ADORABLE Barn 19 Hip No
Total Page:16
File Type:pdf, Size:1020Kb
Load more
Recommended publications
-
Pacific Wind Captures the G2 Ruffian at Belmont Park
PASSPORT Pacific Wind captures the G2 Ruffian at Belmont Park OVERVIEW G2 winner/G1Placed on the DIRT G2 placed on the TURF By leading sire CURLIN Half-Sister to multiple Graded Stakes Winner PACIFIC WIND HIP Curlin x Shag, by Dixieland Band 163 BARN 9 Selling Tuesday, November 5th PAST PERFORMANCES G1Ws G2Ws G1W GSP G2W G2W Pacific Wind put together an unforgettable debut performance winning by 4 ½ lengths (Replay) over a mile on the turf at Santa Anita and was anointed as a TDN ‘Rising Star’ for her efforts. Pacific Wind becomes a ‘Rising Star’ with a 4 ½ length, debut win at Santa Anita. She would earn graded blacktype in her next two races, finishing 3rd in both the G2 Honeymoon and the G3 Senorita, both over the TURF at Santa Anita. Later in her three-year-old season, she was tried on the dirt for the first time over 1 1/16 miles at Santa Anita and responded with a 1 ¾ lengths win (Replay), earning a then career best Beyer of 93, beating future G2W/G1P LA FORCE At four, she was sent east to the barn of Chad Brown, who brought her back in an allowance race at Keeneland over a mile on the dirt where she crushed her foes by 8 ¼ lengths (Replay), beating G1W SAILOR'S VALENTINE. Her (22) Thoro-Graph figure in this race matched the number that G1W SHE'S A JULIE earned when winning this year’s G1 La Troienne. Next out, she was sent off favored in the G2 Ruffian over a mile at Belmont Park, where she won by a length (Replay), defeating G2 winners HIGHWAY STAR, TEQUILITA, FAYPIEN and UNCHAINED MELODY. -
SMART STRIKE B, 1992
SMART STRIKE b, 1992 height 16.0 Dosage (20-7-17-0-2); DI: 3.38; CD: 0.93 RACE AND (STAKES) RECORD See gray pages—Polynesian Age Starts 1st 2nd 3rd Earned Native Dancer, 1950 Polynesian, by Unbreakable 22s, SW, $785,240 2 0 0 0 0 — Raise a Native, 1961 304 f, 43 SW, 4.06 AEI Geisha, by Discovery 3 4 3 1 0 $51,416 4s, SW, $45,955 4 4 3(2) 0 0 $285,960 838 f, 78 SW, 2.34 AEI Raise You, 1946 Case Ace, by Teddy 24s, SW, $37,220 Totals 8 6(2) 1 0 $337,376 Mr. Prospector, b, 1970 14s, SW, $112,171 14 f, 12 r, 11 w, 2 SW Lady Glory, by American Flag Won Philip H. Iselin H (gr. I, 8.5f), Salvator Mile H 1,178 f, 181 SW, 3.98 AEI Nashua, 1952 Nasrullah, by Nearco (gr. III, 8f). 7.62 AWD 30s, SW, $1,288,565 SIRE LINE Gold Digger, 1962 638 f, 77 SW, 2.37 AEI Segula, by Johnstown 35s, SW, $127,255 SMART STRIKE is by MR. PROSPECTOR, stakes 12 f, 7 r, 7 w, 3 SW Sequence, 1946 Count Fleet, by Reigh Count winner of $112,171, Gravesend H, etc., and sire of 181 17s, SW, $54,850 stakes winners, including champions CONQUISTADOR 8 f, 8 r, 8 w, 3 SW Miss Dogwood, by Bull Dog CIELO (Horse of the Year and champion 3yo colt), Cyane, 1959 Turn-to, by Royal Charger RAVINELLA (in Eur, Eng, and Fr), GULCH, FORTY NINER, 14s, SW, $176,367 ALDEBARAN, RHYTHM, IT’S IN THE AIR, GOLDEN Smarten, 1976 401 f, 47 SW, 2.34 AEI Your Game, by Beau Pere 27s, SW, $716,426 ATTRACTION, EILLO, QUEENA, MACHIAVELLIAN, etc. -
ADORABLE Barn 43 & 44 Hip No
Consigned by Paramount Sales, Agent for The Complete Dispersal of McCauley Farms, LLC Hip No. ADORABLE Barn 800 Bay Mare; foaled 2014 43 & 44 Raise a Native Mr. Prospector .................. Gold Digger Smart Strike ...................... Smarten Classy 'n Smart ................ No Class ADORABLE Is It True Yes It's True ...................... Clever Monique Cautionary Tale ................ (2007) Meadowlake Urmia ................................ Chaldea By SMART STRIKE (1992). Black-type winner of $337,376, Philip H. Iselin H. [G1] , etc. Leading sire twice, sire of 18 crops of racing age, 1592 foals, 1231 starters, 122 black-type winners, 12 champions, 903 winners of 2884 races and earning $139,257,505. Sire of dams of 75 black-type winners, including champions Mine That Bird, Inglorious, Eye of the Leopard, Stacked Deck, Desert Power, Smart D N A, Cowboy Son, and of Strong Return, Dullahan, Shared Account, First Dude, Dixie Strike, Stryker Phd. 1st dam CAUTIONARY TALE, by Yes It's True. Winner at 4, $46,016. Dam of 4 registered foals, 3 of racing age, including a 2-year-old of 2017, 2 to race, 1 winner-- Adorable (f. by Smart Strike). Black-type-placed, see record. Truly Striking (f. by Smart Strike). Winner at 3, $17,699. 2nd dam URMIA, by Meadowlake. Unraced. Dam of 7 other winners, including-- SOUL WARRIOR (c. by Lion Heart). 4 wins, 2 to 7, $668,652, West Virginia Derby [G2] (MNR, $457,500), 2nd Iowa Derby [L] (PRM, $50,000). MY MISS STORM CAT (f. by Sea of Secrets). 5 wins in 7 starts, 2 to 4, $190,026, Desert Stormer H. (HOL, $39,810), 3rd Landaluce S. -
STRIKE FREE Barn 12 Hip No
Consigned by Bluewater Sales LLC, Agent V Hip No. STRIKE FREE Barn 460 Dark Bay or Brown Mare; foaled 2013 12 Raise a Native Mr. Prospector ...................... Gold Digger Smart Strike .......................... Smarten Classy 'n Smart .................... No Class STRIKE FREE Harlan Menifee ................................ Anne Campbell Wow Me Free ........................ (2004) With Approval Double Wow ........................ Triple Wow By SMART STRIKE (1992). Black-type winner of $337,376, Philip H. Iselin H. [G1] , etc. Leading sire twice, sire of 19 crops of racing age, 1596 foals, 1292 starters, 136 black-type winners, 14 champions, 964 winners of 3196 races and earning $154,050,388. Sire of dams of 111 black-type winners, including champions Mine That Bird, Inglorious, Eye of the Leopard, Stacked Deck, Moonlit Promise, Desert Power, Smart D N A, Cowboy Son, and of Strong Return, Dullahan, Shared Account, First Dude, Dixie Strike. 1st dam WOW ME FREE , by Menifee. 5 wins, 2 to 4, $204,202, in N.A./U.S., Next Move H. [G3] (AQU, $63,840), Ladies H. [L] (AQU, $48,630), 3rd Shuvee H. [G2] (BEL, $15,000), Wide Country S. (LRL, $5,500). (Total: $215,739). Dam of 7 other registered foals, 6 of racing age, 6 to race, 2 winners-- Treasury Bill (c. by Lemon Drop Kid). 5 wins, 3 to 9, $318,707, 2nd San Vi - cente S. [G2] (SA, $30,000), Buddy Diliberto Memorial S. (FG, $10,000), 3rd Came Home S. (BHP, $8,622). Moon Launch (g. by Malibu Moon). Winner at 3 and 4, 2020, $46,417. 2nd dam DOUBLE WOW, by With Approval. -
Fashionably Late
drf.com/breeding DAILY RACING FORM Sunday, February 9, 2014 PAGE 11 fashionably late JOHN P. SPARKMAN As the stud career of the late, great Storm Cat began to wind down in the early 2000s, the Kentucky breeding indus- try needed a successor as the designated young sire of sires. The obvious choice seemed to be Unbridled’s Song, who had begun his stud career brilliantly, with Breeders’ Cup Distaff winner Unbridled Elaine, Grade 1 winner Songandaprayer, and multiple Grade 2 winner Even the Score in his first crop and Grade 1 winner Buddha in his second. As recently as the middle of last year, however, the investment the breeding industry made in sons of Unbridled’s Song looked like an expensive wager gone very wrong, since Even the Score, the sire of Dullahan and Take the Points, was his only son to have sired a Grade 1 winner. That lackluster record began to improve dramatically in the last half of the year, as Unbridled’s Song’s sons First Defence, Benoit & AssociAtes Dunkirk, and Rockport Harbor all added Fashion Plate wins the Las Virgenes Stakes on Feb. 1, becoming the first Grade 1 Grade 1 winners to their stud records. winner for Unbridled’s Song’s son Old Fashioned. After last Saturday’s Grade 1 Las Virgenes Stakes at Santa Anita, another Honest Man, both by Unbridled’s Song, with similar disdain in the 1 1/8-mile, name can be added to that list, a name that were only a few months away from their Grade 2 Remsen Stakes at Aqueduct a could turn out to be the most promising maiden victories. -
