation. proteomic approach that includes label-free quantitative Oncogene (2010) 29, 5895–5910; doi:10.1038/onc.2010.331; protein complex and phosphorylation profiling by mass published online 9 August 2010 spectrometry to systematically characterize the proximal signaling network of this oncogenic kinase. The proximal Keywords: adaptor protein; BCR-ABL1; phospho- BCR-ABL1 signaling network shows a modular and complex; quantitative mass spectrometry; signaling layered organization with an inner core of three leukemia network; systems biology transformation-relevant adaptor protein complexes (Grb2/Gab2/Shc1 complex, CrkI complex and Dok1/ Dok2 complex). We introduced an ‘interaction direction- ality’ analysis, which annotates static protein networks Introduction with information on the directionality of phosphorylation- dependent interactions. In this analysis, the observed BCR-ABL1 is a constitutively active oncogenic fusion network structure was consistent with a step-wise kinase that arises through a chromosomal translocation phosphorylation-dependent assembly of the Grb2/Gab2/ and causes multiple types of leukemia. It is found in Shc1 and the Dok1/Dok2 complexes on the BCR-ABL1 many cases (B25%) of adult acute lymphoblastic core.
    [Show full text]
  • Host-Pathogen Systems Biology: Logical Modelling of Hepatocyte
    BMC Systems Biology BioMed Central Research article Open Access Host-pathogen systems biology: logical modelling of hepatocyte growth factor and Helicobacter pylori induced c-Met signal transduction Raimo Franke†1, Melanie Müller†1, Nicole Wundrack1, Ernst-Dieter Gilles2, Steffen Klamt2, Thilo Kähne1 and Michael Naumann*1 Address: 1Institute of Experimental Internal Medicine, Otto von Guericke University, Leipziger Str. 44, 39120 Magdeburg, Germany and 2Max Planck Institute for Dynamics of Complex Technical Systems, Sandtorstrasse 1, 39106 Magdeburg, Germany Email: Raimo Franke - [email protected]; Melanie Müller - [email protected]; Nicole Wundrack - [email protected]; Ernst-Dieter Gilles - [email protected]; Steffen Klamt - Klamt@mpi- magdeburg.mpg.de; Thilo Kähne - [email protected]; Michael Naumann* - [email protected] * Corresponding author †Equal contributors Published: 14 January 2008 Received: 3 October 2007 Accepted: 14 January 2008 BMC Systems Biology 2008, 2:4 doi:10.1186/1752-0509-2-4 This article is available from: http://www.biomedcentral.com/1752-0509/2/4 © 2008 Franke et al; licensee BioMed Central Ltd. This is an Open Access article distributed under the terms of the Creative Commons Attribution License (http://creativecommons.org/licenses/by/2.0), which permits unrestricted use, distribution, and reproduction in any medium, provided the original work is properly cited. Abstract Background: The hepatocyte growth factor (HGF) stimulates mitogenesis, motogenesis, and morphogenesis in a wide range of tissues, including epithelial cells, on binding to the receptor tyrosine kinase c-Met. Abnormal c-Met signalling contributes to tumour genesis, in particular to the development of invasive and metastatic phenotypes.