Graydar Oxbow
GRAYDAR OXBOW We have enjoyed tremendous success in standing/managing stallions over the last 20 years. KRIS S. SAINT BALLADO UNBRIDLED’S SONG 2 Dear Breeder, Taylor Made is a family owned and operated farm built on honesty, long-lasting relationships and horsemanship. Taylor Made Stallions’ mode of operation has always been – and remains – to focus on standing quality stallions that provide breeders great opportunities, whether they are breeding to race or sell. 2013 was a bounce-back year for commercial breeders, including a GSVRIVXYVRMRK/IIRIPERH7ITXIQFIVWEPIXLEXWE[KEMRWEGVSWWXLIFSEVHLMKLPMKLXIHF]WIZIR½KYVI]IEVPMRKWERHFSEWXMRK the third highest average of all time. The recent market results have proven that the well-conformed individual has re-emerged as the most important component SJEFY]IV´WWIPIGXMSRGVMXIVME,IVIEX8E]PSV1EHI[IQEOIWYVIIEGLSJSYVWXEPPMSRWVI¾IGXXLEXGSQTSRIRX3YVXIEQLEW been highly selective in providing the breeder a top group of well-conformed stallions whose progeny will be well received at the track and in the sales ring. Last year also marked a bittersweet landmark for one of the great sires of our time. While reaching 17 Grade 1 winners over his historic career in 2013, Unbridled’s Song passed away at the age of 20. Every person at Taylor Made has been touched by this amazing animal over the years. He leaves a lasting legacy that will never be forgotten across the industry he served so well. And yet there is much to look forward to in 2014. The legacy continues with our newest stallion, Graydar, the Grade 1-winning son of Unbridled’s Song. One of the most stunning physicals to come to the breeding shed in years, Graydar had a brilliant VEGIGEVIIVMRGPYHMRKEGSQQERHMRKZMGXSV]MRXLI(SRR,ERHMGET + EX+YPJWXVIEQ4EVO;IEVIGSR½HIRXLI[MPPFI a favorite among breeders as Taylor Made Stallions adds another chapter to its storied tradition. -
Trainers Steve Asmussen Thomas Albertrani
TRAINERS TRAINERS THOMAS ALBERTRANI Bernardini: Jockey Club Gold Cup (2006); Scott and Eric Mark Travers (2006); Jim Dandy (2006); Preakness (2006); Withers (2006) 2015 RECORD Brilliant Speed: Saranac (2011); Blue Grass 1,499 252 252 217 $10,768,759 (2011) Buffum: Bold Ruler (2012) NATIONAL/ECLIPSE CHAMPIONS Criticism: Long Island (2008-09); Sheepshead Curlin: Horse of the Year (2007-08), Top Older Bay (2009) Male (2008), Top 3-Year-Old Male (2007) Empire Dreams: Empire Classic (2015); Kodiak Kowboy: Top Male Sprinter (2009) Birthdate - March 21, 1958 Commentator (2015); NYSS Great White Way My Miss Aurelia: Top 2-Year-Old Filly (2011) Birthplace - Brooklyn, NY (2013) Rachel Alexandra: Horse of the Year (2009), Residence - Garden City, NY Flashing: Nassau County (2009) Top 3-Year-Old Filly (2009) Family - Wife Fonda, daughters Teal and Noelle Gozzip Girl: American Oaks (2009); Sands Untapable: Top 3-Year-Old Filly (2014) Point (2009) 2015 RECORD Love Cove: Ticonderoga (2008) NEW YORK TRAINING TITLES 338 36 41 52 $3,253,692 Miss Frost: Riskaverse (2014) * 2010 Aqueduct spring, 12 victories Oratory: Peter Pan (2005) NATIONAL/ECLIPSE CHAMPION Raw Silk: Sands Point (2008) CAREER HIGHLIGHTS Bernardini: Top 3-Year-Old Male (2006) Ready for Rye: Quick Call (2015); Allied Forces * Campaigned 3-Year-Old Filly Champion (2015) Untapable in 2014, which included four Grade CAREER HIGHLIGHTS Romansh: Excelsior H. (2014); Discovery H. 1 wins: the Kentucky Oaks, the Mother Goose, * Trained Bernardini, who won the Preakness, (2013); Curlin (2013) the -
SYMPATHETIC Barn 45 & 46 Hip No. 1224
Consigned by Lane's End, Agent Barn SYMPATHETIC Hip No. 45 & 46 Dark Bay or Brown Mare; foaled 2014 1224 Raise a Native Mr. Prospector ...................... Gold Digger Smart Strike .......................... Smarten Classy 'n Smart .................... No Class SYMPATHETIC Vice Regent Deputy Minister .................... Mint Copy Initiation ................................ (2005) Mt. Livermore Proposal ................................ Lady of Choice By SMART STRIKE (1992). Black-type winner of $337,376, Philip H. Iselin H. [G1] , etc. Leading sire twice, sire of 19 crops of racing age, 1596 foals, 1292 starters, 136 black-type winners, 14 champions, 964 winners of 3196 races and earning $154,050,388. Sire of dams of 111 black-type winners, including champions Mine That Bird, Inglorious, Eye of the Leopard, Stacked Deck, Moonlit Promise, Desert Power, Smart D N A, Cowboy Son, and of Strong Return, Dullahan, Shared Account, First Dude, Dixie Strike. 1st dam INITIATION , by Deputy Minister. Winner at 2, $75,000, in Canada, Glorious Song S. [L] (WO, $75,000); winner at 2, $44,438, in N.A./U.S. (Total: $121,463). Dam of 6 other registered foals, 5 of racing age, 5 to race, 5 winners, incl.-- Forward Thinker (g. by Indian Charlie). 6 wins, 3 to 5, $190,706, 3rd Al - phabet Soup H.-R (PRX, $11,000), Leemat S.-R (PID, $8,250). Elysian (f. by Smart Strike). 3 wins at 3 and 5, $104,497. Brice (g. by Flatter). Winner at 3, 2020, $24,140. Sanguine. (f. by Quality Road). Winner at 4, 2020, $23,125. 2nd dam Proposal , by Mt. Livermore. 2 wins to 4, $115,021, 2nd Dearly Precious S. -
LIZ HUNTER Barn 37 Hip No
Consigned by James M. Herbener Jr., Agent IV Hip No. LIZ HUNTER Barn 879 Bay Mare; foaled 2006 37 Raise a Native Mr. Prospector .................. Gold Digger Smart Strike ...................... Smarten Classy 'n Smart ................ No Class LIZ HUNTER Exclusive Native Affirmed ............................ Won't Tell You Daisyago .......................... (1999) Northern Dancer Ladyago ............................ Queen of Song By SMART STRIKE (1992). Black-type winner of $337,376, Philip H. Iselin H. [G1] , etc. Leading sire twice, sire of 18 crops of racing age, 1592 foals, 1245 starters, 125 black-type winners, 12 champions, 911 winners of 2921 races and earning $141,503,289. Sire of dams of 78 black-type winners, including champions Mine That Bird, Inglorious, Eye of the Leopard, Stacked Deck, Desert Power, Smart D N A, Cowboy Son, and of Strong Return, Dullahan, Shared Account, First Dude, Dixie Strike, Stryker Phd. 1st dam Daisyago , by Affirmed. 3 wins at 2 and 3, $262,589, 2nd Hopemont S. [L] (KEE, $22,360), 3rd Miesque S. [G3] . Dam of 8 other registered foals, 8 of racing age, 7 to race, 6 winners, including-- Victory Nor Defeat (c. by Unbridled's Song). 2 wins at 3, $91,852, 3rd Super Derby [G2] (LAD, $40,000), Cherokee Run S. (GP, $7,050). Cheonjaeilu (c. by City Zip). Winner at 3, 2017 in Republic of Korea. 2nd dam LADYAGO , by Northern Dancer. 6 wins, 2 to 4, $116,439, Audubon Oaks (ELP, $18,090), 2nd American Beauty S. (RD, $5,640), etc. Half-sister to Pri - vate Song [G2] , Easy Song , Wise Words , Aspiring Diva . Dam of-- Daisyago (f. -
September Yearling Sale 75Th Annual
September Yearling Sale 75th Annual The Keeneland September Yearling Sale has evolved from humble beginnings to become the global marketplace for Thoroughbred yearlings. From 1944, the inaugural year, through 1948, the fall yearlings were sold in an auction which included broodmares, weanlings, stallions and horses of other ages. In 1949, approximately half of the yearlings were sold in a separate October sale and the remainder in a November mixed stock sale as usual. In 1950, the yearlings were sold separately by session, but in the same week as the other stock. In 1951, the fall yearling sales were set farther apart from the fall mixed stock sale, with the yearling auctions preceding the other sale by a week or more. In 1960, the yearling sales were moved to September. In 1981, the yearling sale was held in two four-day segments. Selected sessions were inaugurated in 1989. Coolmore’s M.V. Magnier