    [Show full text]
  • RET/PTC Activation in Papillary Thyroid Carcinoma
    European Journal of Endocrinology (2006) 155 645–653 ISSN 0804-4643 INVITED REVIEW RET/PTC activation in papillary thyroid carcinoma: European Journal of Endocrinology Prize Lecture Massimo Santoro1, Rosa Marina Melillo1 and Alfredo Fusco1,2 1Istituto di Endocrinologia ed Oncologia Sperimentale del CNR ‘G. Salvatore’, c/o Dipartimento di Biologia e Patologia Cellulare e Molecolare, University ‘Federico II’, Via S. Pansini, 5, 80131 Naples, Italy and 2NOGEC (Naples Oncogenomic Center)–CEINGE, Biotecnologie Avanzate & SEMM, European School of Molecular Medicine, Naples, Italy (Correspondence should be addressed to M Santoro; Email: [email protected]) Abstract Papillary thyroid carcinoma (PTC) is frequently associated with RET gene rearrangements that generate the so-called RET/PTC oncogenes. In this review, we examine the data about the mechanisms of thyroid cell transformation, activation of downstream signal transduction pathways and modulation of gene expression induced by RET/PTC. These findings have advanced our understanding of the processes underlying PTC formation and provide the basis for novel therapeutic approaches to this disease. European Journal of Endocrinology 155 645–653 RET/PTC rearrangements in papillary growth factor, have been described in a fraction of PTC thyroid carcinoma patients (7). As illustrated in figure 1, many different genes have been found to be rearranged with RET in The rearranged during tansfection (RET) proto-onco- individual PTC patients. RET/PTC1 and 3 account for gene, located on chromosome 10q11.2, was isolated in more than 90% of all rearrangements and are hence, by 1985 and shown to be activated by a DNA rearrange- far, the most frequent variants (8–11). They result from ment (rearranged during transfection) (1).As the fusion of RET to the coiled-coil domain containing illustrated in Fig.
    [Show full text]
  • Redefining the Specificity of Phosphoinositide-Binding by Human
    bioRxiv preprint doi: https://doi.org/10.1101/2020.06.20.163253; this version posted June 21, 2020. The copyright holder for this preprint (which was not certified by peer review) is the author/funder, who has granted bioRxiv a license to display the preprint in perpetuity. It is made available under aCC-BY-NC 4.0 International license. Redefining the specificity of phosphoinositide-binding by human PH domain-containing proteins Nilmani Singh1†, Adriana Reyes-Ordoñez1†, Michael A. Compagnone1, Jesus F. Moreno Castillo1, Benjamin J. Leslie2, Taekjip Ha2,3,4,5, Jie Chen1* 1Department of Cell & Developmental Biology, University of Illinois at Urbana-Champaign, Urbana, IL 61801; 2Department of Biophysics and Biophysical Chemistry, Johns Hopkins University School of Medicine, Baltimore, MD 21205; 3Department of Biophysics, Johns Hopkins University, Baltimore, MD 21218; 4Department of Biomedical Engineering, Johns Hopkins University, Baltimore, MD 21205; 5Howard Hughes Medical Institute, Baltimore, MD 21205, USA †These authors contributed equally to this work. *Correspondence: [email protected]. bioRxiv preprint doi: https://doi.org/10.1101/2020.06.20.163253; this version posted June 21, 2020. The copyright holder for this preprint (which was not certified by peer review) is the author/funder, who has granted bioRxiv a license to display the preprint in perpetuity. It is made available under aCC-BY-NC 4.0 International license. ABSTRACT Pleckstrin homology (PH) domains are presumed to bind phosphoinositides (PIPs), but specific interaction with and regulation by PIPs for most PH domain-containing proteins are unclear. Here we employed a single-molecule pulldown assay to study interactions of lipid vesicles with full-length proteins in mammalian whole cell lysates.
    [Show full text]
  • RET Gene Fusions in Malignancies of the Thyroid and Other Tissues
    G C A T T A C G G C A T genes Review RET Gene Fusions in Malignancies of the Thyroid and Other Tissues Massimo Santoro 1,*, Marialuisa Moccia 1, Giorgia Federico 1 and Francesca Carlomagno 1,2 1 Department of Molecular Medicine and Medical Biotechnology, University of Naples “Federico II”, 80131 Naples, Italy; [email protected] (M.M.); [email protected] (G.F.); [email protected] (F.C.) 2 Institute of Endocrinology and Experimental Oncology of the CNR, 80131 Naples, Italy * Correspondence: [email protected] Received: 10 March 2020; Accepted: 12 April 2020; Published: 15 April 2020 Abstract: Following the identification of the BCR-ABL1 (Breakpoint Cluster Region-ABelson murine Leukemia) fusion in chronic myelogenous leukemia, gene fusions generating chimeric oncoproteins have been recognized as common genomic structural variations in human malignancies. This is, in particular, a frequent mechanism in the oncogenic conversion of protein kinases. Gene fusion was the first mechanism identified for the oncogenic activation of the receptor tyrosine kinase RET (REarranged during Transfection), initially discovered in papillary thyroid carcinoma (PTC). More recently, the advent of highly sensitive massive parallel (next generation sequencing, NGS) sequencing of tumor DNA or cell-free (cfDNA) circulating tumor DNA, allowed for the detection of RET fusions in many other solid and hematopoietic malignancies. This review summarizes the role of RET fusions in the pathogenesis of human cancer. Keywords: kinase; tyrosine kinase inhibitor; targeted therapy; thyroid cancer 1. The RET Receptor RET (REarranged during Transfection) was initially isolated as a rearranged oncoprotein upon the transfection of a human lymphoma DNA [1].
    [Show full text]
  • Imatinib Dependent Tyrosine Phosphorylation Profiling of Bcr-Abl
    Provided by the author(s) and University College Dublin Library in accordance with publisher policies. Please cite the published version when available. Title Imatinib-dependent tyrosine phosphorylation profiling of Bcr-Abl-positive chronic myeloid leukemia cells Authors(s) Preisinger, C.; Schwarz, J. P.; Bleijerveld, O. B.; et al. Publication date 2012-08-27 Publication information Leukemia, 27 (3): 743-746 Publisher Nature Publishing Group Item record/more information http://hdl.handle.net/10197/5078 Publisher's version (DOI) 10.1038/leu.2012.243 Downloaded 2021-09-25T14:43:28Z The UCD community has made this article openly available. Please share how this access benefits you. Your story matters! (@ucd_oa) © Some rights reserved. For more information, please see the item record link above. 1 Imatinib dependent tyrosine phosphorylation profiling of Bcr-Abl 2 positive chronic myeloid leukemia cells 3 Bcr-Abl is the major cause and pathogenetic principle of chronic myeloid leukemia (CML). 4 Bcr-Abl results from a chromosomal translocation that fuses the bcr and the abl genes, 5 thereby generating a constitutively active tyrosine kinase, which stimulates several signaling 6 networks required for proliferation and survival. Bcr-Abl’s oncogenic properties comprise 7 both functions as a kinase and as a scaffold protein 1. A number of Bcr-Abl interaction 8 partners and downstream effectors have been described, improving our understanding of the 9 signaling networks deranged in CML. Brehme et al. recently defined the “core-interactome of 10 Bcr-Abl”, identifying seven major interaction partners of Bcr-Abl (GRB2, Shc1, Crk, c-Cbl, 11 p85, Sts-1, and SHIP-2) 2.