paid $2.7 million for the highest-priced horse of the 2017 Keeneland September Yearling Sale, a filly by Tapit who is a full sister to 2017 Gold Cup at Santa Anita (G1) Keeneland/Photos by Z Keeneland/Photos winner Cupid. Highest Prices — September Yearling Sale Colts Price Horse Breeding Purchaser Consignor Year $11,700,000 Meydan City (Kingmambo-Crown of Crimson) John Ferguson Burleson Farms, agent 2006 9,700,000 Jalil (Storm Cat-Tranquility Lake) John Ferguson Mill Ridge Sales, agent for 2005 Mr. and Mrs. Martin J. Wygod 9,200,000 Plavius (Danzig-Sharp Minister) John Ferguson Monticule 2006 8,200,000 Act of Diplomacy (Storm Cat-Awesome Humor) John Ferguson Taylor Made Sales Agency, agent 2006 8,000,000 Mr. -
138904 08 Juvenilefillies.Pdf
breeders’ cup JUVENILE FILLIES BREEDERs’ Cup JUVENILE FILLIES (GR. I) 30th Running Santa Anita Park $2,000,000 Guaranteed FOR FILLIES, TWO-YEARS-OLD ONE MILE AND ONE-SIXTEENTH Weight, 122 lbs. Guaranteed $2 million purse including travel awards, of which 55% of all monies to the owner of the winner, 18% to second, 10% to third, 6% to fourth and 3% to fifth; plus travel awards to starters not based in California. The maximum number of starters for the Breeders’ Cup Juvenile Fillies will be limited to fourteen (14). If more than fourteen (14) horses pre-enter, selection will be determined by a combination of Breeders’ Cup Challenge winners, Graded Stakes points and the Breeders’ Cup Racing Secretaries and Directors panel. Please refer to the 2013 Breeders’ Cup World Championships Horsemen’s Information Guide (available upon request) for more information. Nominated Horses Breeders’ Cup Racing Office Pre-Entry Fee: 1% of purse Santa Anita Park Entry Fee: 1% of purse 285 W. Huntington Dr. Arcadia, CA 91007 Phone: (859) 514-9422 To Be Run Saturday, November 2, 2013 Fax: (859) 514-9432 Pre-Entries Close Monday, October 22, 2013 E-mail: [email protected] Pre-entries for the Breeders' Cup Juvenile Fillies (G1) Horse Owner Trainer Artemis Agrotera Chestertown Farm Michael E. Hushion B.f.2 Roman Ruler - Indy Glory by A.P. Indy - Bred in New York by Chester Broman & Mary R. Broman Concave Reddam Racing, LLC Doug O'Neill B.f.2 Colonel John - Galadriel by Ascot Knight - Bred in Ontario by Windways Farm Limited Dancing House Godolphin Racing, LLC Kiaran P. -
Wins Special Eclipse Award Woodford Lacrosse Team Improves
THE WOODFORD SUN, Versailles, Ky. January 12, 2012 13 2011 Eclipse Award fi nalists announced BY RICK CAPONE WOODFORD SUN SPORTS EDITOR The fi nalists for the 41st annual Eclipse Awards were announced on Thursday, Jan. 5. News and notes in horse racing The awards are voted for by members of the National Thoroughbred Racing Association, National Turf Writ- ers and Broadcasters and the Daily Racing Form. Of the 267 eligible voters, 248 responded this year to help select champions in 17 categories. There were not many surprises, as many of the horses Rapid Redux earns his just reward after 22nd that were expected to be fi nalists were on the list. Among others, the fi nalists include Havre de Grace, Blind Luck and Awesome Maria for Older Female Champion; consecutive victory; wins Special Eclipse Award Royal Delta, Plum Pretty and It’s Tricky for Three-Year-Old BY RICK CAPONE Filly Champion; Hansen, Union Rags and Creative Cause WOODFORD SUN SPORTS EDITOR for Two-Year-Old Male Champion and My Miss Aurelia, Stephanie’s Kitten and Grace Hall for Two-Year-Old CThe only thing missing from the list were the fi nalists for Horse The loveable six-year of the Year, which are not announced until the night of the old chestnut gelding, Rapid award show. Redux, had an award winning The Eclipse Awards will be handed out in a ceremony on week last week. Jan. 16 at the Beverly Wilshire in Beverly Hills, Calif. It began last Wednesday, Here is a listing of the 2011 Eclipse Award fi nalists.