    [Show full text]
  • DOK1 Purified Maxpab Rabbit Polyclonal Antibody (D01P)
    DOK1 purified MaxPab rabbit polyclonal antibody (D01P) Catalog # : H00001796-D01P 規格 : [ 100 ug ] List All Specification Application Image Product Rabbit polyclonal antibody raised against a full-length human DOK1 Western Blot (Transfected lysate) Description: protein. Immunogen: DOK1 (NP_001372.1, 1 a.a. ~ 481 a.a) full-length human protein. Sequence: MDGAVMEGPLFLQSQRFGTKRWRKTWAVLYPASPHGVARLEFFDHKG SSSGGGRGSSRRLDCKVIRLAECVSVAPVTVETPPEPGATAFRLDTAQR SHLLAADAPSSAAWVQTLCRNAFPKGSWTLAPTDNPPKLSALEMLENSL enlarge YSPTWEGSQFWVTVQRTEAAERCGLHGSYVLRVEAERLTLLTVGAQS QILEPLLSWPYTLLRRYGRDKVMFSFEAGRRCPSGPGTFTFQTAQGNDI FQAVETAIHRQKAQGKAGQGHDVLRADSHEGEVAEGKLPSPPGPQELL DSPPALYAEPLDSLRIAPCPSQDSLYSDPLDSTSAQAGEGVQRKKPLYW DLYEHAQQQLLKAKLTDPKEDPIYDEPEGLAPVPPQGLYDLPREPKDAW WCQARVKEEGYELPYNPATDDYAVPPPRSTKPLLAPKPQGPAFPEPGT ATGSGIKSHNSALYSQVQKSGASGSWDCGLSRVGTDKTGVKSEGST Host: Rabbit Reactivity: Human Quality Control Antibody reactive against mammalian transfected lysate. Testing: Storage Buffer: In 1x PBS, pH 7.4 Storage Store at -20°C or lower. Aliquot to avoid repeated freezing and thawing. Instruction: MSDS: Download Datasheet: Download Applications Western Blot (Transfected lysate) Western Blot analysis of DOK1 expression in transfected 293T cell line (H00001796-T01) by DOK1 MaxPab polyclonal antibody. Lane 1: DOK1 transfected lysate(52.40 KDa). Lane 2: Non-transfected lysate. Page 1 of 2 2016/5/20 Protocol Download Gene Information Entrez GeneID: 1796 GeneBank NM_001381 Accession#: Protein NP_001372.1 Accession#: Gene Name: DOK1 Gene Alias: MGC117395,MGC138860,P62DOK
    [Show full text]
  • Signaling Opposing Roles in CD200 Receptor Downstream of Tyrosine
    Downstream of Tyrosine Kinase 1 and 2 Play Opposing Roles in CD200 Receptor Signaling Robin Mihrshahi and Marion H. Brown This information is current as J Immunol published online 15 November 2010 of October 1, 2021. http://www.jimmunol.org/content/early/2010/11/14/jimmun ol.1002858 Downloaded from Why The JI? Submit online. • Rapid Reviews! 30 days* from submission to initial decision • No Triage! Every submission reviewed by practicing scientists http://www.jimmunol.org/ • Fast Publication! 4 weeks from acceptance to publication *average Subscription Information about subscribing to The Journal of Immunology is online at: http://jimmunol.org/subscription Permissions Submit copyright permission requests at: by guest on October 1, 2021 http://www.aai.org/About/Publications/JI/copyright.html Email Alerts Receive free email-alerts when new articles cite this article. Sign up at: http://jimmunol.org/alerts The Journal of Immunology is published twice each month by The American Association of Immunologists, Inc., 1451 Rockville Pike, Suite 650, Rockville, MD 20852 All rights reserved. Print ISSN: 0022-1767 Online ISSN: 1550-6606. Published November 15, 2010, doi:10.4049/jimmunol.1002858 The Journal of Immunology Downstream of Tyrosine Kinase 1 and 2 Play Opposing Roles in CD200 Receptor Signaling Robin Mihrshahi and Marion H. Brown The CD200 receptor (CD200R) negatively regulates myeloid cells by interacting with its widely expressed ligand CD200. CD200R signals through a unique inhibitory pathway involving a direct interaction with the adaptor protein downstream of tyrosine kinase 2 (Dok2) and the subsequent recruitment and activation of Ras GTPase-activating protein (RasGAP). Ligand engagement of CD200R also results in tyrosine phosphorylation of Dok1, but this protein is not essential for inhibitory CD200R signaling in human myeloid cells.
    [Show full text]
  • The Tec Kinase−Regulated Phosphoproteome Reveals a Mechanism for the Regulation of Inhibitory Signals in Murine Macrophages
    The Tec Kinase−Regulated Phosphoproteome Reveals a Mechanism for the Regulation of Inhibitory Signals in Murine Macrophages This information is current as Giacomo Tampella, Hannah M. Kerns, Deqiang Niu, Swati of September 29, 2021. Singh, Socheath Khim, Katherine A. Bosch, Meghan E. Garrett, Albanus Moguche, Erica Evans, Beth Browning, Tahmina A. Jahan, Mariana Nacht, Alejandro Wolf-Yadlin, Alessandro Plebani, Jessica A. Hamerman, David J. Rawlings and Richard G. James Downloaded from J Immunol published online 29 May 2015 http://www.jimmunol.org/content/early/2015/05/29/jimmun ol.1403238 http://www.jimmunol.org/ Supplementary http://www.jimmunol.org/content/suppl/2015/05/29/jimmunol.140323 Material 8.DCSupplemental Why The JI? Submit online. • Rapid Reviews! 30 days* from submission to initial decision by guest on September 29, 2021 • No Triage! Every submission reviewed by practicing scientists • Fast Publication! 4 weeks from acceptance to publication *average Subscription Information about subscribing to The Journal of Immunology is online at: http://jimmunol.org/subscription Permissions Submit copyright permission requests at: http://www.aai.org/About/Publications/JI/copyright.html Email Alerts Receive free email-alerts when new articles cite this article. Sign up at: http://jimmunol.org/alerts The Journal of Immunology is published twice each month by The American Association of Immunologists, Inc., 1451 Rockville Pike, Suite 650, Rockville, MD 20852 Copyright © 2015 by The American Association of Immunologists, Inc. All rights reserved. Print ISSN: 0022-1767 Online ISSN: 1550-6606. Published May 29, 2015, doi:10.4049/jimmunol.1403238 The Journal of Immunology The Tec Kinase–Regulated Phosphoproteome Reveals a Mechanism for the Regulation of Inhibitory Signals in Murine Macrophages Giacomo Tampella,*,1 Hannah M.
    [Show full text]
  • Structure, Function, and Regulation of the SRMS Tyrosine Kinase
    International Journal of Molecular Sciences Review Structure, Function, and Regulation of the SRMS Tyrosine Kinase Chakia J. McClendon 1 and W. Todd Miller 1,2,* 1 Department of Physiology and Biophysics, Stony Brook University, Stony Brook, NY 11794-8661, USA; [email protected] 2 Department of Veterans Affairs Medical Center, Northport, NY 11768, USA * Correspondence: [email protected] Received: 21 May 2020; Accepted: 12 June 2020; Published: 14 June 2020 Abstract: Src-related kinase lacking C-terminal regulatory tyrosine and N-terminal myristoylation sites (SRMS) is a tyrosine kinase that was discovered in 1994. It is a member of a family of nonreceptor tyrosine kinases that also includes Brk (PTK6) and Frk. Compared with other tyrosine kinases, there is relatively little information about the structure, function, and regulation of SRMS. In this review, we summarize the current state of knowledge regarding SRMS, including recent results aimed at identifying downstream signaling partners. We also present a structural model for the enzyme and discuss the potential involvement of SRMS in cancer cell signaling. Keywords: tyrosine kinase; signal transduction; phosphorylation; SH3 domains; SH2 domains; Src family kinases 1. Introduction Src-related kinase lacking C-terminal regulatory tyrosine and N-terminal myristoylation sites (SRMS) is a 53 kDa nonreceptor tyrosine kinase that was first discovered in mouse neural precursor cells [1]. Studies of the expression pattern of SRMS mRNA showed that the highest levels were present in lung, testes, and liver tissues. Full-length cDNA encoding SRMS was isolated from a murine lung cDNA library, with the predicted SRMS protein containing all of the conserved amino acid residues expected for a nonreceptor tyrosine kinase.
    [Show full text]
  • Rabbit Anti-Phospho-DOK1-SL5290R-FITC
    SunLong Biotech Co.,LTD Tel: 0086-571- 56623320 Fax:0086-571- 56623318 E-mail:[email protected] www.sunlongbiotech.com Rabbit Anti-phospho-DOK1 SL5290R-FITC Product Name: Anti-phospho-DOK1 (Tyr398)/FITC Chinese Name: FITC标记的磷酸化D酪氨酸激酶衰减蛋白1抗体 DOK1 (phospho Y398); DOK1 (phospho Tyr398); p-DOK1 (phospho Y398); docking protein 1 (downstream of tyrosine kinase 1); Docking protein 1 (p62(dok)) (Downstream of tyrosine kinase 1) (pp62).; docking protein 1 62kD (downstream of Alias: tyrosine kinase 1); Docking protein 1 62kD; Docking protein 1 62kD; Docking protein 1; DOK 1; DOK1; DOK-1; DOK1_HUMAN; Downstream of tyrosine kinase 1; p62(dok); P62DOK; pp62; pp62. Organism Species: Rabbit Clonality: Polyclonal React Species: Human,Mouse,Rat,Dog,Pig,Cow,Horse, IF=1:50-200 Applications: not yet tested in other applications. optimal dilutions/concentrations should be determined by the end user. Molecular weight: 53kDa Form: Lyophilized or Liquid Concentration: 1mg/mlwww.sunlongbiotech.com KLH conjugated Synthesised phosphopeptide derived from human DOK1 around the immunogen: phosphorylation site of Tyr398 Lsotype: IgG Purification: affinity purified by Protein A Storage Buffer: 0.01M TBS(pH7.4) with 1% BSA, 0.03% Proclin300 and 50% Glycerol. Store at -20 °C for one year. Avoid repeated freeze/thaw cycles. The lyophilized antibody is stable at room temperature for at least one month and for greater than a year Storage: when kept at -20°C. When reconstituted in sterile pH 7.4 0.01M PBS or diluent of antibody the antibody is stable for at least two weeks at 2-4 °C. background: Product Detail: Docking protein 1 is constitutively tyrosine phosphorylated in hematopoietic progenitors isolated from chronic myelogenous leukemia (CML) patients in the chronic phase.
    [Show full text]
  • Ephrin-B1 Forward Signaling Regulates Craniofacial Morphogenesis by Controlling Cell Proliferation Across Eph–Ephrin Boundaries
    Downloaded from genesdev.cshlp.org on September 28, 2021 - Published by Cold Spring Harbor Laboratory Press Ephrin-B1 forward signaling regulates craniofacial morphogenesis by controlling cell proliferation across Eph–ephrin boundaries Jeffrey O. Bush1 and Philippe Soriano1,2 Program in Developmental Biology and Division of Basic Sciences, Fred Hutchinson Cancer Research Center, Seattle, Washington 98109, USA; and Department of Developmental and Regenerative Biology, Mt. Sinai School of Medicine, New York, New York 10029, USA Mutations in the X-linked human EPHRIN-B1 gene result in cleft palate and other craniofacial anomalies as part of craniofrontonasal syndrome (CFNS), but the molecular and developmental mechanisms by which ephrin-B1 controls the underlying developmental processes are not clear. Here we demonstrate that ephrin-B1 plays an intrinsic role in palatal shelf outgrowth in the mouse by regulating cell proliferation in the anterior palatal shelf mesenchyme. In ephrin-B1 heterozygous mutants, X inactivation generates ephrin-B1-expressing and -nonex- pressing cells that sort out, resulting in mosaic ephrin-B1 expression. We now show that this process leads to mosaic disruption of cell proliferation and post-transcriptional up-regulation of EphB receptor expression through relief of endocytosis and degradation. The alteration in proliferation rates resulting from ectopic Eph–ephrin expression boundaries correlates with the more severe dysmorphogenesis of ephrin-B1+/À heterozygotes that is a hallmark of CFNS. Finally, by integrating phosphoproteomic and transcriptomic approaches, we show that ephrin-B1 controls proliferation in the palate by regulating the extracellular signal-regulated kinase/mitogen- activated protein kinase (ERK/MAPK) signal transduction pathway. [Keywords: Ephrin; cell proliferation; ERK/MAPK; endocytosis; boundaries; craniofrontonasal syndrome; palate] Supplemental material is available at http://www.genesdev.org.
    [Show full text]